F400171

General Info

Members Datasets Scaffolds Average Seq Length
309 187 614 379

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10065985|Ga0111539_100659853
Length 404
Sequence VSTDRNDPQSMTGLAIDSSTKTAVTAHGDGNRSRPVRVCILAPSIDVLGGQSRQAERLMNGLAAEPSVEIGFIPHAPRLPRPLHFLQRIKYVRTVVNTVVYWIMAATRMWRYDVIHAYSASYYSYLLSVLPIIILAKLYRKRLLLNYHSGEAEDHLANWKLTALPFIRMADLIVVPSGYLVDVFAKFGLQARAIHNVVELDVFRYRERKPIRPAFLTSRLHEPLYNVPCVLRAFAIVQRNYPEASLVVAGDGWMRPQLEQLAVDLELKNTRFVGRVPWGDMPDLYDASDVYLTATNIDNMPGSVIECLSCGLPVVTTDAGGVPYIVTHEETALIVPRDDHQALADQAMRLLRDDDLAVRLARNGRTACVNYAWPAVRSAWLEAYHELGRDVMSSVPSPIRSEIQ

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
158 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
159 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
163 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
164 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
165 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
166 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
167 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
168 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
169 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
170 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
171 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
172 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
173 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
174 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.62
Rhizosphere 95.47
Stem 0
Stem Tuber 0
Unclassified 14.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10065985 3300009094 Bacteria 4275
2 SwRhRL3b_contig_4018325 2162886006 Bacteria 1488
3 JGI25406J46586_10000295 3300003203 Bacteria 22332
4 Ga0065704_10124707 3300005289 Bacteria 1713
5 Ga0065715_10005300 3300005293 Bacteria 3220
6 Ga0065715_10009273 3300005293 Bacteria 2352
7 Ga0065715_10029120 3300005293 Unclassified 1941
8 Ga0065715_10125006 3300005293 Bacteria 2141
9 Ga0065707_10087130 3300005295 Bacteria 5152
10 Ga0065707_10101810 3300005295 Bacteria 2844
11 Ga0070676_10073639 3300005328 Bacteria 2055
12 Ga0070683_100000174 3300005329 Bacteria 42612
13 Ga0070683_100008617 3300005329 Bacteria 8666
14 Ga0070683_100079604 3300005329 Bacteria 3067
15 Ga0070683_100108650 3300005329 Bacteria 2616
16 Ga0070690_100000223 3300005330 Bacteria 29542
17 Ga0070690_100004182 3300005330 Bacteria 7990
18 Ga0070690_100023692 3300005330 Bacteria 3768
19 Ga0070670_100002806 3300005331 Bacteria 14413
20 Ga0070670_100004892 3300005331 Bacteria 11274
21 Ga0070670_100032245 3300005331 Bacteria 4512
22 Ga0070670_100055210 3300005331 Bacteria 3410
23 Ga0070670_100192561 3300005331 Bacteria 1771
24 Ga0068869_100252773 3300005334 Bacteria 1408
25 Ga0070666_10090003 3300005335 Bacteria 2107
26 Ga0070680_100078744 3300005336 Bacteria 2716
27 Ga0068868_100134707 3300005338 Bacteria 2024
28 Ga0070689_100000048 3300005340 Bacteria 75464
29 Ga0070689_100026626 3300005340 Bacteria 4355
30 Ga0070689_100131247 3300005340 Unclassified 2009
31 Ga0070687_100002642 3300005343 Bacteria 6776
32 Ga0070661_100000900 3300005344 Bacteria 21327
33 Ga0070661_100029528 3300005344 Unclassified 3958
34 Ga0070692_10076526 3300005345 Bacteria 1794
35 Ga0070669_100032657 3300005353 Bacteria 3760
36 Ga0070675_100000681 3300005354 Bacteria 23544
37 Ga0070675_100088060 3300005354 Bacteria 2597
38 Ga0070671_100058913 3300005355 Bacteria 3196
