F399664

General Info

Members Datasets Scaffolds Average Seq Length
308 192 616 308

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10005801|Ga0105238_100058017
Length 346
Sequence VKAPPNVEAIGASPAAAMGLGSPPRAAQAHDLQEGTTMRTRRLGSSGLKVSEVGLGCNNFGMRIDQKATQAVVDAALEAGVTFFDTADIYGGTKSEEFLGKALGKRRTDITLATKFGMRIGDDPRRMGGSRRWIMRAVEDSLTRLGTDYIDLYQFHSPDADTPIDETLRALDDLVTQGKVRYIGNSNFTGWQIADADWTAAGSTRFVSAQNLYSLLERKVEFEVLPACEHFGLGFLPFFPLASGLLSGKYKRGEKPPEGTRLAAWGSRGAAALNDRNFDKVEKLAAWAEERGHSILELAFAWLLGHPVVSSVIAGATSPEQVTGNAAAAEWQLSPEEVDEVGKLIG

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
164 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
165 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
166 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
167 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
168 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
169 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
187 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
188 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
192 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.17
Nodule 0
Rhizoplane 4.87
Rhizosphere 87.66
Stem 0
Stem Tuber 0
Unclassified 1.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10005801 3300009551 Bacteria 12226
2 SwRhRL3b_contig_3555482 2162886006 Bacteria 3733
3 SwRhRL2b_contig_137583 2162886007 Bacteria 2276
4 Ga0055530_10000045 3300003791 Bacteria 109202
5 Ga0055543_1010428 3300004625 Bacteria 1949
6 Ga0065165_1000649 3300005262 Bacteria 50230
7 Ga0065707_10188655 3300005295 Unclassified 1282
8 Ga0070658_10277312 3300005327 Bacteria 1427
9 Ga0070680_100001013 3300005336 Bacteria 20035
10 Ga0070680_100005593 3300005336 Bacteria 9516
11 Ga0070680_100073071 3300005336 Bacteria 2819
12 Ga0070660_100081533 3300005339 Bacteria 2540
13 Ga0070691_10004213 3300005341 Bacteria 6539
14 Ga0070668_100004226 3300005347 Bacteria 10656
15 Ga0070669_100009232 3300005353 Bacteria 7026
16 Ga0070671_100001734 3300005355 Bacteria 16560
17 Ga0070671_100021232 3300005355 Bacteria 5303
18 Ga0070671_100120697 3300005355 Bacteria 2206
19 Ga0070673_100014971 3300005364 Bacteria 5428
20 Ga0070659_100000180 3300005366 Bacteria 48763
21 Ga0070659_100165788 3300005366 Bacteria 1808
22 Ga0070667_100007220 3300005367 Bacteria 9232
23 Ga0070667_100173266 3300005367 Bacteria 1906
24 Ga0070678_100144796 3300005456 Bacteria 1906
25 Ga0070662_100005981 3300005457 Bacteria 7806
26 Ga0070681_10009755 3300005458 Bacteria 9449
27 Ga0070681_10009874 3300005458 Bacteria 9404
28 Ga0070681_10011958 3300005458 Bacteria 8605
29 Ga0070681_10309840 3300005458 Unclassified 1488
30 Ga0070685_10000694 3300005466 Bacteria 18232
31 Ga0070679_100087465 3300005530 Bacteria 3103
32 Ga0070679_100477965 3300005530 Bacteria 1190
33 Ga0068853_100031898 3300005539 Bacteria 4460
34 Ga0068853_100118013 3300005539 Bacteria 2364
35 Ga0068853_100133895 3300005539 Bacteria 2220
36 Ga0070686_100000021 3300005544 Bacteria 131944
37 Ga0070665_100000494 3300005548 Bacteria 56412
38 Ga0070665_100023592 3300005548 Bacteria 6194
