F402513

General Info

Members Datasets Scaffolds Average Seq Length
314 247 628 97

Family's Representative Sequence

Representative Sequence 3300003911|JGI25405J52794_10081701|JGI25405J52794_100817012
Length 113
Sequence MGYLNIHPQHSSWRSTVSVNIKPLEDRLVIKVVEAEQTTASGLVIPDTAKEKPQEGEVLAVGPGRVDDNGNRVPLDVNVGDKVIFSKYGGTEVKYSGEELLILSARDVLAVVA

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
37 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
40 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
45 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
61 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
62 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
63 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
64 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
65 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
66 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
67 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
77 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
78 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
79 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
81 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
93 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
94 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
95 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
96 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
97 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
98 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
99 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
100 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
101 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
102 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
103 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
104 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
105 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
106 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
107 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
169 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
170 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
171 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
172 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
200 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
201 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
202 2643221546 Microbacterium sp. Root53 Isolate Unclassified
203 2643221553 Microbacterium sp. Root553 Isolate Unclassified
204 2643221566 Microbacterium sp. Root166 Isolate Unclassified
205 2643221597 Microbacterium sp. Root180 Isolate Unclassified
206 2643221630 Microbacterium sp. Root322 Isolate Unclassified
207 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
208 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
209 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
210 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
211 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
212 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
213 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
214 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
215 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
216 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
217 2773857759 Microbacterium sp. 1294 Isolate Unclassified
218 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
219 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
220 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