39 Ga0070671_100114155 3300005355 Bacteria 2270
40 Ga0070674_100057340 3300005356 Unclassified 2704
41 Ga0070688_100000026 3300005365 Bacteria 69247
42 Ga0070667_100016775 3300005367 Bacteria 6059
43 Ga0070667_100025848 3300005367 Bacteria 4884
44 Ga0070703_10001550 3300005406 Bacteria 6842
45 Ga0070701_10000049 3300005438 Bacteria 30898
46 Ga0070701_10069711 3300005438 Unclassified 1876
47 Ga0070700_100000544 3300005441 Bacteria 18889
48 Ga0070700_100188651 3300005441 Bacteria 1440
49 Ga0070694_100015102 3300005444 Unclassified 4843
50 Ga0070694_100037016 3300005444 Bacteria 3235
51 Ga0070694_100043425 3300005444 Bacteria 3006
52 Ga0070694_100112050 3300005444 Bacteria 1945
53 Ga0070694_100130245 3300005444 Bacteria 1816
54 Ga0070663_100060177 3300005455 Bacteria 2731
55 Ga0070662_100004651 3300005457 Bacteria 8702
56 Ga0070662_100008824 3300005457 Bacteria 6571
57 Ga0070681_10005858 3300005458 Bacteria 11895
58 Ga0068867_100053359 3300005459 Bacteria 2985
59 Ga0068867_100110991 3300005459 Bacteria 2107
60 Ga0070685_10000043 3300005466 Bacteria 75315
61 Ga0070698_100192520 3300005471 Unclassified 1976
62 Ga0070684_100005004 3300005535 Bacteria 10122
63 Ga0070684_100023539 3300005535 Bacteria 5154
64 Ga0070684_100047185 3300005535 Bacteria 3733
65 Ga0070697_100063142 3300005536 Bacteria 3024
66 Ga0068853_100047502 3300005539 Bacteria 3683
67 Ga0070672_100010255 3300005543 Bacteria 6492
68 Ga0070686_100000064 3300005544 Bacteria 82209
69 Ga0070686_100134278 3300005544 Bacteria 1715
70 Ga0070695_100075227 3300005545 Bacteria 2221
71 Ga0070693_100027054 3300005547 Bacteria 3103
72 Ga0070665_100075626 3300005548 Bacteria 3374
73 Ga0070704_100012456 3300005549 Bacteria 5255
74 Ga0070704_100014381 3300005549 Bacteria 4942
75 Ga0070704_100060501 3300005549 Bacteria 2706
76 Ga0070664_100018983 3300005564 Bacteria 5653
77 Ga0070664_100088938 3300005564 Bacteria 2671
78 Ga0070664_100286853 3300005564 Bacteria 1485
79 Ga0070664_100335005 3300005564 Bacteria 1373
80 Ga0068857_100011166 3300005577 Bacteria 7811
81 Ga0068857_100011840 3300005577 Bacteria 7588
82 Ga0068854_100166040 3300005578 Unclassified 1714
83 Ga0068852_100023720 3300005616 Bacteria 4944
84 Ga0068859_100000246 3300005617 Bacteria 53443
85 Ga0068859_100107286 3300005617 Bacteria 2853
86 Ga0068864_100087134 3300005618 Bacteria 2748
87 Ga0068864_100168214 3300005618 Unclassified 1997
88 Ga0068861_100000794 3300005719 Bacteria 19016
89 Ga0068861_100012380 3300005719 Bacteria 5949
90 Ga0068861_100014630 3300005719 Bacteria 5509
91 Ga0068861_100016377 3300005719 Bacteria 5245
92 Ga0068851_10004845 3300005834 Bacteria 6091
93 Ga0068863_100009154 3300005841 Bacteria 9663
94 Ga0068858_100046740 3300005842 Bacteria 4012
95 Ga0068858_100068425 3300005842 Bacteria 3290
96 Ga0068860_100010156 3300005843 Bacteria 9327
97 Ga0068860_100076662 3300005843 Bacteria 3180
98 Ga0068862_100011868 3300005844 Bacteria 7194
99 Ga0081539_10000071 3300005985 Bacteria 233094
100 Ga0081539_10000654 3300005985 Bacteria 69664
101 Ga0097621_100015647 3300006237 Bacteria 5715
102 Ga0097621_100197184 3300006237 Unclassified 1746
103 Ga0075428_100289139 3300006844 Bacteria 1763
104 Ga0075430_100002017 3300006846 Bacteria 16734
105 Ga0075430_100006302 3300006846 Bacteria 10007
106 Ga0075430_100035945 3300006846 Bacteria 4201
107 Ga0075430_100132879 3300006846 Bacteria 2074
108 Ga0075431_100004500 3300006847 Bacteria 13680
