F402513
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 314 | 247 | 628 | 97 |
Family's Representative Sequence
| Representative Sequence | 3300003911|JGI25405J52794_10081701|JGI25405J52794_100817012 |
| Length | 113 |
| Sequence | MGYLNIHPQHSSWRSTVSVNIKPLEDRLVIKVVEAEQTTASGLVIPDTAKEKPQEGEVLAVGPGRVDDNGNRVPLDVNVGDKVIFSKYGGTEVKYSGEELLILSARDVLAVVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 19 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 20 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 21 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 22 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 23 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 27 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300013052 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 29 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 36 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 37 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 38 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 39 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 40 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 41 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 42 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 43 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 44 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 45 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 61 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 62 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 63 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 64 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 65 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 66 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 67 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 68 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 69 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 70 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 71 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 72 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 73 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 74 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 75 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 76 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 77 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 78 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 79 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 80 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 81 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 82 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 83 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 84 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 86 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 87 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 88 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 89 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 90 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 91 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 92 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 93 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 94 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 95 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 96 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 97 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 98 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 99 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 100 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 101 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 102 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 103 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 104 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 105 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 106 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 107 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 108 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 109 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 110 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 111 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 112 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 113 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 114 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 115 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 116 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 119 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 121 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 122 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 123 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 166 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 167 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 168 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 169 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 170 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 171 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 172 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 173 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 174 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 176 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 199 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 200 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 201 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 202 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 203 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 204 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 205 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 206 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 207 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 208 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 209 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 210 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 211 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 212 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 213 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 214 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 215 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 216 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 217 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 218 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 219 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 220 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 221 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 222 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 223 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 224 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 225 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 226 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 227 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 228 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 229 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 230 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 231 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 232 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 233 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 234 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 235 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 236 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 237 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 238 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 239 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 240 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 241 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 242 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 243 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 244 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 245 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 246 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 247 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 65.92 |
| Metatranscriptomes | 18.79 |
| Isolates | 15.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.64 |
| Bulb | 0 |
| Endosphere | 4.46 |
| Nodule | 0 |
| Rhizoplane | 1.59 |
| Rhizosphere | 81.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25405J52794_10081701 | 3300003911 | Bacteria | 711 |
| 2 | Ga0058863_11941044 | 3300004799 | Bacteria | 580 |
| 3 | Ga0058861_12046996 | 3300004800 | Bacteria | 751 |
| 4 | Ga0058862_12864829 | 3300004803 | Bacteria | 816 |
| 5 | Ga0065714_10216280 | 3300005288 | Bacteria | 853 |
| 6 | Ga0070658_10086939 | 3300005327 | Bacteria | 2572 |
| 7 | Ga0070658_10446793 | 3300005327 | Bacteria | 1114 |
| 8 | Ga0068869_101098126 | 3300005334 | Bacteria | 696 |
| 9 | Ga0070682_100855161 | 3300005337 | Bacteria | 744 |
| 10 | Ga0070682_101176958 | 3300005337 | Bacteria | 646 |
| 11 | Ga0068868_101271646 | 3300005338 | Bacteria | 683 |
| 12 | Ga0070660_101411237 | 3300005339 | Bacteria | 592 |
| 13 | Ga0070692_10134154 | 3300005345 | Bacteria | 1395 |
| 14 | Ga0070692_10324715 | 3300005345 | Bacteria | 948 |
| 15 | Ga0070668_101727778 | 3300005347 | Bacteria | 575 |
| 16 | Ga0070659_100101397 | 3300005366 | Bacteria | 2317 |
| 17 | Ga0070714_100003328 | 3300005435 | Bacteria | 11980 |
| 18 | Ga0070681_10553100 | 3300005458 | Bacteria | 1065 |
| 19 | Ga0070679_100404060 | 3300005530 | Bacteria | 1312 |