221 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
222 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
223 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
224 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
225 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
226 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
227 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
228 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
229 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
230 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
231 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
232 2919069694 Microbacterium sp. 1154 Isolate Unclassified
233 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
234 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
235 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
236 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
237 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
238 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
239 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
240 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
241 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
242 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
243 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
244 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
245 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
246 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
247 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 65.92
Metatranscriptomes 18.79
Isolates 15.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.64
Bulb 0
Endosphere 4.46
Nodule 0
Rhizoplane 1.59
Rhizosphere 81.21
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10081701 3300003911 Bacteria 711
2 Ga0058863_11941044 3300004799 Bacteria 580
3 Ga0058861_12046996 3300004800 Bacteria 751
4 Ga0058862_12864829 3300004803 Bacteria 816
5 Ga0065714_10216280 3300005288 Bacteria 853
6 Ga0070658_10086939 3300005327 Bacteria 2572
7 Ga0070658_10446793 3300005327 Bacteria 1114
8 Ga0068869_101098126 3300005334 Bacteria 696
9 Ga0070682_100855161 3300005337 Bacteria 744
10 Ga0070682_101176958 3300005337 Bacteria 646
11 Ga0068868_101271646 3300005338 Bacteria 683
12 Ga0070660_101411237 3300005339 Bacteria 592
13 Ga0070692_10134154 3300005345 Bacteria 1395
14 Ga0070692_10324715 3300005345 Bacteria 948
15 Ga0070668_101727778 3300005347 Bacteria 575
16 Ga0070659_100101397 3300005366 Bacteria 2317
17 Ga0070714_100003328 3300005435 Bacteria 11980
18 Ga0070681_10553100 3300005458 Bacteria 1065
19 Ga0070679_100404060 3300005530 Bacteria 1312
20 Ga0070664_102156513 3300005564 Bacteria 529
21 Ga0068858_100712403 3300005842 Bacteria 977
22 Ga0081455_10000106 3300005937 Bacteria 93286
23 Ga0075363_100605297 3300006048 Bacteria 657
24 Ga0075364_10024344 3300006051 Bacteria 3843
25 Ga0075370_10368201 3300006353 Bacteria 860
26 Ga0105240_10532035 3300009093 Bacteria 1303
27 Ga0105242_11739034 3300009176 Bacteria 661
28 Ga0105242_12132769 3300009176 Bacteria 605
29 Ga0105249_10445566 3300009553 Bacteria 1333
30 Ga0105249_11090757 3300009553 Bacteria 868
31 Ga0105030_122697 3300009987 Bacteria 572
32 Ga0105246_11263369 3300011119 Bacteria 682
33 Ga0154014_110940 3300013052 Bacteria 539
34 Ga0157370_10728731 3300013104 Bacteria 904
35 Ga0157369_10328777 3300013105 Bacteria 1588
36 Ga0157369_11788022 3300013105 Bacteria 624
37 Ga0157378_12042929 3300013297 Bacteria 623
38 Ga0157372_11624040 3300013307 Bacteria 744
39 Ga0157375_13307139 3300013308 Bacteria 537