39 Ga0068855_100003558 3300005563 Bacteria 19048
40 Ga0068855_100056647 3300005563 Bacteria 4598
41 Ga0068855_100153501 3300005563 Bacteria 2617
42 Ga0068855_100154103 3300005563 Bacteria 2611
43 Ga0068855_100326258 3300005563 Bacteria 1695
44 Ga0070664_100123509 3300005564 Bacteria 2269
45 Ga0070664_100167951 3300005564 Bacteria 1945
46 Ga0068857_100027332 3300005577 Bacteria 5033
47 Ga0068852_100056763 3300005616 Bacteria 3385
48 Ga0068852_100428275 3300005616 Bacteria 1306
49 Ga0068859_100001205 3300005617 Bacteria 26395
50 Ga0068864_100012449 3300005618 Bacteria 7033
51 Ga0068863_100012323 3300005841 Bacteria 8253
52 Ga0068858_100032980 3300005842 Bacteria 4810
53 Ga0068858_100034312 3300005842 Bacteria 4706
54 Ga0068858_100376092 3300005842 Bacteria 1363
55 Ga0068860_100553851 3300005843 Bacteria 1152
56 Ga0068862_100017663 3300005844 Bacteria 5939
57 Ga0081455_10081002 3300005937 Bacteria 2660
58 Ga0081539_10032183 3300005985 Bacteria 3216
59 Ga0070717_10102190 3300006028 Bacteria 2435
60 Ga0075367_10156435 3300006178 Bacteria 1416
61 Ga0075369_10028733 3300006186 Bacteria 2332
62 Ga0075366_10053131 3300006195 Bacteria 2406
63 Ga0097621_100022476 3300006237 Bacteria 4896
64 Ga0075370_10128089 3300006353 Bacteria 1480
65 Ga0075428_100000074 3300006844 Bacteria 82188
66 Ga0075428_100272829 3300006844 Bacteria 1820
67 Ga0075430_100007606 3300006846 Bacteria 9153
68 Ga0075431_100056861 3300006847 Bacteria 4035
69 Ga0075429_100000159 3300006880 Bacteria 42611
70 Ga0075429_100154980 3300006880 Bacteria 2006
71 Ga0068865_100002563 3300006881 Bacteria 10778
72 Ga0075436_100025201 3300006914 Bacteria 4091
73 Ga0097620_100001205 3300006931 Bacteria 26395
74 Ga0075435_100159670 3300007076 Bacteria 1898
75 Ga0105240_10004600 3300009093 Bacteria 20912
76 Ga0105240_10006444 3300009093 Bacteria 17256
77 Ga0105240_10008112 3300009093 Bacteria 15078
78 Ga0105240_10029248 3300009093 Bacteria 7184
79 Ga0105240_10063431 3300009093 Bacteria 4596
80 Ga0105240_10172247 3300009093 Bacteria 2562
81 Ga0105240_10196764 3300009093 Bacteria 2365
82 Ga0105240_10197159 3300009093 Bacteria 2363
83 Ga0105240_10326659 3300009093 Bacteria 1747
84 Ga0105240_10489347 3300009093 Bacteria 1370
85 Ga0111539_10039148 3300009094 Bacteria 5715
86 Ga0105245_10045441 3300009098 Bacteria 3923
87 Ga0114129_10000111 3300009147 Bacteria 81023
88 Ga0114129_10050911 3300009147 Bacteria 5816
89 Ga0114129_10055633 3300009147 Bacteria 5544
90 Ga0114129_10116798 3300009147 Bacteria 3676
91 Ga0105241_10176316 3300009174 Bacteria 1769
92 Ga0105248_10005094 3300009177 Bacteria 14500
93 Ga0105248_10012258 3300009177 Bacteria 9455
94 Ga0105248_10137497 3300009177 Bacteria 2756
95 Ga0105237_10003436 3300009545 Bacteria 18797
96 Ga0105237_10038728 3300009545 Bacteria 4814
97 Ga0105237_10458541 3300009545 Bacteria 1281
98 Ga0105238_10150511 3300009551 Bacteria 2302
99 Ga0105238_10496797 3300009551 Bacteria 1220
100 Ga0105239_10051933 3300010375 Bacteria 4494
101 Ga0157373_10178022 3300013100 Bacteria 1497
102 Ga0157370_10141207 3300013104 Bacteria 2244
103 Ga0157369_10178672 3300013105 Bacteria 2234