| 20 | Ga0070664_102156513 | 3300005564 | Bacteria | 529 |
| 21 | Ga0068858_100712403 | 3300005842 | Bacteria | 977 |
| 22 | Ga0081455_10000106 | 3300005937 | Bacteria | 93286 |
| 23 | Ga0075363_100605297 | 3300006048 | Bacteria | 657 |
| 24 | Ga0075364_10024344 | 3300006051 | Bacteria | 3843 |
| 25 | Ga0075370_10368201 | 3300006353 | Bacteria | 860 |
| 26 | Ga0105240_10532035 | 3300009093 | Bacteria | 1303 |
| 27 | Ga0105242_11739034 | 3300009176 | Bacteria | 661 |
| 28 | Ga0105242_12132769 | 3300009176 | Bacteria | 605 |
| 29 | Ga0105249_10445566 | 3300009553 | Bacteria | 1333 |
| 30 | Ga0105249_11090757 | 3300009553 | Bacteria | 868 |
| 31 | Ga0105030_122697 | 3300009987 | Bacteria | 572 |
| 32 | Ga0105246_11263369 | 3300011119 | Bacteria | 682 |
| 33 | Ga0154014_110940 | 3300013052 | Bacteria | 539 |
| 34 | Ga0157370_10728731 | 3300013104 | Bacteria | 904 |
| 35 | Ga0157369_10328777 | 3300013105 | Bacteria | 1588 |
| 36 | Ga0157369_11788022 | 3300013105 | Bacteria | 624 |
| 37 | Ga0157378_12042929 | 3300013297 | Bacteria | 623 |
| 38 | Ga0157372_11624040 | 3300013307 | Bacteria | 744 |
| 39 | Ga0157375_13307139 | 3300013308 | Bacteria | 537 |
| 40 | Ga0157380_12430034 | 3300014326 | Bacteria | 589 |
| 41 | Ga0182006_1158155 | 3300015261 | Bacteria | 765 |
| 42 | Ga0182005_1222837 | 3300015265 | Bacteria | 574 |
| 43 | Ga0197907_11191523 | 3300020069 | Bacteria | 611 |
| 44 | Ga0197907_11454344 | 3300020069 | Bacteria | 709 |
| 45 | Ga0206356_10609498 | 3300020070 | Bacteria | 1337 |
| 46 | Ga0206355_1291832 | 3300020076 | Bacteria | 675 |
| 47 | Ga0206351_10073400 | 3300020077 | Bacteria | 1379 |
| 48 | Ga0206354_10335464 | 3300020081 | Bacteria | 1111 |
| 49 | Ga0206354_11001573 | 3300020081 | Bacteria | 557 |
| 50 | Ga0154015_1240952 | 3300020610 | Bacteria | 533 |
| 51 | Ga0154015_1422545 | 3300020610 | Bacteria | 979 |
| 52 | Ga0224712_10167562 | 3300022467 | Bacteria | 983 |
| 53 | Ga0209759_1045884 | 3300025256 | Bacteria | 711 |
| 54 | Ga0207688_10359964 | 3300025901 | Bacteria | 898 |
| 55 | Ga0207647_10546630 | 3300025904 | Bacteria | 643 |
| 56 | Ga0207705_10571183 | 3300025909 | Bacteria | 879 |
| 57 | Ga0207707_10272488 | 3300025912 | Bacteria | 1467 |
| 58 | Ga0207671_10420893 | 3300025914 | Bacteria | 1063 |
| 59 | Ga0207662_10650826 | 3300025918 | Bacteria | 736 |
| 60 | Ga0207657_10695190 | 3300025919 | Bacteria | 790 |
| 61 | Ga0207652_10351949 | 3300025921 | Bacteria | 1329 |
| 62 | Ga0207664_10044536 | 3300025929 | Bacteria | 3475 |
| 63 | Ga0207664_11174957 | 3300025929 | Bacteria | 685 |
| 64 | Ga0207690_10023748 | 3300025932 | Bacteria | 3831 |
| 65 | Ga0207690_10622913 | 3300025932 | Bacteria | 882 |
| 66 | Ga0207706_10107829 | 3300025933 | Bacteria | 2451 |
| 67 | Ga0207686_10270195 | 3300025934 | Bacteria | 1250 |
| 68 | Ga0207686_11759933 | 3300025934 | Bacteria | 513 |
| 69 | Ga0207661_11208734 | 3300025944 | Bacteria | 695 |
| 70 | Ga0207675_100195651 | 3300026118 | Bacteria | 1941 |
| 71 | Ga0207683_10954341 | 3300026121 | Bacteria | 796 |
| 72 | Ga0314311_1248299 | 3300030733 | Bacteria | 748 |
| 73 | Ga0316179_1047948 | 3300030734 | Bacteria | 1013 |
| 74 | Ga0316183_1190494 | 3300030742 | Bacteria | 967 |
| 75 | Ga0316182_1073605 | 3300030745 | Bacteria | 1606 |
| 76 | Ga0316575_10075170 | 3300031665 | Bacteria | 1359 |
| 77 | Ga0316579_10165239 | 3300031691 | Bacteria | 1069 |
| 78 | Ga0316576_10000044 | 3300031727 | Bacteria | 38025 |
| 79 | Ga0316576_10040116 | 3300031727 | Bacteria | 3363 |
| 80 | Ga0316578_10557900 | 3300031728 | Bacteria | 672 |
| 81 | Ga0307405_10509708 | 3300031731 | Bacteria | 966 |
| 82 | Ga0316577_10202231 | 3300031733 | Bacteria | 1122 |
| 83 | Ga0307407_10201513 | 3300031903 | Bacteria | 1334 |
| 84 | Ga0307412_10302084 | 3300031911 | Bacteria | 1266 |
| 85 | Ga0307412_10397589 | 3300031911 | Bacteria | 1121 |
| 86 | Ga0307412_12145819 | 3300031911 | Bacteria | 519 |
| 87 | Ga0307409_100166129 | 3300031995 | Bacteria | 1937 |
| 88 | Ga0307409_101406969 | 3300031995 | Bacteria | 724 |
| 89 | Ga0307416_100893853 | 3300032002 | Bacteria | 988 |
| 90 | Ga0307414_10592844 | 3300032004 | Bacteria | 993 |
| 91 | Ga0307411_10745184 | 3300032005 | Bacteria | 858 |
| 92 | Ga0307411_12254197 | 3300032005 | Bacteria | 511 |
| 93 | Ga0316583_10009358 | 3300032133 | Bacteria | 3527 |
| 94 | Ga0316585_10037519 | 3300032137 | Bacteria | 1538 |
| 95 | Ga0316580_10015165 | 3300032139 | Bacteria | 2355 |
| 96 | Ga0316593_10013181 | 3300032168 | Bacteria | 2443 |
| 97 | Ga0316593_10104525 | 3300032168 | Bacteria | 1007 |
| 98 | Ga0307510_10309677 | 3300033180 | Bacteria | 1039 |
| 99 | Ga0316592_1078866 | 3300033524 | Bacteria | 748 |
| 100 | Ga0316588_1008505 | 3300033528 | Bacteria | 2115 |
| 101 | Ga0316587_1028237 | 3300033529 | Bacteria | 983 |
| 102 | Ga0316587_1071577 | 3300033529 | Bacteria | 649 |