40 Ga0157380_12430034 3300014326 Bacteria 589
41 Ga0182006_1158155 3300015261 Bacteria 765
42 Ga0182005_1222837 3300015265 Bacteria 574
43 Ga0197907_11191523 3300020069 Bacteria 611
44 Ga0197907_11454344 3300020069 Bacteria 709
45 Ga0206356_10609498 3300020070 Bacteria 1337
46 Ga0206355_1291832 3300020076 Bacteria 675
47 Ga0206351_10073400 3300020077 Bacteria 1379
48 Ga0206354_10335464 3300020081 Bacteria 1111
49 Ga0206354_11001573 3300020081 Bacteria 557
50 Ga0154015_1240952 3300020610 Bacteria 533
51 Ga0154015_1422545 3300020610 Bacteria 979
52 Ga0224712_10167562 3300022467 Bacteria 983
53 Ga0209759_1045884 3300025256 Bacteria 711
54 Ga0207688_10359964 3300025901 Bacteria 898
55 Ga0207647_10546630 3300025904 Bacteria 643
56 Ga0207705_10571183 3300025909 Bacteria 879
57 Ga0207707_10272488 3300025912 Bacteria 1467
58 Ga0207671_10420893 3300025914 Bacteria 1063
59 Ga0207662_10650826 3300025918 Bacteria 736
60 Ga0207657_10695190 3300025919 Bacteria 790
61 Ga0207652_10351949 3300025921 Bacteria 1329
62 Ga0207664_10044536 3300025929 Bacteria 3475
63 Ga0207664_11174957 3300025929 Bacteria 685
64 Ga0207690_10023748 3300025932 Bacteria 3831
65 Ga0207690_10622913 3300025932 Bacteria 882
66 Ga0207706_10107829 3300025933 Bacteria 2451
67 Ga0207686_10270195 3300025934 Bacteria 1250
68 Ga0207686_11759933 3300025934 Bacteria 513
69 Ga0207661_11208734 3300025944 Bacteria 695
70 Ga0207675_100195651 3300026118 Bacteria 1941
71 Ga0207683_10954341 3300026121 Bacteria 796
72 Ga0314311_1248299 3300030733 Bacteria 748
73 Ga0316179_1047948 3300030734 Bacteria 1013
74 Ga0316183_1190494 3300030742 Bacteria 967
75 Ga0316182_1073605 3300030745 Bacteria 1606
76 Ga0316575_10075170 3300031665 Bacteria 1359
77 Ga0316579_10165239 3300031691 Bacteria 1069
78 Ga0316576_10000044 3300031727 Bacteria 38025
79 Ga0316576_10040116 3300031727 Bacteria 3363
80 Ga0316578_10557900 3300031728 Bacteria 672
81 Ga0307405_10509708 3300031731 Bacteria 966
82 Ga0316577_10202231 3300031733 Bacteria 1122
83 Ga0307407_10201513 3300031903 Bacteria 1334
84 Ga0307412_10302084 3300031911 Bacteria 1266
85 Ga0307412_10397589 3300031911 Bacteria 1121
86 Ga0307412_12145819 3300031911 Bacteria 519
87 Ga0307409_100166129 3300031995 Bacteria 1937
88 Ga0307409_101406969 3300031995 Bacteria 724
89 Ga0307416_100893853 3300032002 Bacteria 988
90 Ga0307414_10592844 3300032004 Bacteria 993
91 Ga0307411_10745184 3300032005 Bacteria 858
92 Ga0307411_12254197 3300032005 Bacteria 511
93 Ga0316583_10009358 3300032133 Bacteria 3527
94 Ga0316585_10037519 3300032137 Bacteria 1538
95 Ga0316580_10015165 3300032139 Bacteria 2355
96 Ga0316593_10013181 3300032168 Bacteria 2443
97 Ga0316593_10104525 3300032168 Bacteria 1007
98 Ga0307510_10309677 3300033180 Bacteria 1039
99 Ga0316592_1078866 3300033524 Bacteria 748
100 Ga0316588_1008505 3300033528 Bacteria 2115
101 Ga0316587_1028237 3300033529 Bacteria 983
102 Ga0316587_1071577 3300033529 Bacteria 649
103 Ga0316596_1007657 3300033541 Bacteria 2557
104 Ga0316596_1085990 3300033541 Bacteria 846
105 Ga0316574_0054410 3300035398 Bacteria 2499
106 Ga0316582_0178372 3300036647 Bacteria 1444
107 Ga0316582_0384401 3300036647 Bacteria 966
108 Ga0316584_0069522 3300036712 Bacteria 2639
109 Ga0316584_0501034 3300036712 Bacteria 853
110 Ga0316584_0656913 3300036712 Bacteria 722
111 Ga0395900_0426939 3300037418 Bacteria 1285
112 Ga0395898_0207684 3300037466 Bacteria 1869
113 Ga0395898_0425142 3300037466 Bacteria 1266
114 Ga0395898_0783962 3300037466 Bacteria 894
115 Ga0316581_0038005 3300037588 Bacteria 1463