104 Ga0157374_10150636 3300013296 Bacteria 2261
105 Ga0163162_10273628 3300013306 Bacteria 1821
106 Ga0163162_10533912 3300013306 Bacteria 1302
107 Ga0157372_10014961 3300013307 Bacteria 8306
108 Ga0157372_10125019 3300013307 Bacteria 2957
109 Ga0157375_10008698 3300013308 Bacteria 8896
110 Ga0157375_10445519 3300013308 Bacteria 1460
111 Ga0163163_10013533 3300014325 Bacteria 7477
112 Ga0163163_10110035 3300014325 Bacteria 2783
113 Ga0163163_10257759 3300014325 Bacteria 1795
114 Ga0157379_10000951 3300014968 Bacteria 23496
115 Ga0157379_10483407 3300014968 Bacteria 1146
116 Ga0182005_1022081 3300015265 Bacteria 1744
117 Ga0209675_1000742 3300025291 Bacteria 21990
118 Ga0209758_1000782 3300025297 Bacteria 45683
119 Ga0209050_1000121 3300025298 Bacteria 196019
120 Ga0209257_1000125 3300025304 Bacteria 218126
121 Ga0207697_10035449 3300025315 Unclassified 2043
122 Ga0207705_10009333 3300025909 Bacteria 7135
123 Ga0207707_10029786 3300025912 Bacteria 4774
124 Ga0207707_10082000 3300025912 Bacteria 2815
125 Ga0207695_10000766 3300025913 Bacteria 61318
126 Ga0207695_10001045 3300025913 Bacteria 48612
127 Ga0207695_10012910 3300025913 Bacteria 9997
128 Ga0207695_10018705 3300025913 Bacteria 8000
129 Ga0207695_10054114 3300025913 Bacteria 4194
130 Ga0207695_10109480 3300025913 Bacteria 2744
131 Ga0207695_10121272 3300025913 Bacteria 2582
132 Ga0207695_10245186 3300025913 Bacteria 1692
133 Ga0207671_10326118 3300025914 Bacteria 1215
134 Ga0207660_10037265 3300025917 Bacteria 3387
135 Ga0207660_10052068 3300025917 Bacteria 2913
136 Ga0207660_10217984 3300025917 Bacteria 1497
137 Ga0207660_10306223 3300025917 Bacteria 1266
138 Ga0207657_10012953 3300025919 Bacteria 8199
139 Ga0207657_10051888 3300025919 Bacteria 3563
140 Ga0207694_10006700 3300025924 Bacteria 8755
141 Ga0207694_10089365 3300025924 Bacteria 2430
142 Ga0207650_10081976 3300025925 Bacteria 2448
143 Ga0207644_10000370 3300025931 Bacteria 29393
144 Ga0207644_10011564 3300025931 Bacteria 5843
145 Ga0207644_10054217 3300025931 Bacteria 2887
146 Ga0207644_10080133 3300025931 Bacteria 2411
147 Ga0207690_10000158 3300025932 Bacteria 53051
148 Ga0207690_10166258 3300025932 Bacteria 1649
149 Ga0207686_10024150 3300025934 Bacteria 3519
150 Ga0207704_10001722 3300025938 Bacteria 9793
151 Ga0207711_10000117 3300025941 Bacteria 81970
152 Ga0207711_10085495 3300025941 Bacteria 2764
153 Ga0207711_10170270 3300025941 Bacteria 1976
154 Ga0207667_10011337 3300025949 Bacteria 10366
155 Ga0207667_10019855 3300025949 Bacteria 7488
156 Ga0207667_10046609 3300025949 Bacteria 4590
157 Ga0207667_10079977 3300025949 Bacteria 3387
158 Ga0207667_10118412 3300025949 Bacteria 2729
159 Ga0207667_10292389 3300025949 Bacteria 1664
160 Ga0207668_10005379 3300025972 Bacteria 7535
161 Ga0207658_10187588 3300025986 Bacteria 1716
162 Ga0207703_10006324 3300026035 Bacteria 9467
163 Ga0207703_10104256 3300026035 Bacteria 2409
164 Ga0207703_10354820 3300026035 Bacteria 1351
165 Ga0207641_10006124 3300026088 Bacteria 10179
166 Ga0207641_10031355 3300026088 Bacteria 4409
167 Ga0207676_10023852 3300026095 Bacteria 4520