| 103 | Ga0316596_1007657 | 3300033541 | Bacteria | 2557 |
| 104 | Ga0316596_1085990 | 3300033541 | Bacteria | 846 |
| 105 | Ga0316574_0054410 | 3300035398 | Bacteria | 2499 |
| 106 | Ga0316582_0178372 | 3300036647 | Bacteria | 1444 |
| 107 | Ga0316582_0384401 | 3300036647 | Bacteria | 966 |
| 108 | Ga0316584_0069522 | 3300036712 | Bacteria | 2639 |
| 109 | Ga0316584_0501034 | 3300036712 | Bacteria | 853 |
| 110 | Ga0316584_0656913 | 3300036712 | Bacteria | 722 |
| 111 | Ga0395900_0426939 | 3300037418 | Bacteria | 1285 |
| 112 | Ga0395898_0207684 | 3300037466 | Bacteria | 1869 |
| 113 | Ga0395898_0425142 | 3300037466 | Bacteria | 1266 |
| 114 | Ga0395898_0783962 | 3300037466 | Bacteria | 894 |
| 115 | Ga0316581_0038005 | 3300037588 | Bacteria | 1463 |
| 116 | Ga0395901_1537573 | 3300038443 | Bacteria | 620 |
| 117 | Ga0395901_1554703 | 3300038443 | Bacteria | 616 |
| 118 | Ga0400485_17720 | 3300038735 | Bacteria | 15081 |
| 119 | Ga0400488_03030 | 3300038741 | Bacteria | 7443 |
| 120 | Ga0400486_24539 | 3300038742 | Bacteria | 23507 |
| 121 | Ga0400483_129587 | 3300039062 | Bacteria | 4638 |
| 122 | Ga0400483_168137 | 3300039062 | Bacteria | 3650 |
| 123 | Ga0400483_264403 | 3300039062 | Bacteria | 3292 |
| 124 | Ga0439465_0108482 | 3300041413 | Bacteria | 964 |
| 125 | Ga0451793_0142424 | 3300041452 | Bacteria | 2756 |
| 126 | Ga0451833_0902602 | 3300041491 | Bacteria | 4378 |
| 127 | Ga0451837_1135319 | 3300041494 | Bacteria | 2099 |
| 128 | Ga0451839_1531844 | 3300041496 | Bacteria | 1845 |
| 129 | Ga0451843_1091548 | 3300041509 | Bacteria | 540 |
| 130 | Ga0439452_099772 | 3300042010 | Bacteria | 624 |
| 131 | Ga0439454_117481 | 3300042011 | Bacteria | 512 |
| 132 | Ga0439446_0068745 | 3300042156 | Bacteria | 1081 |
| 133 | Ga0439434_0120684 | 3300042435 | Bacteria | 855 |
| 134 | Ga0439459_0067638 | 3300042438 | Bacteria | 820 |
| 135 | Ga0466965_0019526 | 3300044683 | Bacteria | 3254 |
| 136 | Ga0466966_0156445 | 3300044684 | Bacteria | 1388 |
| 137 | Ga0466966_0988065 | 3300044684 | Bacteria | 508 |
| 138 | Ga0466961_0176464 | 3300044693 | Bacteria | 1327 |
| 139 | Ga0466961_0214597 | 3300044693 | Bacteria | 1187 |
| 140 | Ga0466963_0389147 | 3300044694 | Bacteria | 983 |
| 141 | Ga0466970_0054172 | 3300044765 | Bacteria | 2142 |
| 142 | Ga0466960_0173874 | 3300044901 | Bacteria | 1164 |
| 143 | Ga0466960_0638848 | 3300044901 | Bacteria | 634 |
| 144 | Ga0466959_0135280 | 3300045049 | Bacteria | 1745 |
| 145 | Ga0466958_0167708 | 3300045836 | Bacteria | 1390 |
| 146 | Ga0466967_0410755 | 3300045976 | Bacteria | 1318 |
| 147 | Ga0495597_0336645 | 3300046542 | Bacteria | 581 |
| 148 | Ga0495673_0322731 | 3300047469 | Bacteria | 550 |
| 149 | Ga0496105_1362216 | 3300048908 | Bacteria | 515 |
| 150 | Ga0496108_1767863 | 3300048911 | Bacteria | 507 |
| 151 | Ga0496111_0947933 | 3300048914 | Bacteria | 618 |
| 152 | Ga0496112_0150423 | 3300048915 | Bacteria | 2295 |
| 153 | Ga0496126_0017011 | 3300048929 | Bacteria | 7255 |
| 154 | Ga0496126_1091865 | 3300048929 | Bacteria | 593 |
| 155 | Ga0501306_055047 | 3300049127 | Bacteria | 646 |
| 156 | Ga0501309_007096 | 3300049129 | Bacteria | 1381 |
| 157 | Ga0501310_058996 | 3300049130 | Bacteria | 569 |
| 158 | Ga0501316_025620 | 3300049532 | Bacteria | 768 |
| 159 | Ga0501316_048490 | 3300049532 | Bacteria | 607 |
| 160 | Ga0501317_096675 | 3300049533 | Bacteria | 528 |
| 161 | Ga0501318_024445 | 3300049534 | Bacteria | 786 |
| 162 | Ga0501318_036979 | 3300049534 | Bacteria | 685 |
| 163 | Ga0501321_018937 | 3300049537 | Bacteria | 839 |
| 164 | Ga0501321_053670 | 3300049537 | Bacteria | 595 |
| 165 | Ga0501321_089440 | 3300049537 | Bacteria | 500 |
| 166 | Ga0501323_022906 | 3300049539 | Bacteria | 835 |
| 167 | Ga0501325_021948 | 3300049541 | Bacteria | 679 |
| 168 | Ga0501336_035619 | 3300049552 | Bacteria | 503 |
| 169 | Ga0501031_0078045 | 3300049568 | Bacteria | 2157 |
| 170 | Ga0501031_0361528 | 3300049568 | Bacteria | 939 |
| 171 | Ga0501032_0195254 | 3300049569 | Bacteria | 1322 |
| 172 | Ga0501033_0256681 | 3300049570 | Bacteria | 1238 |
| 173 | Ga0501033_0332493 | 3300049570 | Bacteria | 1066 |
| 174 | Ga0501036_0260574 | 3300049572 | Bacteria | 1452 |
| 175 | Ga0501036_1066408 | 3300049572 | Bacteria | 660 |
| 176 | Ga0501037_0116805 | 3300049573 | Bacteria | 1920 |
| 177 | Ga0501037_0651108 | 3300049573 | Bacteria | 704 |
| 178 | Ga0501038_0126878 | 3300049574 | Bacteria | 2099 |
| 179 | Ga0501038_0301580 | 3300049574 | Bacteria | 1257 |
| 180 | Ga0501039_0019447 | 3300049575 | Bacteria | 5207 |
| 181 | Ga0501039_0232485 | 3300049575 | Bacteria | 1449 |
| 182 | Ga0501040_0037287 | 3300049576 | Bacteria | 3302 |
| 183 | Ga0501040_0072819 | 3300049576 | Bacteria | 2373 |
| 184 | Ga0501040_1025531 | 3300049576 | Bacteria | 598 |
| 185 | Ga0501041_0072458 | 3300049577 | Bacteria | 2116 |