109 Ga0075431_100029977 3300006847 Bacteria 5603
110 Ga0075431_100044160 3300006847 Unclassified 4597
111 Ga0075431_100080024 3300006847 Bacteria 3373
112 Ga0075433_10021695 3300006852 Bacteria 5387
113 Ga0075433_10030952 3300006852 Bacteria 4570
114 Ga0075433_10041171 3300006852 Bacteria 4002
115 Ga0075429_100076794 3300006880 Bacteria 2909
116 Ga0075429_100080812 3300006880 Bacteria 2834
117 Ga0075429_100095379 3300006880 Bacteria 2594
118 Ga0068865_100013510 3300006881 Bacteria 5161
119 Ga0075436_100014227 3300006914 Bacteria 5447
120 Ga0097620_100000246 3300006931 Bacteria 53443
121 Ga0097620_100107286 3300006931 Bacteria 2853
122 Ga0075435_100063178 3300007076 Bacteria 3007
123 Ga0105247_10008890 3300009101 Bacteria 6120
124 Ga0105247_10034049 3300009101 Unclassified 3102
125 Ga0114129_10027374 3300009147 Bacteria 8071
126 Ga0114129_10036557 3300009147 Bacteria 6934
127 Ga0114129_10080234 3300009147 Bacteria 4536
128 Ga0114129_10153700 3300009147 Bacteria 3148
129 Ga0114129_10202814 3300009147 Unclassified 2685
130 Ga0105243_10011743 3300009148 Bacteria 6623
131 Ga0105243_10143396 3300009148 Bacteria 2041
132 Ga0105243_10210700 3300009148 Unclassified 1711
133 Ga0105243_10434215 3300009148 Bacteria 1228
134 Ga0105241_10004277 3300009174 Bacteria 10562
135 Ga0105242_10069608 3300009176 Unclassified 2915
136 Ga0105248_10000320 3300009177 Bacteria 56769
137 Ga0105248_10064684 3300009177 Bacteria 4106
138 Ga0105248_10151869 3300009177 Bacteria 2613
139 Ga0105248_10418829 3300009177 Unclassified 1508
140 Ga0105237_10003414 3300009545 Bacteria 18884
141 Ga0105237_10380881 3300009545 Bacteria 1415
142 Ga0105238_10268052 3300009551 Unclassified 1688
143 Ga0105249_10010334 3300009553 Bacteria 8204
144 Ga0105249_10010478 3300009553 Bacteria 8144
145 Ga0157371_10045529 3300013102 Bacteria 3122
146 Ga0157374_10215115 3300013296 Unclassified 1885
147 Ga0157378_10194548 3300013297 Bacteria 1915
148 Ga0163162_10058655 3300013306 Bacteria 3879
149 Ga0163162_10339723 3300013306 Bacteria 1634
150 Ga0157372_10042161 3300013307 Bacteria 5046
151 Ga0157375_10029620 3300013308 Bacteria 5152
152 Ga0157375_10053039 3300013308 Unclassified 3988
153 Ga0163163_10243799 3300014325 Unclassified 1847
154 Ga0157380_10000079 3300014326 Bacteria 53933
155 Ga0157380_10008298 3300014326 Bacteria 7402
156 Ga0157380_10112661 3300014326 Bacteria 2289
157 Ga0157380_10117720 3300014326 Bacteria 2244
158 Ga0157377_10083248 3300014745 Bacteria 1874
159 Ga0157379_10014934 3300014968 Bacteria 6811
160 Ga0157379_10036373 3300014968 Bacteria 4391
161 Ga0182005_1025491 3300015265 Unclassified 1614
162 Ga0213874_10003011 3300021377 Bacteria 3695
163 Ga0213876_10000006 3300021384 Bacteria 700803
164 Ga0213875_10010438 3300021388 Bacteria 4646
165 Ga0207697_10009967 3300025315 Bacteria 4082
166 Ga0207656_10005700 3300025321 Bacteria 4425
167 Ga0207653_10000797 3300025885 Bacteria 10615
168 Ga0207642_10029987 3300025899 Bacteria 2260
169 Ga0207710_10024887 3300025900 Bacteria 2581
170 Ga0207647_10013309 3300025904 Bacteria 5709
171 Ga0207647_10061902 3300025904 Bacteria 2281
172 Ga0207645_10008309 3300025907 Bacteria 7250
173 Ga0207645_10052422 3300025907 Bacteria 2607
174 Ga0207645_10082962 3300025907 Bacteria 2055
175 Ga0207643_10001531 3300025908 Bacteria 13202
176 Ga0207705_10051366 3300025909 Bacteria 2967
177 Ga0207654_10078221 3300025911 Bacteria 1984
178 Ga0207707_10011118 3300025912 Bacteria 7828