168 Ga0207674_10103303 3300026116 Bacteria 2829
169 Ga0207675_100066573 3300026118 Bacteria 3368
170 Ga0207683_10067071 3300026121 Bacteria 3165
171 Ga0207698_10223863 3300026142 Bacteria 1702
172 Ga0207698_10583568 3300026142 Bacteria 1100
173 Ga0209966_1001341 3300027695 Bacteria 4321
174 Ga0209974_10015527 3300027876 Bacteria 2528
175 Ga0268266_10000003 3300028379 Bacteria 1701703
176 Ga0268266_10007907 3300028379 Bacteria 9521
177 Ga0268264_10022206 3300028381 Bacteria 5180
178 Ga0307517_10033047 3300028786 Bacteria 5958
179 Ga0307517_10097903 3300028786 Bacteria 2338
180 Ga0265338_10044425 3300028800 Bacteria 4103
181 Ga0265338_10086431 3300028800 Bacteria 2610
182 Ga0265330_10040469 3300031235 Bacteria 2070
183 Ga0265328_10015836 3300031239 Bacteria 2948
184 Ga0265340_10004179 3300031247 Bacteria 8103
185 Ga0265339_10007579 3300031249 Bacteria 6993
186 Ga0265327_10000130 3300031251 Bacteria 165066
187 Ga0265316_10011875 3300031344 Bacteria 7832
188 Ga0307513_10000698 3300031456 Bacteria 48179
189 Ga0265313_10002425 3300031595 Bacteria 16114
190 Ga0265314_10002326 3300031711 Bacteria 19631
191 Ga0265314_10013661 3300031711 Bacteria 6547
192 Ga0265342_10007501 3300031712 Bacteria 7981
193 Ga0307406_10150542 3300031901 Bacteria 1659
194 Ga0307407_10003314 3300031903 Bacteria 6576
195 Ga0307412_10254584 3300031911 Bacteria 1365
196 Ga0307409_100504501 3300031995 Bacteria 1179
197 Ga0307510_10004404 3300033180 Bacteria 16566
198 Ga0373926_0071968 3300035083 Bacteria 1271
199 Ga0373936_0028363 3300035113 Bacteria 2200
200 Ga0373927_0020871 3300035695 Bacteria 4293
201 Ga0373925_0000003 3300037068 Bacteria 362401
202 Ga0395899_0001234 3300037312 Bacteria 22332
203 Ga0395900_0000567 3300037418 Bacteria 51172
204 Ga0395900_0201646 3300037418 Bacteria 2012
205 Ga0395905_0026199 3300037471 Bacteria 5498
206 Ga0395905_0033390 3300037471 Bacteria 4834
207 Ga0395905_0071089 3300037471 Bacteria 3262
208 Ga0395901_0000032 3300038443 Bacteria 235172
209 Ga0395901_0077562 3300038443 Bacteria 3468
210 Ga0466961_0260230 3300044693 Bacteria 1064
211 Ga0495653_0202750 3300046463 Bacteria 1345
212 Ga0495628_0006846 3300046516 Bacteria 9907
213 Ga0495643_0000512 3300046522 Bacteria 48356
214 Ga0495668_0084736 3300046616 Bacteria 1738
215 Ga0495611_0005139 3300046648 Bacteria 5609
216 Ga0495625_0035377 3300046660 Bacteria 3682
217 Ga0495604_0098250 3300047317 Bacteria 2158
218 Ga0495672_0017502 3300047320 Bacteria 4794
219 Ga0495686_0017710 3300047472 Bacteria 4794
220 Ga0496100_0253849 3300048903 Bacteria 1302
221 Ga0496101_0071545 3300048904 Bacteria 2543
222 Ga0496102_0036380 3300048905 Bacteria 4435
223 Ga0496102_0153994 3300048905 Bacteria 2161
224 Ga0496102_0361490 3300048905 Bacteria 1367
225 Ga0496104_0060193 3300048907 Bacteria 3597
226 Ga0496105_0024649 3300048908 Bacteria 4889
227 Ga0496105_0035601 3300048908 Bacteria 4097
228 Ga0496108_0019364 3300048911 Bacteria 5589
229 Ga0496108_0336837 3300048911 Bacteria 1316
230 Ga0496109_0082508 3300048912 Bacteria 2963
231 Ga0496113_0066634 3300048916 Bacteria 2728