| 186 | Ga0501041_0092226 | 3300049577 | Bacteria | 1870 |
| 187 | Ga0501042_0032149 | 3300049578 | Bacteria | 3715 |
| 188 | Ga0501042_0046031 | 3300049578 | Bacteria | 3110 |
| 189 | Ga0501043_0405902 | 3300049579 | Bacteria | 1029 |
| 190 | Ga0501046_0628542 | 3300049580 | Bacteria | 760 |
| 191 | Ga0501047_0174902 | 3300049581 | Bacteria | 2014 |
| 192 | Ga0501048_0043383 | 3300049582 | Bacteria | 3219 |
| 193 | Ga0501048_0063377 | 3300049582 | Bacteria | 2615 |
| 194 | Ga0501067_0462777 | 3300049583 | Bacteria | 709 |
| 195 | Ga0501068_0120889 | 3300049584 | Bacteria | 1633 |
| 196 | Ga0501069_0124607 | 3300049585 | Bacteria | 1473 |
| 197 | Ga0501069_0703710 | 3300049585 | Bacteria | 609 |
| 198 | Ga0501070_0013869 | 3300049586 | Bacteria | 6787 |
| 199 | Ga0501070_1033887 | 3300049586 | Unclassified | 636 |
| 200 | Ga0501071_0027874 | 3300049587 | Bacteria | 3976 |
| 201 | Ga0501071_0093069 | 3300049587 | Bacteria | 2216 |
| 202 | Ga0501072_0019664 | 3300049588 | Bacteria | 5224 |
| 203 | Ga0501072_0304749 | 3300049588 | Bacteria | 1266 |
| 204 | Ga0501073_0000030 | 3300049589 | Bacteria | 115949 |
| 205 | Ga0501074_0091037 | 3300049590 | Bacteria | 2184 |
| 206 | Ga0501074_0284540 | 3300049590 | Bacteria | 1175 |
| 207 | Ga0501075_0008353 | 3300049591 | Bacteria | 7221 |
| 208 | Ga0501075_0152919 | 3300049591 | Bacteria | 1759 |
| 209 | Ga0501076_0028768 | 3300049592 | Bacteria | 4318 |
| 210 | Ga0501076_0234804 | 3300049592 | Bacteria | 1499 |
| 211 | Ga0501077_0159037 | 3300049593 | Bacteria | 1434 |
| 212 | Ga0501079_0050692 | 3300049741 | Bacteria | 3204 |
| 213 | Ga0501079_0895686 | 3300049741 | Bacteria | 699 |
| 214 | Ga0501079_1151256 | 3300049741 | Bacteria | 611 |
| 215 | Ga0501080_0191254 | 3300049742 | Bacteria | 1880 |
| 216 | Ga0501081_0657981 | 3300049743 | Bacteria | 785 |
| 217 | Ga0501083_0493379 | 3300049744 | Bacteria | 797 |
| 218 | Ga0501035_0894623 | 3300049822 | Bacteria | 703 |
| 219 | Ga0501044_0096994 | 3300049823 | Bacteria | 2969 |
| 220 | Ga0501044_1350913 | 3300049823 | Bacteria | 579 |
| 221 | Ga0501044_1589462 | 3300049823 | Bacteria | 519 |
| 222 | Ga0501045_0012512 | 3300049824 | Bacteria | 5976 |
| 223 | Ga0501045_0068387 | 3300049824 | Bacteria | 2609 |
| 224 | nmdc:mga00v17_7705_c1 | 3300050491 | Bacteria | 5762 |
| 225 | nmdc:mga0yw44_49594_c1 | 3300050492 | Bacteria | 2535 |
| 226 | nmdc:mga0yw44_76202_c1 | 3300050492 | Bacteria | 2093 |
| 227 | nmdc:mga07m45_302546_c1 | 3300050496 | Bacteria | 930 |
| 228 | nmdc:mga07m45_920164_c1 | 3300050496 | Bacteria | 500 |
| 229 | nmdc:mga0sz30_9274_c1 | 3300050516 | Bacteria | 3738 |
| 230 | Ga0500556_0000426 | 3300053104 | Bacteria | 30343 |
| 231 | Ga0500562_006804 | 3300053108 | Bacteria | 2883 |
| 232 | Ga0500655_000662 | 3300053133 | Bacteria | 6832 |
| 233 | Ga0500559_0000050 | 3300053136 | Bacteria | 93262 |
| 234 | Ga0500568_0005034 | 3300053139 | Bacteria | 6922 |
| 235 | Ga0501084_0041637 | 3300054114 | Bacteria | 3843 |
| 236 | Ga0501084_0185172 | 3300054114 | Bacteria | 1757 |
| 237 | Ga0501084_1026904 | 3300054114 | Bacteria | 693 |
| 238 | Ga0590077_106515 | 3300059426 | Bacteria | 658 |
| 239 | Ga0587084_045529 | 3300059477 | Bacteria | 760 |
| 240 | Ga0587073_0017894 | 3300059492 | Bacteria | 1316 |
| 241 | Ga0587073_0079033 | 3300059492 | Bacteria | 812 |
| 242 | Ga0587077_096875 | 3300059493 | Bacteria | 702 |
| 243 | Ga0587080_163499 | 3300059503 | Bacteria | 524 |
| 244 | Ga0587082_141298 | 3300059504 | Bacteria | 562 |
| 245 | Ga0587085_088856 | 3300059506 | Bacteria | 635 |
| 246 | Ga0587086_115646 | 3300059507 | Bacteria | 508 |
| 247 | Ga0587089_100693 | 3300059509 | Bacteria | 524 |
| 248 | Ga0587090_040785 | 3300059510 | Bacteria | 816 |
| 249 | Ga0587095_011833 | 3300059514 | Bacteria | 752 |
| 250 | Ga0587106_060186 | 3300059605 | Bacteria | 696 |
| 251 | Ga0587101_053839 | 3300059623 | Bacteria | 701 |
| 252 | Ga0587109_067133 | 3300059624 | Bacteria | 768 |
| 253 | Ga0587115_110466 | 3300059626 | Bacteria | 519 |
| 254 | Ga0587067_104499 | 3300059640 | Bacteria | 660 |
| 255 | Ga0587068_052320 | 3300059641 | Bacteria | 767 |
| 256 | Ga0587069_028441 | 3300059642 | Bacteria | 888 |
| 257 | Ga0587069_090101 | 3300059642 | Bacteria | 612 |
| 258 | Ga0587072_087168 | 3300059643 | Bacteria | 683 |
| 259 | Ga0587076_035398 | 3300059645 | Bacteria | 907 |
| 260 | Ga0587071_071700 | 3300060344 | Bacteria | 756 |
| 261 | Ga0587111_0274464 | 3300060346 | Bacteria | 507 |
| 262 | Ga0501082_0151652 | 3300060353 | Bacteria | 2013 |
| 263 | Ga0501082_0564757 | 3300060353 | Bacteria | 995 |
| 264 | Ga0466962_0639040 | 3300061719 | Bacteria | 544 |
| 265 | Ga0530510_0149762 | 3300061734 | Bacteria | 1722 |
| 266 | Ga0530510_0540875 | 3300061734 | Bacteria | 884 |
| 267 | 2587863703 | 2585428094 | Bacteria | 3604039 |