179 Ga0207671_10001345 3300025914 Bacteria 28739
180 Ga0207660_10008205 3300025917 Bacteria 6758
181 Ga0207662_10036812 3300025918 Bacteria 2862
182 Ga0207649_10001082 3300025920 Bacteria 16585
183 Ga0207649_10022126 3300025920 Unclassified 3671
184 Ga0207652_10126316 3300025921 Bacteria 2278
185 Ga0207681_10016065 3300025923 Bacteria 4675
186 Ga0207650_10015787 3300025925 Bacteria 5265
187 Ga0207650_10021185 3300025925 Bacteria 4595
188 Ga0207650_10029481 3300025925 Unclassified 3945
189 Ga0207650_10067119 3300025925 Unclassified 2691
190 Ga0207650_10134278 3300025925 Bacteria 1940
191 Ga0207659_10025155 3300025926 Bacteria 3996
192 Ga0207659_10079731 3300025926 Bacteria 2416
193 Ga0207644_10165260 3300025931 Unclassified 1724
194 Ga0207690_10087438 3300025932 Unclassified 2193
195 Ga0207706_10006761 3300025933 Bacteria 10603
196 Ga0207706_10011022 3300025933 Bacteria 8242
197 Ga0207706_10019734 3300025933 Bacteria 6063
198 Ga0207686_10096566 3300025934 Unclassified 1964
199 Ga0207709_10005341 3300025935 Bacteria 7310
200 Ga0207670_10000102 3300025936 Bacteria 58245
201 Ga0207665_10118651 3300025939 Unclassified 1867
202 Ga0207691_10000231 3300025940 Bacteria 54273
203 Ga0207691_10003324 3300025940 Bacteria 15656
204 Ga0207711_10004807 3300025941 Bacteria 11470
205 Ga0207689_10026236 3300025942 Bacteria 4879
206 Ga0207689_10253565 3300025942 Bacteria 1455
207 Ga0207661_10002053 3300025944 Bacteria 13859
208 Ga0207679_10003653 3300025945 Bacteria 9532
209 Ga0207679_10031375 3300025945 Bacteria 3719
210 Ga0207679_10031538 3300025945 Bacteria 3710
211 Ga0207712_10018620 3300025961 Bacteria 4525
212 Ga0207712_10033645 3300025961 Bacteria 3467
213 Ga0207712_10049948 3300025961 Bacteria 2918
214 Ga0207640_10057304 3300025981 Bacteria 2562
215 Ga0207658_10012059 3300025986 Bacteria 5896
216 Ga0207639_10195852 3300026041 Bacteria 1729
217 Ga0207678_10017100 3300026067 Bacteria 6367
218 Ga0207708_10000195 3300026075 Bacteria 47942
219 Ga0207708_10004889 3300026075 Bacteria 9884
220 Ga0207708_10026385 3300026075 Bacteria 4396
221 Ga0207648_10020865 3300026089 Bacteria 5898
222 Ga0207648_10121834 3300026089 Bacteria 2293
223 Ga0207676_10033188 3300026095 Bacteria 3898
224 Ga0207676_10042035 3300026095 Unclassified 3514
225 Ga0207674_10000111 3300026116 Bacteria 94237
226 Ga0207674_10000191 3300026116 Bacteria 75335
227 Ga0207674_10083165 3300026116 Unclassified 3201
228 Ga0207675_100002255 3300026118 Bacteria 19161
229 Ga0207675_100027839 3300026118 Bacteria 5265
230 Ga0207675_100038384 3300026118 Unclassified 4469
231 Ga0207675_100052557 3300026118 Bacteria 3801
232 Ga0207698_10011194 3300026142 Bacteria 5805
233 Ga0207428_10042405 3300027907 Unclassified 3680
234 Ga0268266_10288889 3300028379 Bacteria 1527
235 Ga0268264_10077705 3300028381 Bacteria 2828
236 Ga0268264_10103157 3300028381 Bacteria 2483
237 Ga0268264_10159160 3300028381 Bacteria 2032
238 Ga0307513_10002326 3300031456 Bacteria 26490
239 Ga0307408_100007762 3300031548 Bacteria 7093
240 Ga0307410_10047295 3300031852 Bacteria 2875
241 Ga0307410_10090525 3300031852 Unclassified 2170
242 Ga0307406_10002695 3300031901 Bacteria 9680
243 Ga0307416_100070679 3300032002 Bacteria 2896
244 Ga0307414_10192987 3300032004 Bacteria 1650
245 Ga0307411_10021712 3300032005 Bacteria 3763
246 Ga0307415_100038873 3300032126 Bacteria 3139
247 Ga0373925_0129532 3300037068 Bacteria 1966