232 Ga0496115_0000107 3300048918 Bacteria 76028
233 Ga0496115_0002097 3300048918 Bacteria 14269
234 Ga0496115_0008616 3300048918 Bacteria 7553
235 Ga0501033_0221607 3300049570 Bacteria 1346
236 Ga0501034_0028855 3300049571 Bacteria 5644
237 Ga0501034_0143181 3300049571 Bacteria 2369
238 Ga0501034_0286293 3300049571 Bacteria 1587
239 Ga0501036_0288784 3300049572 Bacteria 1372
240 Ga0501037_0022866 3300049573 Bacteria 4623
241 Ga0501037_0165267 3300049573 Bacteria 1576
242 Ga0501038_0043767 3300049574 Bacteria 3892
243 Ga0501040_0009963 3300049576 Bacteria 6207
244 Ga0501041_0036559 3300049577 Bacteria 2975
245 Ga0501047_0093885 3300049581 Bacteria 2879
246 Ga0501048_0020784 3300049582 Bacteria 4810
247 Ga0501067_0000738 3300049583 Bacteria 17581
248 Ga0501067_0067140 3300049583 Bacteria 1985
249 Ga0501068_0004132 3300049584 Bacteria 7867
250 Ga0501069_0001858 3300049585 Bacteria 10543
251 Ga0501069_0007367 3300049585 Bacteria 5773
252 Ga0501070_0012039 3300049586 Bacteria 7300
253 Ga0501070_0012488 3300049586 Bacteria 7163
254 Ga0501070_0053556 3300049586 Bacteria 3346
255 Ga0501071_0000537 3300049587 Bacteria 19439
256 Ga0501071_0078776 3300049587 Bacteria 2408
257 Ga0501072_0013592 3300049588 Bacteria 6231
258 Ga0501073_0039274 3300049589 Bacteria 3353
259 Ga0501074_0012889 3300049590 Bacteria 6079
260 Ga0501074_0014605 3300049590 Bacteria 5713
261 Ga0501202_004585 3300049652 Bacteria 2419
262 Ga0501206_018987 3300049653 Bacteria 972
263 Ga0501230_014607 3300049667 Bacteria 1292
264 Ga0501233_002149 3300049668 Bacteria 3446
265 Ga0501235_000099 3300049669 Bacteria 13729
266 Ga0501242_004145 3300049674 Bacteria 1600
267 Ga0501253_032947 3300049683 Bacteria 1000
268 Ga0501079_0026387 3300049741 Bacteria 4454
269 Ga0501079_0088754 3300049741 Bacteria 2394
270 Ga0501080_0006637 3300049742 Bacteria 10409
271 Ga0501080_0022585 3300049742 Bacteria 5828
272 Ga0501080_0203194 3300049742 Bacteria 1818
273 Ga0501083_0006835 3300049744 Bacteria 8097
274 Ga0501083_0012531 3300049744 Bacteria 5932
275 Ga0501232_000942 3300049757 Bacteria 2160
276 Ga0501035_0084187 3300049822 Bacteria 2805
277 Ga0501035_0299421 3300049822 Bacteria 1355
278 Ga0501044_0002434 3300049823 Bacteria 21234
279 Ga0501044_0014181 3300049823 Bacteria 8606
280 Ga0501045_0030777 3300049824 Bacteria 3885
281 nmdc:mga06z11_258615_c1 3300050494 Bacteria 1027
282 nmdc:mga07m45_121947_c1 3300050496 Bacteria 1506
283 nmdc:mga07m45_34955_c1 3300050496 Bacteria 2795
284 nmdc:mga05p37_599_c1 3300050507 Bacteria 39739
285 nmdc:mga05p37_60366_c1 3300050507 Bacteria 4669
286 nmdc:mga09592_37896_c1 3300050508 Bacteria 4046
287 nmdc:mga0qj67_104647_c1 3300050509 Bacteria 2283
288 nmdc:mga0qj67_8954_c1 3300050509 Bacteria 7425
289 nmdc:mga0qj67_970_c1 3300050509 Bacteria 19746
290 nmdc:mga06r32_37778_c1 3300050510 Bacteria 4569
291 nmdc:mga06r32_7771_c1 3300050510 Bacteria 9640
292 nmdc:mga08y16_44297_c1 3300050511 Bacteria 4662
293 nmdc:mga0rr50_185486_c1 3300050513 Unclassified 1702
294 nmdc:mga0rr50_367300_c1 3300050513 Bacteria 1212
295 nmdc:mga08x19_128301_c1 3300050514 Unclassified 1704