| 268 | 2643734846 | 2643221542 | Bacteria | 3563959 |
| 269 | 2643753771 | 2643221546 | Bacteria | 2910897 |
| 270 | 2643783544 | 2643221553 | Bacteria | 3544260 |
| 271 | 2643847832 | 2643221566 | Bacteria | 3460379 |
| 272 | 2643994872 | 2643221597 | Bacteria | 3347721 |
| 273 | 2644173006 | 2643221630 | Bacteria | 3601215 |
| 274 | 2644182443 | 2643221632 | Bacteria | 3406696 |
| 275 | 2644456001 | 2643221681 | Bacteria | 3707866 |
| 276 | 2644538446 | 2643221697 | Bacteria | 3575694 |
| 277 | 2644679207 | 2643221724 | Bacteria | 3593515 |
| 278 | 2676473622 | 2675903058 | Bacteria | 6822861 |
| 279 | 2730228710 | 2728369380 | Bacteria | 3620317 |
| 280 | 2739202871 | 2738543005 | Bacteria | 5278128 |
| 281 | 2744958246 | 2744054611 | Bacteria | 5611514 |
| 282 | 2747953656 | 2747842429 | Bacteria | 3914386 |
| 283 | 2774378837 | 2773857758 | Bacteria | 3592392 |
| 284 | 2774381924 | 2773857759 | Bacteria | 2963774 |
| 285 | 2808628706 | 2808606306 | Bacteria | 3608896 |
| 286 | 2819667009 | 2818991458 | Bacteria | 4794049 |
| 287 | 2821269110 | 2821268502 | Bacteria | 3750023 |
| 288 | 2827632135 | 2827628540 | Bacteria | 6858585 |
| 289 | 2833709996 | 2833709550 | Bacteria | 4008291 |
| 290 | 2852665852 | 2852663356 | Bacteria | 4090475 |
| 291 | 2852678625 | 2852677369 | Bacteria | 3768884 |
| 292 | 2857712420 | 2857710386 | Bacteria | 3186771 |
| 293 | 2857724649 | 2857723135 | Bacteria | 4217853 |
| 294 | 2862993588 | 2862993130 | Bacteria | 3860849 |
| 295 | 2887446081 | 2887443736 | Bacteria | 4426037 |
| 296 | 2887485768 | 2887478801 | Bacteria | 8972725 |
| 297 | 2904510296 | 2904509784 | Bacteria | 3520416 |
| 298 | 2908678488 | 2908678064 | Bacteria | 3482747 |
| 299 | 2919070809 | 2919069694 | Bacteria | 3622919 |
| 300 | 2928142910 | 2928142448 | Bacteria | 5288925 |
| 301 | 2946034702 | 2946033335 | Bacteria | 3835514 |
| 302 | 2946043190 | 2946041624 | Bacteria | 4191385 |
| 303 | 2946081820 | 2946080515 | Bacteria | 4310960 |
| 304 | 2956941024 | 2956939328 | Bacteria | 3474458 |
| 305 | 2966926582 | 2966924647 | Bacteria | 3268643 |
| 306 | 2977230383 | 2977228692 | Bacteria | 3450105 |
| 307 | 2977239186 | 2977236895 | Bacteria | 3569373 |
| 308 | 2977252085 | 2977251589 | Bacteria | 2952848 |
| 309 | 2984543030 | 2984542743 | Bacteria | 3569378 |
| 310 | 2984593605 | 2984592036 | Bacteria | 3670284 |
| 311 | 3001120717 | 3001119090 | Bacteria | 3449530 |
| 312 | 8004183570 | 8004182704 | Bacteria | 3391155 |
| 313 | 8004213395 | 8004212874 | Bacteria | 2861420 |
| 314 | 8055035345 | 8055034563 | Bacteria | 3562128 |
| 315 | JGI25405J52794_10081701 | |||
| 316 | Ga0058863_11941044 | |||
| 317 | Ga0058861_12046996 | |||
| 318 | Ga0058862_12864829 | |||
| 319 | Ga0065714_10216280 | |||
| 320 | Ga0070658_10086939 | |||
| 321 | Ga0070658_10446793 | |||
| 322 | Ga0068869_101098126 | |||
| 323 | Ga0070682_100855161 | |||
| 324 | Ga0070682_101176958 | |||
| 325 | Ga0068868_101271646 | |||
| 326 | Ga0070660_101411237 | |||
| 327 | Ga0070692_10134154 | |||
| 328 | Ga0070692_10324715 | |||
| 329 | Ga0070668_101727778 | |||
| 330 | Ga0070659_100101397 | |||
| 331 | Ga0070714_100003328 | |||
| 332 | Ga0070681_10553100 | |||
| 333 | Ga0070679_100404060 | |||
| 334 | Ga0070664_102156513 | |||
| 335 | Ga0068858_100712403 | |||
| 336 | Ga0081455_10000106 | |||
| 337 | Ga0075363_100605297 | |||
| 338 | Ga0075364_10024344 | |||
| 339 | Ga0075370_10368201 | |||
| 340 | Ga0105240_10532035 | |||
| 341 | Ga0105242_11739034 | |||
| 342 | Ga0105242_12132769 | |||
| 343 | Ga0105249_10445566 | |||
| 344 | Ga0105249_11090757 | |||
| 345 | Ga0105030_122697 | |||
| 346 | Ga0105246_11263369 | |||
| 347 | Ga0154014_110940 | |||
| 348 | Ga0157370_10728731 | |||
| 349 | Ga0157369_10328777 | |||
| 350 | Ga0157369_11788022 | |||
| 351 | Ga0157378_12042929 | |||
| 352 | Ga0157372_11624040 | |||
| 353 | Ga0157375_13307139 | |||
| 354 | Ga0157380_12430034 | |||
| 355 | Ga0182006_1158155 | |||
| 356 | Ga0182005_1222837 | |||
| 357 | Ga0197907_11191523 | |||
| 358 | Ga0197907_11454344 | |||
| 359 | Ga0206356_10609498 | |||
| 360 | Ga0206355_1291832 | |||
| 361 | Ga0206351_10073400 | |||
| 362 | Ga0206354_10335464 | |||
| 363 | Ga0206354_11001573 | |||
| 364 | Ga0154015_1240952 | |||
| 365 | Ga0154015_1422545 | |||
| 366 | Ga0224712_10167562 | |||
| 367 | Ga0209759_1045884 | |||
| 368 | Ga0207688_10359964 | |||
| 369 | Ga0207647_10546630 | |||
| 370 | Ga0207705_10571183 | |||
| 371 | Ga0207707_10272488 | |||
| 372 | Ga0207671_10420893 | |||
| 373 | Ga0207662_10650826 | |||
| 374 | Ga0207657_10695190 | |||
| 375 | Ga0207652_10351949 | |||
| 376 | Ga0207664_10044536 | |||
| 377 | Ga0207664_11174957 | |||
| 378 | Ga0207690_10023748 | |||
| 379 | Ga0207690_10622913 | |||
| 380 | Ga0207706_10107829 | |||
| 381 | Ga0207686_10270195 | |||