248 Ga0436364_0238568 3300037853 Bacteria 4690
249 Ga0395901_0364330 3300038443 Unclassified 1490
250 Ga0242420_014626 3300038996 Unclassified 1349
251 Ga0436365_0259142 3300039437 Bacteria 5564
252 Ga0436365_0695157 3300039437 Bacteria 511493
253 Ga0436365_1305940 3300039437 Bacteria 2781
254 Ga0436363_0115927 3300039450 Bacteria 6324
255 Ga0436362_0239784 3300039453 Bacteria 4922
256 Ga0466967_0682056 3300045976 Bacteria 1017
257 Ga0495633_0070769 3300046558 Bacteria 1628
258 Ga0496108_0451321 3300048911 Bacteria 1123
259 Ga0496109_0026359 3300048912 Bacteria 5183
260 Ga0496110_0016730 3300048913 Bacteria 6126
261 Ga0496112_0340697 3300048915 Unclassified 1443
262 Ga0496113_0019349 3300048916 Unclassified 4761
263 Ga0501295_009407 3300049518 Bacteria 1502
264 Ga0501296_007142 3300049519 Unclassified 1278
265 Ga0501298_002472 3300049521 Bacteria 2796
266 Ga0501041_0048532 3300049577 Bacteria 2586
267 Ga0501046_0020336 3300049580 Bacteria 5493
268 Ga0501198_005338 3300049649 Bacteria 1807
269 Ga0501202_003395 3300049652 Unclassified 2726
270 Ga0501207_003851 3300049654 Bacteria 2020
271 Ga0501216_010749 3300049660 Unclassified 1476
272 Ga0501223_012110 3300049663 Bacteria 1728
273 Ga0501224_007810 3300049664 Bacteria 1558
274 Ga0501227_006201 3300049665 Bacteria 2570
275 Ga0501251_001090 3300049681 Bacteria 2495
276 Ga0501257_021965 3300049686 Bacteria 1508
277 Ga0501260_001039 3300049689 Bacteria 2243
278 Ga0501261_006650 3300049690 Bacteria 1473
279 Ga0501221_004181 3300049704 Bacteria 2390
280 Ga0501234_005071 3300049707 Bacteria 2064
281 Ga0501081_0149076 3300049743 Bacteria 1680
282 Ga0501270_005027 3300049767 Bacteria 1517
283 Ga0501045_0003538 3300049824 Bacteria 10717
284 Ga0501045_0295689 3300049824 Bacteria 1205
285 nmdc:mga05p37_124497_c1 3300050507 Bacteria 3166
286 nmdc:mga05p37_128712_c1 3300050507 Bacteria 3108
287 nmdc:mga05p37_39817_c2 3300050507 Unclassified 3198
288 nmdc:mga05p37_45799_c1 3300050507 Bacteria 5379
289 nmdc:mga05p37_471682_c1 3300050507 Bacteria 1448
290 nmdc:mga05p37_9613_c1 3300050507 Bacteria 11452
291 nmdc:mga09592_239815_c1 3300050508 Unclassified 1571
292 nmdc:mga0qj67_132223_c1 3300050509 Bacteria 2021
293 nmdc:mga0qj67_1419_c1 3300050509 Bacteria 16772
294 nmdc:mga0qj67_21667_c1 3300050509 Unclassified 4930
295 nmdc:mga0qj67_29075_c1 3300050509 Unclassified 4292
296 nmdc:mga0qj67_59217_c1 3300050509 Bacteria 3037
297 nmdc:mga06r32_21816_c1 3300050510 Bacteria 5913
298 nmdc:mga06r32_29035_c1 3300050510 Bacteria 5179
299 nmdc:mga06r32_90455_c1 3300050510 Bacteria 2990
300 nmdc:mga08y16_22103_c1 3300050511 Bacteria 6715
301 nmdc:mga0rr50_53691_c1 3300050513 Bacteria 2998
302 nmdc:mga08x19_11076_c1 3300050514 Bacteria 5428
303 nmdc:mga0a205_223975_c1 3300050515 Bacteria 1766
304 nmdc:mga0a205_62783_c1 3300050515 Unclassified 3589
305 nmdc:mga0a205_7847_c1 3300050515 Bacteria 9695
306 Ga0501084_0112755 3300054114 Bacteria 2285
307 Ga0530510_0022596 3300061734 Bacteria 4481
308 Ga0111539_10065985
309 SwRhRL3b_contig_4018325
310 JGI25406J46586_10000295
311 Ga0065704_10124707
312 Ga0065715_10005300
313 Ga0065715_10009273
314 Ga0065715_10029120
315 Ga0065715_10125006
316 Ga0065707_10087130
317 Ga0065707_10101810
318 Ga0070676_10073639
319 Ga0070683_100000174
320 Ga0070683_100008617
321 Ga0070683_100079604
322 Ga0070683_100108650
323 Ga0070690_100000223
324 Ga0070690_100004182
325 Ga0070690_100023692
326 Ga0070670_100002806