296 nmdc:mga08x19_44098_c1 3300050514 Bacteria 2847
297 Ga0500641_0008628 3300053096 Bacteria 3644
298 Ga0500641_0010275 3300053096 Bacteria 3378
299 Ga0500562_001104 3300053108 Bacteria 6634
300 Ga0500562_003795 3300053108 Bacteria 3804
301 Ga0500595_012911 3300053119 Bacteria 3214
302 Ga0501084_0012482 3300054114 Bacteria 7039
303 Ga0501084_0379137 3300054114 Bacteria 1195
304 Ga0501082_0014604 3300060353 Bacteria 6764
305 Ga0501082_0017535 3300060353 Bacteria 6167
306 Ga0501082_0025313 3300060353 Bacteria 5113
307 Ga0530510_0165238 3300061734 Bacteria 1638
308 2939674045 2939669807 Bacteria 5028511
309 Ga0105238_10005801
310 SwRhRL3b_contig_3555482
311 SwRhRL2b_contig_137583
312 Ga0055530_10000045
313 Ga0055543_1010428
314 Ga0065165_1000649
315 Ga0065707_10188655
316 Ga0070658_10277312
317 Ga0070680_100001013
318 Ga0070680_100005593
319 Ga0070680_100073071
320 Ga0070660_100081533
321 Ga0070691_10004213
322 Ga0070668_100004226
323 Ga0070669_100009232
324 Ga0070671_100001734
325 Ga0070671_100021232
326 Ga0070671_100120697
327 Ga0070673_100014971
328 Ga0070659_100000180
329 Ga0070659_100165788
330 Ga0070667_100007220
331 Ga0070667_100173266
332 Ga0070678_100144796
333 Ga0070662_100005981
334 Ga0070681_10009755
335 Ga0070681_10009874
336 Ga0070681_10011958
337 Ga0070681_10309840
338 Ga0070685_10000694
339 Ga0070679_100087465
340 Ga0070679_100477965
341 Ga0068853_100031898
342 Ga0068853_100118013
343 Ga0068853_100133895
344 Ga0070686_100000021
345 Ga0070665_100000494
346 Ga0070665_100023592
347 Ga0068855_100003558
348 Ga0068855_100056647
349 Ga0068855_100153501
350 Ga0068855_100154103
351 Ga0068855_100326258
352 Ga0070664_100123509
353 Ga0070664_100167951
354 Ga0068857_100027332
355 Ga0068852_100056763
356 Ga0068852_100428275
357 Ga0068859_100001205
358 Ga0068864_100012449
359 Ga0068863_100012323
360 Ga0068858_100032980
361 Ga0068858_100034312
362 Ga0068858_100376092
363 Ga0068860_100553851
364 Ga0068862_100017663
365 Ga0081455_10081002
366 Ga0081539_10032183
367 Ga0070717_10102190
368 Ga0075367_10156435
369 Ga0075369_10028733
370 Ga0075366_10053131
371 Ga0097621_100022476
372 Ga0075370_10128089
373 Ga0075428_100000074
374 Ga0075428_100272829
375 Ga0075430_100007606
376 Ga0075431_100056861
377 Ga0075429_100000159
378 Ga0075429_100154980
379 Ga0068865_100002563
380 Ga0075436_100025201
381 Ga0097620_100001205
382 Ga0075435_100159670
383 Ga0105240_10004600
384 Ga0105240_10006444
385 Ga0105240_10008112
386 Ga0105240_10029248
387 Ga0105240_10063431
388 Ga0105240_10172247
389 Ga0105240_10196764
390 Ga0105240_10197159
391 Ga0105240_10326659
392 Ga0105240_10489347
393 Ga0111539_10039148
394 Ga0105245_10045441
395 Ga0114129_10000111
396 Ga0114129_10050911
397 Ga0114129_10055633
398 Ga0114129_10116798
399 Ga0105241_10176316
400 Ga0105248_10005094
401 Ga0105248_10012258
402 Ga0105248_10137497
403 Ga0105237_10003436
404 Ga0105237_10038728
405 Ga0105237_10458541
406 Ga0105238_10150511
407 Ga0105238_10496797
408 Ga0105239_10051933
409 Ga0157373_10178022
410 Ga0157370_10141207
411 Ga0157369_10178672
412 Ga0157374_10150636