116 Ga0395901_1537573 3300038443 Bacteria 620
117 Ga0395901_1554703 3300038443 Bacteria 616
118 Ga0400485_17720 3300038735 Bacteria 15081
119 Ga0400488_03030 3300038741 Bacteria 7443
120 Ga0400486_24539 3300038742 Bacteria 23507
121 Ga0400483_129587 3300039062 Bacteria 4638
122 Ga0400483_168137 3300039062 Bacteria 3650
123 Ga0400483_264403 3300039062 Bacteria 3292
124 Ga0439465_0108482 3300041413 Bacteria 964
125 Ga0451793_0142424 3300041452 Bacteria 2756
126 Ga0451833_0902602 3300041491 Bacteria 4378
127 Ga0451837_1135319 3300041494 Bacteria 2099
128 Ga0451839_1531844 3300041496 Bacteria 1845
129 Ga0451843_1091548 3300041509 Bacteria 540
130 Ga0439452_099772 3300042010 Bacteria 624
131 Ga0439454_117481 3300042011 Bacteria 512
132 Ga0439446_0068745 3300042156 Bacteria 1081
133 Ga0439434_0120684 3300042435 Bacteria 855
134 Ga0439459_0067638 3300042438 Bacteria 820
135 Ga0466965_0019526 3300044683 Bacteria 3254
136 Ga0466966_0156445 3300044684 Bacteria 1388
137 Ga0466966_0988065 3300044684 Bacteria 508
138 Ga0466961_0176464 3300044693 Bacteria 1327
139 Ga0466961_0214597 3300044693 Bacteria 1187
140 Ga0466963_0389147 3300044694 Bacteria 983
141 Ga0466970_0054172 3300044765 Bacteria 2142
142 Ga0466960_0173874 3300044901 Bacteria 1164
143 Ga0466960_0638848 3300044901 Bacteria 634
144 Ga0466959_0135280 3300045049 Bacteria 1745
145 Ga0466958_0167708 3300045836 Bacteria 1390
146 Ga0466967_0410755 3300045976 Bacteria 1318
147 Ga0495597_0336645 3300046542 Bacteria 581
148 Ga0495673_0322731 3300047469 Bacteria 550
149 Ga0496105_1362216 3300048908 Bacteria 515
150 Ga0496108_1767863 3300048911 Bacteria 507
151 Ga0496111_0947933 3300048914 Bacteria 618
152 Ga0496112_0150423 3300048915 Bacteria 2295
153 Ga0496126_0017011 3300048929 Bacteria 7255
154 Ga0496126_1091865 3300048929 Bacteria 593
155 Ga0501306_055047 3300049127 Bacteria 646
156 Ga0501309_007096 3300049129 Bacteria 1381
157 Ga0501310_058996 3300049130 Bacteria 569
158 Ga0501316_025620 3300049532 Bacteria 768
159 Ga0501316_048490 3300049532 Bacteria 607
160 Ga0501317_096675 3300049533 Bacteria 528
161 Ga0501318_024445 3300049534 Bacteria 786
162 Ga0501318_036979 3300049534 Bacteria 685
163 Ga0501321_018937 3300049537 Bacteria 839
164 Ga0501321_053670 3300049537 Bacteria 595
165 Ga0501321_089440 3300049537 Bacteria 500
166 Ga0501323_022906 3300049539 Bacteria 835
167 Ga0501325_021948 3300049541 Bacteria 679
168 Ga0501336_035619 3300049552 Bacteria 503
169 Ga0501031_0078045 3300049568 Bacteria 2157
170 Ga0501031_0361528 3300049568 Bacteria 939
171 Ga0501032_0195254 3300049569 Bacteria 1322
172 Ga0501033_0256681 3300049570 Bacteria 1238
173 Ga0501033_0332493 3300049570 Bacteria 1066
174 Ga0501036_0260574 3300049572 Bacteria 1452
175 Ga0501036_1066408 3300049572 Bacteria 660
176 Ga0501037_0116805 3300049573 Bacteria 1920
177 Ga0501037_0651108 3300049573 Bacteria 704
178 Ga0501038_0126878 3300049574 Bacteria 2099
179 Ga0501038_0301580 3300049574 Bacteria 1257
180 Ga0501039_0019447 3300049575 Bacteria 5207
181 Ga0501039_0232485 3300049575 Bacteria 1449
182 Ga0501040_0037287 3300049576 Bacteria 3302
183 Ga0501040_0072819 3300049576 Bacteria 2373
184 Ga0501040_1025531 3300049576 Bacteria 598
185 Ga0501041_0072458 3300049577 Bacteria 2116
186 Ga0501041_0092226 3300049577 Bacteria 1870
187 Ga0501042_0032149 3300049578 Bacteria 3715
188 Ga0501042_0046031 3300049578 Bacteria 3110
189 Ga0501043_0405902 3300049579 Bacteria 1029
190 Ga0501046_0628542 3300049580 Bacteria 760
191 Ga0501047_0174902 3300049581 Bacteria 2014
192 Ga0501048_0043383 3300049582 Bacteria 3219