| 382 | Ga0207686_11759933 | |||
| 383 | Ga0207661_11208734 | |||
| 384 | Ga0207675_100195651 | |||
| 385 | Ga0207683_10954341 | |||
| 386 | Ga0314311_1248299 | |||
| 387 | Ga0316179_1047948 | |||
| 388 | Ga0316183_1190494 | |||
| 389 | Ga0316182_1073605 | |||
| 390 | Ga0316575_10075170 | |||
| 391 | Ga0316579_10165239 | |||
| 392 | Ga0316576_10000044 | |||
| 393 | Ga0316576_10040116 | |||
| 394 | Ga0316578_10557900 | |||
| 395 | Ga0307405_10509708 | |||
| 396 | Ga0316577_10202231 | |||
| 397 | Ga0307407_10201513 | |||
| 398 | Ga0307412_10302084 | |||
| 399 | Ga0307412_10397589 | |||
| 400 | Ga0307412_12145819 | |||
| 401 | Ga0307409_100166129 | |||
| 402 | Ga0307409_101406969 | |||
| 403 | Ga0307416_100893853 | |||
| 404 | Ga0307414_10592844 | |||
| 405 | Ga0307411_10745184 | |||
| 406 | Ga0307411_12254197 | |||
| 407 | Ga0316583_10009358 | |||
| 408 | Ga0316585_10037519 | |||
| 409 | Ga0316580_10015165 | |||
| 410 | Ga0316593_10013181 | |||
| 411 | Ga0316593_10104525 | |||
| 412 | Ga0307510_10309677 | |||
| 413 | Ga0316592_1078866 | |||
| 414 | Ga0316588_1008505 | |||
| 415 | Ga0316587_1028237 | |||
| 416 | Ga0316587_1071577 | |||
| 417 | Ga0316596_1007657 | |||
| 418 | Ga0316596_1085990 | |||
| 419 | Ga0316574_0054410 | |||
| 420 | Ga0316582_0178372 | |||
| 421 | Ga0316582_0384401 | |||
| 422 | Ga0316584_0069522 | |||
| 423 | Ga0316584_0501034 | |||
| 424 | Ga0316584_0656913 | |||
| 425 | Ga0395900_0426939 | |||
| 426 | Ga0395898_0207684 | |||
| 427 | Ga0395898_0425142 | |||
| 428 | Ga0395898_0783962 | |||
| 429 | Ga0316581_0038005 | |||
| 430 | Ga0395901_1537573 | |||
| 431 | Ga0395901_1554703 | |||
| 432 | Ga0400485_17720 | |||
| 433 | Ga0400488_03030 | |||
| 434 | Ga0400486_24539 | |||
| 435 | Ga0400483_129587 | |||
| 436 | Ga0400483_168137 | |||
| 437 | Ga0400483_264403 | |||
| 438 | Ga0439465_0108482 | |||
| 439 | Ga0451793_0142424 | |||
| 440 | Ga0451833_0902602 | |||
| 441 | Ga0451837_1135319 | |||
| 442 | Ga0451839_1531844 | |||
| 443 | Ga0451843_1091548 | |||
| 444 | Ga0439452_099772 | |||
| 445 | Ga0439454_117481 | |||
| 446 | Ga0439446_0068745 | |||
| 447 | Ga0439434_0120684 | |||
| 448 | Ga0439459_0067638 | |||
| 449 | Ga0466965_0019526 | |||
| 450 | Ga0466966_0156445 | |||
| 451 | Ga0466966_0988065 | |||
| 452 | Ga0466961_0176464 | |||
| 453 | Ga0466961_0214597 | |||
| 454 | Ga0466963_0389147 | |||
| 455 | Ga0466970_0054172 | |||
| 456 | Ga0466960_0173874 | |||
| 457 | Ga0466960_0638848 | |||
| 458 | Ga0466959_0135280 | |||
| 459 | Ga0466958_0167708 | |||
| 460 | Ga0466967_0410755 | |||
| 461 | Ga0495597_0336645 | |||
| 462 | Ga0495673_0322731 | |||
| 463 | Ga0496105_1362216 | |||
| 464 | Ga0496108_1767863 | |||
| 465 | Ga0496111_0947933 | |||
| 466 | Ga0496112_0150423 | |||
| 467 | Ga0496126_0017011 | |||
| 468 | Ga0496126_1091865 | |||
| 469 | Ga0501306_055047 | |||
| 470 | Ga0501309_007096 | |||
| 471 | Ga0501310_058996 | |||
| 472 | Ga0501316_025620 | |||
| 473 | Ga0501316_048490 | |||
| 474 | Ga0501317_096675 | |||
| 475 | Ga0501318_024445 | |||
| 476 | Ga0501318_036979 | |||
| 477 | Ga0501321_018937 | |||
| 478 | Ga0501321_053670 | |||
| 479 | Ga0501321_089440 | |||
| 480 | Ga0501323_022906 | |||
| 481 | Ga0501325_021948 | |||
| 482 | Ga0501336_035619 | |||
| 483 | Ga0501031_0078045 | |||
| 484 | Ga0501031_0361528 | |||
| 485 | Ga0501032_0195254 | |||
| 486 | Ga0501033_0256681 | |||
| 487 | Ga0501033_0332493 | |||
| 488 | Ga0501036_0260574 | |||
| 489 | Ga0501036_1066408 | |||
| 490 | Ga0501037_0116805 | |||
| 491 | Ga0501037_0651108 | |||
| 492 | Ga0501038_0126878 | |||
| 493 | Ga0501038_0301580 | |||
| 494 | Ga0501039_0019447 | |||
| 495 | Ga0501039_0232485 | |||
| 496 | Ga0501040_0037287 | |||
| 497 | Ga0501040_0072819 | |||
| 498 | Ga0501040_1025531 | |||
| 499 | Ga0501041_0072458 | |||
| 500 | Ga0501041_0092226 | |||
| 501 | Ga0501042_0032149 | |||
| 502 | Ga0501042_0046031 | |||
| 503 | Ga0501043_0405902 | |||
| 504 | Ga0501046_0628542 | |||
| 505 | Ga0501047_0174902 | |||
| 506 | Ga0501048_0043383 | |||
| 507 | Ga0501048_0063377 | |||
| 508 | Ga0501067_0462777 | |||
| 509 | Ga0501068_0120889 | |||
| 510 | Ga0501069_0124607 | |||
| 511 | Ga0501069_0703710 | |||
| 512 | Ga0501070_0013869 | |||
| 513 | Ga0501070_1033887 | |||
| 514 | Ga0501071_0027874 | |||
| 515 | Ga0501071_0093069 | |||
| 516 | Ga0501072_0019664 | |||
| 517 | Ga0501072_0304749 | |||
| 518 | Ga0501073_0000030 | |||
| 519 | Ga0501074_0091037 | |||
| 520 | Ga0501074_0284540 | |||
| 521 | Ga0501075_0008353 | |||
| 522 | Ga0501075_0152919 | |||
| 523 | Ga0501076_0028768 | |||
| 524 | Ga0501076_0234804 | |||
| 525 | Ga0501077_0159037 | |||
| 526 | Ga0501079_0050692 | |||
| 527 | Ga0501079_0895686 | |||
| 528 | Ga0501079_1151256 | |||
| 529 | Ga0501080_0191254 | |||
| 530 | Ga0501081_0657981 | |||
| 531 | Ga0501083_0493379 | |||