413 Ga0163162_10273628
414 Ga0163162_10533912
415 Ga0157372_10014961
416 Ga0157372_10125019
417 Ga0157375_10008698
418 Ga0157375_10445519
419 Ga0163163_10013533
420 Ga0163163_10110035
421 Ga0163163_10257759
422 Ga0157379_10000951
423 Ga0157379_10483407
424 Ga0182005_1022081
425 Ga0209675_1000742
426 Ga0209758_1000782
427 Ga0209050_1000121
428 Ga0209257_1000125
429 Ga0207697_10035449
430 Ga0207705_10009333
431 Ga0207707_10029786
432 Ga0207707_10082000
433 Ga0207695_10000766
434 Ga0207695_10001045
435 Ga0207695_10012910
436 Ga0207695_10018705
437 Ga0207695_10054114
438 Ga0207695_10109480
439 Ga0207695_10121272
440 Ga0207695_10245186
441 Ga0207671_10326118
442 Ga0207660_10037265
443 Ga0207660_10052068
444 Ga0207660_10217984
445 Ga0207660_10306223
446 Ga0207657_10012953
447 Ga0207657_10051888
448 Ga0207694_10006700
449 Ga0207694_10089365
450 Ga0207650_10081976
451 Ga0207644_10000370
452 Ga0207644_10011564
453 Ga0207644_10054217
454 Ga0207644_10080133
455 Ga0207690_10000158
456 Ga0207690_10166258
457 Ga0207686_10024150
458 Ga0207704_10001722
459 Ga0207711_10000117
460 Ga0207711_10085495
461 Ga0207711_10170270
462 Ga0207667_10011337
463 Ga0207667_10019855
464 Ga0207667_10046609
465 Ga0207667_10079977
466 Ga0207667_10118412
467 Ga0207667_10292389
468 Ga0207668_10005379
469 Ga0207658_10187588
470 Ga0207703_10006324
471 Ga0207703_10104256
472 Ga0207703_10354820
473 Ga0207641_10006124
474 Ga0207641_10031355
475 Ga0207676_10023852
476 Ga0207674_10103303
477 Ga0207675_100066573
478 Ga0207683_10067071
479 Ga0207698_10223863
480 Ga0207698_10583568
481 Ga0209966_1001341
482 Ga0209974_10015527
483 Ga0268266_10000003
484 Ga0268266_10007907
485 Ga0268264_10022206
486 Ga0307517_10033047
487 Ga0307517_10097903
488 Ga0265338_10044425
489 Ga0265338_10086431
490 Ga0265330_10040469
491 Ga0265328_10015836
492 Ga0265340_10004179
493 Ga0265339_10007579
494 Ga0265327_10000130
495 Ga0265316_10011875
496 Ga0307513_10000698
497 Ga0265313_10002425
498 Ga0265314_10002326
499 Ga0265314_10013661
500 Ga0265342_10007501
501 Ga0307406_10150542
502 Ga0307407_10003314
503 Ga0307412_10254584
504 Ga0307409_100504501
505 Ga0307510_10004404
506 Ga0373926_0071968
507 Ga0373936_0028363
508 Ga0373927_0020871
509 Ga0373925_0000003
510 Ga0395899_0001234
511 Ga0395900_0000567
512 Ga0395900_0201646
513 Ga0395905_0026199
514 Ga0395905_0033390
515 Ga0395905_0071089
516 Ga0395901_0000032
517 Ga0395901_0077562
518 Ga0466961_0260230
519 Ga0495653_0202750
520 Ga0495628_0006846
521 Ga0495643_0000512
522 Ga0495668_0084736
523 Ga0495611_0005139
524 Ga0495625_0035377
525 Ga0495604_0098250
526 Ga0495672_0017502
527 Ga0495686_0017710
528 Ga0496100_0253849
529 Ga0496101_0071545
530 Ga0496102_0036380
531 Ga0496102_0153994
532 Ga0496102_0361490
533 Ga0496104_0060193
534 Ga0496105_0024649
535 Ga0496105_0035601
536 Ga0496108_0019364
537 Ga0496108_0336837
538 Ga0496109_0082508
539 Ga0496113_0066634
540 Ga0496115_0000107
541 Ga0496115_0002097
542 Ga0496115_0008616
543 Ga0501033_0221607
544 Ga0501034_0028855
545 Ga0501034_0143181
546 Ga0501034_0286293
547 Ga0501036_0288784
548 Ga0501037_0022866