193 Ga0501048_0063377 3300049582 Bacteria 2615
194 Ga0501067_0462777 3300049583 Bacteria 709
195 Ga0501068_0120889 3300049584 Bacteria 1633
196 Ga0501069_0124607 3300049585 Bacteria 1473
197 Ga0501069_0703710 3300049585 Bacteria 609
198 Ga0501070_0013869 3300049586 Bacteria 6787
199 Ga0501070_1033887 3300049586 Unclassified 636
200 Ga0501071_0027874 3300049587 Bacteria 3976
201 Ga0501071_0093069 3300049587 Bacteria 2216
202 Ga0501072_0019664 3300049588 Bacteria 5224
203 Ga0501072_0304749 3300049588 Bacteria 1266
204 Ga0501073_0000030 3300049589 Bacteria 115949
205 Ga0501074_0091037 3300049590 Bacteria 2184
206 Ga0501074_0284540 3300049590 Bacteria 1175
207 Ga0501075_0008353 3300049591 Bacteria 7221
208 Ga0501075_0152919 3300049591 Bacteria 1759
209 Ga0501076_0028768 3300049592 Bacteria 4318
210 Ga0501076_0234804 3300049592 Bacteria 1499
211 Ga0501077_0159037 3300049593 Bacteria 1434
212 Ga0501079_0050692 3300049741 Bacteria 3204
213 Ga0501079_0895686 3300049741 Bacteria 699
214 Ga0501079_1151256 3300049741 Bacteria 611
215 Ga0501080_0191254 3300049742 Bacteria 1880
216 Ga0501081_0657981 3300049743 Bacteria 785
217 Ga0501083_0493379 3300049744 Bacteria 797
218 Ga0501035_0894623 3300049822 Bacteria 703
219 Ga0501044_0096994 3300049823 Bacteria 2969
220 Ga0501044_1350913 3300049823 Bacteria 579
221 Ga0501044_1589462 3300049823 Bacteria 519
222 Ga0501045_0012512 3300049824 Bacteria 5976
223 Ga0501045_0068387 3300049824 Bacteria 2609
224 nmdc:mga00v17_7705_c1 3300050491 Bacteria 5762
225 nmdc:mga0yw44_49594_c1 3300050492 Bacteria 2535
226 nmdc:mga0yw44_76202_c1 3300050492 Bacteria 2093
227 nmdc:mga07m45_302546_c1 3300050496 Bacteria 930
228 nmdc:mga07m45_920164_c1 3300050496 Bacteria 500
229 nmdc:mga0sz30_9274_c1 3300050516 Bacteria 3738
230 Ga0500556_0000426 3300053104 Bacteria 30343
231 Ga0500562_006804 3300053108 Bacteria 2883
232 Ga0500655_000662 3300053133 Bacteria 6832
233 Ga0500559_0000050 3300053136 Bacteria 93262
234 Ga0500568_0005034 3300053139 Bacteria 6922
235 Ga0501084_0041637 3300054114 Bacteria 3843
236 Ga0501084_0185172 3300054114 Bacteria 1757
237 Ga0501084_1026904 3300054114 Bacteria 693
238 Ga0590077_106515 3300059426 Bacteria 658
239 Ga0587084_045529 3300059477 Bacteria 760
240 Ga0587073_0017894 3300059492 Bacteria 1316
241 Ga0587073_0079033 3300059492 Bacteria 812
242 Ga0587077_096875 3300059493 Bacteria 702
243 Ga0587080_163499 3300059503 Bacteria 524
244 Ga0587082_141298 3300059504 Bacteria 562
245 Ga0587085_088856 3300059506 Bacteria 635
246 Ga0587086_115646 3300059507 Bacteria 508
247 Ga0587089_100693 3300059509 Bacteria 524
248 Ga0587090_040785 3300059510 Bacteria 816
249 Ga0587095_011833 3300059514 Bacteria 752
250 Ga0587106_060186 3300059605 Bacteria 696
251 Ga0587101_053839 3300059623 Bacteria 701
252 Ga0587109_067133 3300059624 Bacteria 768
253 Ga0587115_110466 3300059626 Bacteria 519
254 Ga0587067_104499 3300059640 Bacteria 660
255 Ga0587068_052320 3300059641 Bacteria 767
256 Ga0587069_028441 3300059642 Bacteria 888
257 Ga0587069_090101 3300059642 Bacteria 612
258 Ga0587072_087168 3300059643 Bacteria 683
259 Ga0587076_035398 3300059645 Bacteria 907
260 Ga0587071_071700 3300060344 Bacteria 756
261 Ga0587111_0274464 3300060346 Bacteria 507
262 Ga0501082_0151652 3300060353 Bacteria 2013
263 Ga0501082_0564757 3300060353 Bacteria 995
264 Ga0466962_0639040 3300061719 Bacteria 544
265 Ga0530510_0149762 3300061734 Bacteria 1722
266 Ga0530510_0540875 3300061734 Bacteria 884
267 2587863703 2585428094 Bacteria 3604039
268 2643734846 2643221542 Bacteria 3563959