327 Ga0070670_100004892
328 Ga0070670_100032245
329 Ga0070670_100055210
330 Ga0070670_100192561
331 Ga0068869_100252773
332 Ga0070666_10090003
333 Ga0070680_100078744
334 Ga0068868_100134707
335 Ga0070689_100000048
336 Ga0070689_100026626
337 Ga0070689_100131247
338 Ga0070687_100002642
339 Ga0070661_100000900
340 Ga0070661_100029528
341 Ga0070692_10076526
342 Ga0070669_100032657
343 Ga0070675_100000681
344 Ga0070675_100088060
345 Ga0070671_100058913
346 Ga0070671_100114155
347 Ga0070674_100057340
348 Ga0070688_100000026
349 Ga0070667_100016775
350 Ga0070667_100025848
351 Ga0070703_10001550
352 Ga0070701_10000049
353 Ga0070701_10069711
354 Ga0070700_100000544
355 Ga0070700_100188651
356 Ga0070694_100015102
357 Ga0070694_100037016
358 Ga0070694_100043425
359 Ga0070694_100112050
360 Ga0070694_100130245
361 Ga0070663_100060177
362 Ga0070662_100004651
363 Ga0070662_100008824
364 Ga0070681_10005858
365 Ga0068867_100053359
366 Ga0068867_100110991
367 Ga0070685_10000043
368 Ga0070698_100192520
369 Ga0070684_100005004
370 Ga0070684_100023539
371 Ga0070684_100047185
372 Ga0070697_100063142
373 Ga0068853_100047502
374 Ga0070672_100010255
375 Ga0070686_100000064
376 Ga0070686_100134278
377 Ga0070695_100075227
378 Ga0070693_100027054
379 Ga0070665_100075626
380 Ga0070704_100012456
381 Ga0070704_100014381
382 Ga0070704_100060501
383 Ga0070664_100018983
384 Ga0070664_100088938
385 Ga0070664_100286853
386 Ga0070664_100335005
387 Ga0068857_100011166
388 Ga0068857_100011840
389 Ga0068854_100166040
390 Ga0068852_100023720
391 Ga0068859_100000246
392 Ga0068859_100107286
393 Ga0068864_100087134
394 Ga0068864_100168214
395 Ga0068861_100000794
396 Ga0068861_100012380
397 Ga0068861_100014630
398 Ga0068861_100016377
399 Ga0068851_10004845
400 Ga0068863_100009154
401 Ga0068858_100046740
402 Ga0068858_100068425
403 Ga0068860_100010156
404 Ga0068860_100076662
405 Ga0068862_100011868
406 Ga0081539_10000071
407 Ga0081539_10000654
408 Ga0097621_100015647
409 Ga0097621_100197184
410 Ga0075428_100289139
411 Ga0075430_100002017
412 Ga0075430_100006302
413 Ga0075430_100035945
414 Ga0075430_100132879
415 Ga0075431_100004500
416 Ga0075431_100029977
417 Ga0075431_100044160
418 Ga0075431_100080024
419 Ga0075433_10021695
420 Ga0075433_10030952
421 Ga0075433_10041171
422 Ga0075429_100076794
423 Ga0075429_100080812
424 Ga0075429_100095379
425 Ga0068865_100013510
426 Ga0075436_100014227
427 Ga0097620_100000246
428 Ga0097620_100107286
429 Ga0075435_100063178
430 Ga0105247_10008890
431 Ga0105247_10034049
432 Ga0114129_10027374
433 Ga0114129_10036557
434 Ga0114129_10080234
435 Ga0114129_10153700
436 Ga0114129_10202814
437 Ga0105243_10011743
438 Ga0105243_10143396
439 Ga0105243_10210700
440 Ga0105243_10434215
441 Ga0105241_10004277
442 Ga0105242_10069608
443 Ga0105248_10000320
444 Ga0105248_10064684
445 Ga0105248_10151869
446 Ga0105248_10418829
447 Ga0105237_10003414
448 Ga0105237_10380881
449 Ga0105238_10268052
450 Ga0105249_10010334
451 Ga0105249_10010478
452 Ga0157371_10045529
453 Ga0157374_10215115
454 Ga0157378_10194548
455 Ga0163162_10058655
456 Ga0163162_10339723
457 Ga0157372_10042161
458 Ga0157375_10029620
459 Ga0157375_10053039
460 Ga0163163_10243799
461 Ga0157380_10000079
462 Ga0157380_10008298
463 Ga0157380_10112661
464 Ga0157380_10117720
465 Ga0157377_10083248
466 Ga0157379_10014934
467 Ga0157379_10036373
468 Ga0182005_1025491
469 Ga0213874_10003011
470 Ga0213876_10000006