549 Ga0501037_0165267
550 Ga0501038_0043767
551 Ga0501040_0009963
552 Ga0501041_0036559
553 Ga0501047_0093885
554 Ga0501048_0020784
555 Ga0501067_0000738
556 Ga0501067_0067140
557 Ga0501068_0004132
558 Ga0501069_0001858
559 Ga0501069_0007367
560 Ga0501070_0012039
561 Ga0501070_0012488
562 Ga0501070_0053556
563 Ga0501071_0000537
564 Ga0501071_0078776
565 Ga0501072_0013592
566 Ga0501073_0039274
567 Ga0501074_0012889
568 Ga0501074_0014605
569 Ga0501202_004585
570 Ga0501206_018987
571 Ga0501230_014607
572 Ga0501233_002149
573 Ga0501235_000099
574 Ga0501242_004145
575 Ga0501253_032947
576 Ga0501079_0026387
577 Ga0501079_0088754
578 Ga0501080_0006637
579 Ga0501080_0022585
580 Ga0501080_0203194
581 Ga0501083_0006835
582 Ga0501083_0012531
583 Ga0501232_000942
584 Ga0501035_0084187
585 Ga0501035_0299421
586 Ga0501044_0002434
587 Ga0501044_0014181
588 Ga0501045_0030777
589 nmdc:mga06z11_258615_c1
590 nmdc:mga07m45_121947_c1
591 nmdc:mga07m45_34955_c1
592 nmdc:mga05p37_599_c1
593 nmdc:mga05p37_60366_c1
594 nmdc:mga09592_37896_c1
595 nmdc:mga0qj67_104647_c1
596 nmdc:mga0qj67_8954_c1
597 nmdc:mga0qj67_970_c1
598 nmdc:mga06r32_37778_c1
599 nmdc:mga06r32_7771_c1
600 nmdc:mga08y16_44297_c1
601 nmdc:mga0rr50_185486_c1
602 nmdc:mga0rr50_367300_c1
603 nmdc:mga08x19_128301_c1
604 nmdc:mga08x19_44098_c1
605 Ga0500641_0008628
606 Ga0500641_0010275
607 Ga0500562_001104
608 Ga0500562_003795
609 Ga0500595_012911
610 Ga0501084_0012482
611 Ga0501084_0379137
612 Ga0501082_0014604
613 Ga0501082_0017535
614 Ga0501082_0025313
615 Ga0530510_0165238
616 2939674045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

52

345

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ow0-assembly1.cif.gz_A crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with nad+ and peg 0.8869 1 292
4aub-assembly1.cif.gz_B the complex structure of the bacterial aldo-keto reductase akr14a1 with nadp and citrate 0.8841 1 290
4aub-assembly1.cif.gz_C the complex structure of the bacterial aldo-keto reductase akr14a1 with nadp and citrate 0.8809 1 289
4aub-assembly1.cif.gz_G the complex structure of the bacterial aldo-keto reductase akr14a1 with nadp and citrate 0.8792 1 290
6ow0-assembly1.cif.gz_A crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with nad+ and peg 0.8755 1 292
ID Description Score Start End Superfamily
af_A0A0P0W8U8_11_146_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.907 1 107 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8945 1 294 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8888 1 294 3.20.20.100
af_E9QGU5_66_406_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8755 1 294 3.20.20.100
af_E9QGU5_66_406_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8699 1 294 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2V6DPK9-F1-model_v4 Aldo/keto reductase 0.9951 1 80
AF-A0A4V1ZTL2-F1-model_v4 Aldo/keto reductase 0.9758 1 107 GO:0005829
AF-A0A2V6DPK9-F1-model_v4 Aldo/keto reductase 0.971 1 80
AF-A0A4V1ZTL2-F1-model_v4 Aldo/keto reductase 0.9582 1 107 GO:0005829
AF-T1C6M3-F1-model_v4 Aldo/keto reductase 0.9572 2 97 GO:0005829

Map