| 532 | Ga0501035_0894623 | |||
| 533 | Ga0501044_0096994 | |||
| 534 | Ga0501044_1350913 | |||
| 535 | Ga0501044_1589462 | |||
| 536 | Ga0501045_0012512 | |||
| 537 | Ga0501045_0068387 | |||
| 538 | nmdc:mga00v17_7705_c1 | |||
| 539 | nmdc:mga0yw44_49594_c1 | |||
| 540 | nmdc:mga0yw44_76202_c1 | |||
| 541 | nmdc:mga07m45_302546_c1 | |||
| 542 | nmdc:mga07m45_920164_c1 | |||
| 543 | nmdc:mga0sz30_9274_c1 | |||
| 544 | Ga0500556_0000426 | |||
| 545 | Ga0500562_006804 | |||
| 546 | Ga0500655_000662 | |||
| 547 | Ga0500559_0000050 | |||
| 548 | Ga0500568_0005034 | |||
| 549 | Ga0501084_0041637 | |||
| 550 | Ga0501084_0185172 | |||
| 551 | Ga0501084_1026904 | |||
| 552 | Ga0590077_106515 | |||
| 553 | Ga0587084_045529 | |||
| 554 | Ga0587073_0017894 | |||
| 555 | Ga0587073_0079033 | |||
| 556 | Ga0587077_096875 | |||
| 557 | Ga0587080_163499 | |||
| 558 | Ga0587082_141298 | |||
| 559 | Ga0587085_088856 | |||
| 560 | Ga0587086_115646 | |||
| 561 | Ga0587089_100693 | |||
| 562 | Ga0587090_040785 | |||
| 563 | Ga0587095_011833 | |||
| 564 | Ga0587106_060186 | |||
| 565 | Ga0587101_053839 | |||
| 566 | Ga0587109_067133 | |||
| 567 | Ga0587115_110466 | |||
| 568 | Ga0587067_104499 | |||
| 569 | Ga0587068_052320 | |||
| 570 | Ga0587069_028441 | |||
| 571 | Ga0587069_090101 | |||
| 572 | Ga0587072_087168 | |||
| 573 | Ga0587076_035398 | |||
| 574 | Ga0587071_071700 | |||
| 575 | Ga0587111_0274464 | |||
| 576 | Ga0501082_0151652 | |||
| 577 | Ga0501082_0564757 | |||
| 578 | Ga0466962_0639040 | |||
| 579 | Ga0530510_0149762 | |||
| 580 | Ga0530510_0540875 | |||
| 581 | 2587863703 | |||
| 582 | 2643734846 | |||
| 583 | 2643753771 | |||
| 584 | 2643783544 | |||
| 585 | 2643847832 | |||
| 586 | 2643994872 | |||
| 587 | 2644173006 | |||
| 588 | 2644182443 | |||
| 589 | 2644456001 | |||
| 590 | 2644538446 | |||
| 591 | 2644679207 | |||
| 592 | 2676473622 | |||
| 593 | 2730228710 | |||
| 594 | 2739202871 | |||
| 595 | 2744958246 | |||
| 596 | 2747953656 | |||
| 597 | 2774378837 | |||
| 598 | 2774381924 | |||
| 599 | 2808628706 | |||
| 600 | 2819667009 | |||
| 601 | 2821269110 | |||
| 602 | 2827632135 | |||
| 603 | 2833709996 | |||
| 604 | 2852665852 | |||
| 605 | 2852678625 | |||
| 606 | 2857712420 | |||
| 607 | 2857724649 | |||
| 608 | 2862993588 | |||
| 609 | 2887446081 | |||
| 610 | 2887485768 | |||
| 611 | 2904510296 | |||
| 612 | 2908678488 | |||
| 613 | 2919070809 | |||
| 614 | 2928142910 | |||
| 615 | 2946034702 | |||
| 616 | 2946043190 | |||
| 617 | 2946081820 | |||
| 618 | 2956941024 | |||
| 619 | 2966926582 | |||
| 620 | 2977230383 | |||
| 621 | 2977239186 | |||
| 622 | 2977252085 | |||
| 623 | 2984543030 | |||
| 624 | 2984593605 | |||
| 625 | 3001120717 | |||
| 626 | 8004183570 | |||
| 627 | 8004213395 | |||
| 628 | 8055035345 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wnr-assembly1.cif.gz_E | crystal structure of the cpn10 from thermus thermophilus hb8 | 0.9667 | 21 | 113 |
| 1wnr-assembly1.cif.gz_E | crystal structure of the cpn10 from thermus thermophilus hb8 | 0.9419 | 21 | 113 |
| 3nx6-assembly1.cif.gz_A | crystal structure of co-chaperonin, groes (xoo4289) from xanthomonas oryzae pv. oryzae kacc10331 | 0.904 | 21 | 113 |
| 1wnr-assembly1.cif.gz_G | crystal structure of the cpn10 from thermus thermophilus hb8 | 0.8901 | 21 | 113 |
| 1wnr-assembly1.cif.gz_C | crystal structure of the cpn10 from thermus thermophilus hb8 | 0.8865 | 21 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wnrD00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.9776 | 21 | 113 | 2.30.33.40 |
| 1wnrD00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.9522 | 21 | 113 | 2.30.33.40 |
| af_C0PKD9_55_155_2.30.33.40 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.9302 | 21 | 112 | 2.30.33.40 |
| af_Q9VU35_1_103_2.30.33.40 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.9106 | 18 | 113 | 2.30.33.40 |
| 3nx6A00 | Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin | 0.904 | 21 | 113 | 2.30.33.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5YB43-F1-model_v4 | deleted | 0.9503 | 21 | 113 |
|
| AF-A0A0S7XKI7-F1-model_v4 | Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) | 0.9501 | 21 | 111 |
GO:0005524
GO:0005737 GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |
| AF-A0A7G7VH27-F1-model_v4 | Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) | 0.9498 | 21 | 112 |
GO:0005524
GO:0005737 GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |
| AF-Q98AX8-F1-model_v4 | Co-chaperonin GroES 3 (10 kDa chaperonin 3) (Chaperonin-10 3) (Cpn10 3) | 0.9465 | 18 | 113 |
GO:0005524
GO:0005737 GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |
| AF-A0A7C3YET8-F1-model_v4 | Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) | 0.9455 | 19 | 113 |
GO:0005524
GO:0005737 GO:0044183 GO:0046872 GO:0051082 GO:0051085 GO:0051087 |