471 Ga0213875_10010438
472 Ga0207697_10009967
473 Ga0207656_10005700
474 Ga0207653_10000797
475 Ga0207642_10029987
476 Ga0207710_10024887
477 Ga0207647_10013309
478 Ga0207647_10061902
479 Ga0207645_10008309
480 Ga0207645_10052422
481 Ga0207645_10082962
482 Ga0207643_10001531
483 Ga0207705_10051366
484 Ga0207654_10078221
485 Ga0207707_10011118
486 Ga0207671_10001345
487 Ga0207660_10008205
488 Ga0207662_10036812
489 Ga0207649_10001082
490 Ga0207649_10022126
491 Ga0207652_10126316
492 Ga0207681_10016065
493 Ga0207650_10015787
494 Ga0207650_10021185
495 Ga0207650_10029481
496 Ga0207650_10067119
497 Ga0207650_10134278
498 Ga0207659_10025155
499 Ga0207659_10079731
500 Ga0207644_10165260
501 Ga0207690_10087438
502 Ga0207706_10006761
503 Ga0207706_10011022
504 Ga0207706_10019734
505 Ga0207686_10096566
506 Ga0207709_10005341
507 Ga0207670_10000102
508 Ga0207665_10118651
509 Ga0207691_10000231
510 Ga0207691_10003324
511 Ga0207711_10004807
512 Ga0207689_10026236
513 Ga0207689_10253565
514 Ga0207661_10002053
515 Ga0207679_10003653
516 Ga0207679_10031375
517 Ga0207679_10031538
518 Ga0207712_10018620
519 Ga0207712_10033645
520 Ga0207712_10049948
521 Ga0207640_10057304
522 Ga0207658_10012059
523 Ga0207639_10195852
524 Ga0207678_10017100
525 Ga0207708_10000195
526 Ga0207708_10004889
527 Ga0207708_10026385
528 Ga0207648_10020865
529 Ga0207648_10121834
530 Ga0207676_10033188
531 Ga0207676_10042035
532 Ga0207674_10000111
533 Ga0207674_10000191
534 Ga0207674_10083165
535 Ga0207675_100002255
536 Ga0207675_100027839
537 Ga0207675_100038384
538 Ga0207675_100052557
539 Ga0207698_10011194
540 Ga0207428_10042405
541 Ga0268266_10288889
542 Ga0268264_10077705
543 Ga0268264_10103157
544 Ga0268264_10159160
545 Ga0307513_10002326
546 Ga0307408_100007762
547 Ga0307410_10047295
548 Ga0307410_10090525
549 Ga0307406_10002695
550 Ga0307416_100070679
551 Ga0307414_10192987
552 Ga0307411_10021712
553 Ga0307415_100038873
554 Ga0373925_0129532
555 Ga0436364_0238568
556 Ga0395901_0364330
557 Ga0242420_014626
558 Ga0436365_0259142
559 Ga0436365_0695157
560 Ga0436365_1305940
561 Ga0436363_0115927
562 Ga0436362_0239784
563 Ga0466967_0682056
564 Ga0495633_0070769
565 Ga0496108_0451321
566 Ga0496109_0026359
567 Ga0496110_0016730
568 Ga0496112_0340697
569 Ga0496113_0019349
570 Ga0501295_009407
571 Ga0501296_007142
572 Ga0501298_002472
573 Ga0501041_0048532
574 Ga0501046_0020336
575 Ga0501198_005338
576 Ga0501202_003395
577 Ga0501207_003851
578 Ga0501216_010749
579 Ga0501223_012110
580 Ga0501224_007810
581 Ga0501227_006201
582 Ga0501251_001090
583 Ga0501257_021965
584 Ga0501260_001039
585 Ga0501261_006650
586 Ga0501221_004181
587 Ga0501234_005071
588 Ga0501081_0149076
589 Ga0501270_005027
590 Ga0501045_0003538
591 Ga0501045_0295689
592 nmdc:mga05p37_124497_c1
593 nmdc:mga05p37_128712_c1
594 nmdc:mga05p37_39817_c2
595 nmdc:mga05p37_45799_c1
596 nmdc:mga05p37_471682_c1
597 nmdc:mga05p37_9613_c1
598 nmdc:mga09592_239815_c1
599 nmdc:mga0qj67_132223_c1
600 nmdc:mga0qj67_1419_c1
601 nmdc:mga0qj67_21667_c1
602 nmdc:mga0qj67_29075_c1
603 nmdc:mga0qj67_59217_c1
604 nmdc:mga06r32_21816_c1
605 nmdc:mga06r32_29035_c1
606 nmdc:mga06r32_90455_c1
607 nmdc:mga08y16_22103_c1
608 nmdc:mga0rr50_53691_c1
609 nmdc:mga08x19_11076_c1
610 nmdc:mga0a205_223975_c1
611 nmdc:mga0a205_62783_c1
612 nmdc:mga0a205_7847_c1
613 Ga0501084_0112755
614 Ga0530510_0022596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