269 2643753771 2643221546 Bacteria 2910897
270 2643783544 2643221553 Bacteria 3544260
271 2643847832 2643221566 Bacteria 3460379
272 2643994872 2643221597 Bacteria 3347721
273 2644173006 2643221630 Bacteria 3601215
274 2644182443 2643221632 Bacteria 3406696
275 2644456001 2643221681 Bacteria 3707866
276 2644538446 2643221697 Bacteria 3575694
277 2644679207 2643221724 Bacteria 3593515
278 2676473622 2675903058 Bacteria 6822861
279 2730228710 2728369380 Bacteria 3620317
280 2739202871 2738543005 Bacteria 5278128
281 2744958246 2744054611 Bacteria 5611514
282 2747953656 2747842429 Bacteria 3914386
283 2774378837 2773857758 Bacteria 3592392
284 2774381924 2773857759 Bacteria 2963774
285 2808628706 2808606306 Bacteria 3608896
286 2819667009 2818991458 Bacteria 4794049
287 2821269110 2821268502 Bacteria 3750023
288 2827632135 2827628540 Bacteria 6858585
289 2833709996 2833709550 Bacteria 4008291
290 2852665852 2852663356 Bacteria 4090475
291 2852678625 2852677369 Bacteria 3768884
292 2857712420 2857710386 Bacteria 3186771
293 2857724649 2857723135 Bacteria 4217853
294 2862993588 2862993130 Bacteria 3860849
295 2887446081 2887443736 Bacteria 4426037
296 2887485768 2887478801 Bacteria 8972725
297 2904510296 2904509784 Bacteria 3520416
298 2908678488 2908678064 Bacteria 3482747
299 2919070809 2919069694 Bacteria 3622919
300 2928142910 2928142448 Bacteria 5288925
301 2946034702 2946033335 Bacteria 3835514
302 2946043190 2946041624 Bacteria 4191385
303 2946081820 2946080515 Bacteria 4310960
304 2956941024 2956939328 Bacteria 3474458
305 2966926582 2966924647 Bacteria 3268643
306 2977230383 2977228692 Bacteria 3450105
307 2977239186 2977236895 Bacteria 3569373
308 2977252085 2977251589 Bacteria 2952848
309 2984543030 2984542743 Bacteria 3569378
310 2984593605 2984592036 Bacteria 3670284
311 3001120717 3001119090 Bacteria 3449530
312 8004183570 8004182704 Bacteria 3391155
313 8004213395 8004212874 Bacteria 2861420
314 8055035345 8055034563 Bacteria 3562128
315 JGI25405J52794_10081701
316 Ga0058863_11941044
317 Ga0058861_12046996
318 Ga0058862_12864829
319 Ga0065714_10216280
320 Ga0070658_10086939
321 Ga0070658_10446793
322 Ga0068869_101098126
323 Ga0070682_100855161
324 Ga0070682_101176958
325 Ga0068868_101271646
326 Ga0070660_101411237
327 Ga0070692_10134154
328 Ga0070692_10324715
329 Ga0070668_101727778
330 Ga0070659_100101397
331 Ga0070714_100003328
332 Ga0070681_10553100
333 Ga0070679_100404060
334 Ga0070664_102156513
335 Ga0068858_100712403
336 Ga0081455_10000106
337 Ga0075363_100605297
338 Ga0075364_10024344
339 Ga0075370_10368201
340 Ga0105240_10532035
341 Ga0105242_11739034
342 Ga0105242_12132769
343 Ga0105249_10445566
344 Ga0105249_11090757
345 Ga0105030_122697
346 Ga0105246_11263369
347 Ga0154014_110940
348 Ga0157370_10728731
349 Ga0157369_10328777
350 Ga0157369_11788022
351 Ga0157378_12042929
352 Ga0157372_11624040
353 Ga0157375_13307139
354 Ga0157380_12430034
355 Ga0182006_1158155
356 Ga0182005_1222837
357 Ga0197907_11191523
358 Ga0197907_11454344
359 Ga0206356_10609498
360 Ga0206355_1291832
361 Ga0206351_10073400
362 Ga0206354_10335464
363 Ga0206354_11001573
364 Ga0154015_1240952
365 Ga0154015_1422545
366 Ga0224712_10167562
367 Ga0209759_1045884
368 Ga0207688_10359964
369 Ga0207647_10546630
370 Ga0207705_10571183
371 Ga0207707_10272488
372 Ga0207671_10420893
373 Ga0207662_10650826
374 Ga0207657_10695190
375 Ga0207652_10351949
376 Ga0207664_10044536
377 Ga0207664_11174957
378 Ga0207690_10023748
379 Ga0207690_10622913
380 Ga0207706_10107829
381 Ga0207686_10270195
382 Ga0207686_11759933
383 Ga0207661_11208734
384 Ga0207675_100195651
385 Ga0207683_10954341
386 Ga0314311_1248299
387 Ga0316179_1047948
388 Ga0316183_1190494
389 Ga0316182_1073605
390 Ga0316575_10075170
391 Ga0316579_10165239
392 Ga0316576_10000044
393 Ga0316576_10040116
394 Ga0316578_10557900
395 Ga0307405_10509708
396 Ga0316577_10202231
397 Ga0307407_10201513
398 Ga0307412_10302084
399 Ga0307412_10397589
400 Ga0307412_12145819
401 Ga0307409_100166129
402 Ga0307409_101406969
403 Ga0307416_100893853
404 Ga0307414_10592844
405 Ga0307411_10745184
406 Ga0307411_12254197
407 Ga0316583_10009358
408 Ga0316585_10037519
409 Ga0316580_10015165
410 Ga0316593_10013181
411 Ga0316593_10104525
412 Ga0307510_10309677
413 Ga0316592_1078866
414 Ga0316588_1008505
415 Ga0316587_1028237
416 Ga0316587_1071577
417 Ga0316596_1007657
418 Ga0316596_1085990
419 Ga0316574_0054410
420 Ga0316582_0178372
421 Ga0316582_0384401
422 Ga0316584_0069522
423 Ga0316584_0501034
424 Ga0316584_0656913
425 Ga0395900_0426939
426 Ga0395898_0207684
427 Ga0395898_0425142
428 Ga0395898_0783962
429 Ga0316581_0038005
430 Ga0395901_1537573
431 Ga0395901_1554703
432 Ga0400485_17720
433 Ga0400488_03030
434 Ga0400486_24539
435 Ga0400483_129587
436 Ga0400483_168137
437 Ga0400483_264403
438 Ga0439465_0108482
439 Ga0451793_0142424
440 Ga0451833_0902602
441 Ga0451837_1135319
442 Ga0451839_1531844
443 Ga0451843_1091548
444 Ga0439452_099772
445 Ga0439454_117481
446 Ga0439446_0068745
447 Ga0439434_0120684
448 Ga0439459_0067638
449 Ga0466965_0019526
450 Ga0466966_0156445
451 Ga0466966_0988065
452 Ga0466961_0176464
453 Ga0466961_0214597
454 Ga0466963_0389147
455 Ga0466970_0054172
456 Ga0466960_0173874
457 Ga0466960_0638848
458 Ga0466959_0135280
459 Ga0466958_0167708
460 Ga0466967_0410755
461 Ga0495597_0336645
462 Ga0495673_0322731
463 Ga0496105_1362216
464 Ga0496108_1767863
465 Ga0496111_0947933
466 Ga0496112_0150423
467 Ga0496126_0017011
468 Ga0496126_1091865
469 Ga0501306_055047
470 Ga0501309_007096
471 Ga0501310_058996
472 Ga0501316_025620
473 Ga0501316_048490
474 Ga0501317_096675
475 Ga0501318_024445
476 Ga0501318_036979
477 Ga0501321_018937
478 Ga0501321_053670
479 Ga0501321_089440
480 Ga0501323_022906
481 Ga0501325_021948
482 Ga0501336_035619
483 Ga0501031_0078045
484 Ga0501031_0361528
485 Ga0501032_0195254
486 Ga0501033_0256681
487 Ga0501033_0332493
488 Ga0501036_0260574
489 Ga0501036_1066408
490 Ga0501037_0116805
491 Ga0501037_0651108
492 Ga0501038_0126878
493 Ga0501038_0301580
494 Ga0501039_0019447
495 Ga0501039_0232485
496 Ga0501040_0037287
497 Ga0501040_0072819
498 Ga0501040_1025531
499 Ga0501041_0072458
500 Ga0501041_0092226
501 Ga0501042_0032149
502 Ga0501042_0046031
503 Ga0501043_0405902
504 Ga0501046_0628542
505 Ga0501047_0174902
506 Ga0501048_0043383
507 Ga0501048_0063377
508 Ga0501067_0462777
509 Ga0501068_0120889
510 Ga0501069_0124607
511 Ga0501069_0703710
512 Ga0501070_0013869
513 Ga0501070_1033887
514 Ga0501071_0027874
515 Ga0501071_0093069
516 Ga0501072_0019664
517 Ga0501072_0304749
518 Ga0501073_0000030
519 Ga0501074_0091037
520 Ga0501074_0284540
521 Ga0501075_0008353
522 Ga0501075_0152919
523 Ga0501076_0028768
524 Ga0501076_0234804
525 Ga0501077_0159037
526 Ga0501079_0050692
527 Ga0501079_0895686
528 Ga0501079_1151256
529 Ga0501080_0191254
530 Ga0501081_0657981
531 Ga0501083_0493379
532 Ga0501035_0894623
533 Ga0501044_0096994
534 Ga0501044_1350913
535 Ga0501044_1589462
536 Ga0501045_0012512
537 Ga0501045_0068387
538 nmdc:mga00v17_7705_c1
539 nmdc:mga0yw44_49594_c1
540 nmdc:mga0yw44_76202_c1
541 nmdc:mga07m45_302546_c1