206

367

0.95

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

214

353

0.94

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

231

382

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8344 192 353
3qhp-assembly1.cif.gz_A crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from helicobacter pylori 0.8296 192 353
5i45-assembly1.cif.gz_A 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. 0.828 178 353
7vfm-assembly2.cif.gz_C crystal structure of sdgb (udp and sd peptide-binding form) 0.8131 82 371
7ec1-assembly1.cif.gz_B crystal structure of sdgb (ligand-free form) 0.8038 82 371
ID Description Score Start End Superfamily
5d00A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9193 188 347 3.40.50.2000
af_Q2G0L3_321_481_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9097 195 356 3.40.50.2000
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.901 194 352 3.40.50.2000
af_P96407_190_356_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8994 188 349 3.40.50.2000
af_Q2G0L3_321_481_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8938 195 356 3.40.50.2000
ID Description Score Start End GO Terms
AF-X1I0G9-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9322 225 367 GO:0016757
AF-A0A069S8H6-F1-model_v4 deleted 0.9251 192 370
AF-A0A069S8H6-F1-model_v4 deleted 0.9104 192 370
AF-A0A2H9PIZ1-F1-model_v4 Glycosyl transferase family 1 domain-containing protein 0.9091 205 366 GO:0016757
AF-A0A832M4N4-F1-model_v4 Glycosyltransferase 0.8975 206 377 GO:0016757

Map