542 nmdc:mga07m45_920164_c1
543 nmdc:mga0sz30_9274_c1
544 Ga0500556_0000426
545 Ga0500562_006804
546 Ga0500655_000662
547 Ga0500559_0000050
548 Ga0500568_0005034
549 Ga0501084_0041637
550 Ga0501084_0185172
551 Ga0501084_1026904
552 Ga0590077_106515
553 Ga0587084_045529
554 Ga0587073_0017894
555 Ga0587073_0079033
556 Ga0587077_096875
557 Ga0587080_163499
558 Ga0587082_141298
559 Ga0587085_088856
560 Ga0587086_115646
561 Ga0587089_100693
562 Ga0587090_040785
563 Ga0587095_011833
564 Ga0587106_060186
565 Ga0587101_053839
566 Ga0587109_067133
567 Ga0587115_110466
568 Ga0587067_104499
569 Ga0587068_052320
570 Ga0587069_028441
571 Ga0587069_090101
572 Ga0587072_087168
573 Ga0587076_035398
574 Ga0587071_071700
575 Ga0587111_0274464
576 Ga0501082_0151652
577 Ga0501082_0564757
578 Ga0466962_0639040
579 Ga0530510_0149762
580 Ga0530510_0540875
581 2587863703
582 2643734846
583 2643753771
584 2643783544
585 2643847832
586 2643994872
587 2644173006
588 2644182443
589 2644456001
590 2644538446
591 2644679207
592 2676473622
593 2730228710
594 2739202871
595 2744958246
596 2747953656
597 2774378837
598 2774381924
599 2808628706
600 2819667009
601 2821269110
602 2827632135
603 2833709996
604 2852665852
605 2852678625
606 2857712420
607 2857724649
608 2862993588
609 2887446081
610 2887485768
611 2904510296
612 2908678488
613 2919070809
614 2928142910
615 2946034702
616 2946043190
617 2946081820
618 2956941024
619 2966926582
620 2977230383
621 2977239186
622 2977252085
623 2984543030
624 2984593605
625 3001120717
626 8004183570
627 8004213395
628 8055035345

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00166

Cpn10

Chaperonin 10 Kd subunit

20

112

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wnr-assembly1.cif.gz_E crystal structure of the cpn10 from thermus thermophilus hb8 0.9667 21 113
1wnr-assembly1.cif.gz_E crystal structure of the cpn10 from thermus thermophilus hb8 0.9419 21 113
3nx6-assembly1.cif.gz_A crystal structure of co-chaperonin, groes (xoo4289) from xanthomonas oryzae pv. oryzae kacc10331 0.904 21 113
1wnr-assembly1.cif.gz_G crystal structure of the cpn10 from thermus thermophilus hb8 0.8901 21 113
1wnr-assembly1.cif.gz_C crystal structure of the cpn10 from thermus thermophilus hb8 0.8865 21 113
ID Description Score Start End Superfamily
1wnrD00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9776 21 113 2.30.33.40
1wnrD00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9522 21 113 2.30.33.40
af_C0PKD9_55_155_2.30.33.40 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9302 21 112 2.30.33.40
af_Q9VU35_1_103_2.30.33.40 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9106 18 113 2.30.33.40
3nx6A00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.904 21 113 2.30.33.40
ID Description Score Start End GO Terms
AF-A0A3N5YB43-F1-model_v4 deleted 0.9503 21 113
AF-A0A0S7XKI7-F1-model_v4 Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) 0.9501 21 111 GO:0005524
GO:0005737
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087
AF-A0A7G7VH27-F1-model_v4 Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) 0.9498 21 112 GO:0005524
GO:0005737
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087
AF-Q98AX8-F1-model_v4 Co-chaperonin GroES 3 (10 kDa chaperonin 3) (Chaperonin-10 3) (Cpn10 3) 0.9465 18 113 GO:0005524
GO:0005737
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087
AF-A0A7C3YET8-F1-model_v4 Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) 0.9455 19 113 GO:0005524
GO:0005737
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087

Map