F399422

General Info

Members Datasets Scaffolds Average Seq Length
307 224 255 328

Family's Representative Sequence

Representative Sequence 3300053093|Ga0500651_0000540|Ga0500651_0000540_8241_9338
Length 365
Sequence MRGKFGRQFGLTWIRGGRKVAALRSSLMNLATDPKRKAVRQTTGAEPGHNHPRNSGIAFNEEAVLGPTINLSAVERRTASLPARRSVKKEYQAAWLVKAIQCIDLTTLAGDDTPARVHRLCAKAKSPLRADLVEALGLVDDAPKVGAVCVYPTMVNPAVEALTGSGIPVASVATGFPAGLMPLDLRLEEIRRAVADGAGEIDIVITRAHVFDQDWMALYDEIAAMRAACGPAHLKAILATGDLKTLRNVYRASMTAMMAGADFIKTSTGKEDVNATLPVSLVMVRAIREYLALTDFKVGFKPAGGLRTAKDAMNWQILMKEELGRAWLEPDLFRIGASSLLGDIERQLEHFVTGRYAALNRHAMA

Samples

Sample ID Description Type Environment
1 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
2 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
3 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
4 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
5 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
6 2643221693 Rhizobium sp. Root491 Isolate Unclassified
7 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
8 2751185800 Brucella pituitosa AA2 Isolate Unclassified
9 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
10 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
11 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
12 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
13 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
14 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
15 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
16 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
17 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
18 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
19 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
20 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
21 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
22 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
23 2854911287 Brucella lupini LUP21 Isolate Unclassified
24 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
25 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
26 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
27 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
28 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
29 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
30 2909042592 Labrys sp. LIt4 Isolate Nodule
31 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
32 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
33 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
34 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
35 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
36 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
37 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
38 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
39 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
40 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
41 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
42 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
43 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
44 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
45 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
46 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
47 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
48 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
49 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
50 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
51 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
52 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
53 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
54 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
55 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
56 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
57 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
127 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
145 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
146 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
196 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
203 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
204 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
205 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
206 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
207 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
208 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
209 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
210 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
211 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
214 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
215 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
216 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
219 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
220 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
221 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
224 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.06
Metatranscriptomes 0
Isolates 16.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.87
Nodule 1.63
Rhizoplane 2.28
Rhizosphere 52.77
Stem 0
Stem Tuber 0
Unclassified 23.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000619 3300003187 Bacteria 30988
2 JGI25153J46596_10000149 3300003215 Bacteria 70796
3 JGI25160J50197_1014967 3300003354 Bacteria 2568
4 Ga0055529_1006927 3300003763 Bacteria 1558
5 Ga0058692_1002934 3300003856 Bacteria 5494
6 Ga0065704_10144283 3300005289 Bacteria 1487
7 Ga0065707_10083216 3300005295 Bacteria 9971
8 Ga0070665_100004072 3300005548 Bacteria 15376
9 Ga0070665_100025367 3300005548 Bacteria 5974
10 Ga0068856_100354514 3300005614 Bacteria 1486
11 Ga0081455_10062226 3300005937 Bacteria 3138
12 Ga0081455_10141443 3300005937 Bacteria 1868
13 Ga0081455_10173394 3300005937 Bacteria 1640
14 Ga0081540_1087099 3300005983 Bacteria 1385
15 Ga0075368_10002035 3300006042 Bacteria 6541
16 Ga0075363_100057121 3300006048 Bacteria 2094
17 Ga0075364_10141684 3300006051 Bacteria 1617
18 Ga0075362_10034346 3300006177 Bacteria 2210
19 Ga0075369_10067639 3300006186 Bacteria 1569
20 Ga0075369_10086504 3300006186 Bacteria 1395
21 Ga0075366_10005425 3300006195 Bacteria 6907
22 Ga0075430_100043482 3300006846 Bacteria 3797
23 Ga0099826_10000076 3300006948 Bacteria 51489
24 Ga0105244_10057900 3300009036 Bacteria 1958
25 Ga0105240_10056875 3300009093 Bacteria 4892
26 Ga0105240_10120521 3300009093 Bacteria 3159
27 Ga0105240_10202063 3300009093 Bacteria 2328
28 Ga0111539_10238142 3300009094 Bacteria 2118
29 Ga0105247_10033141 3300009101 Bacteria 3140
30 Ga0105241_10177379 3300009174 Bacteria 1765
31 Ga0105248_10089888 3300009177 Bacteria 3458
32 Ga0105237_10588021 3300009545 Bacteria 1120
33 Ga0105238_10151768 3300009551 Bacteria 2292
34 Ga0105239_10201061 3300010375 Bacteria 2232
35 Ga0105246_10062776 3300011119 Bacteria 2589
36 Ga0157373_10036315 3300013100 Bacteria 3538
37 Ga0157371_10000449 3300013102 Bacteria 50517
38 Ga0157370_10000208 3300013104 Bacteria 74371
39 Ga0157370_10005163 3300013104 Bacteria 14724
40 Ga0157369_10433101 3300013105 Bacteria 1363
41 Ga0157380_10001745 3300014326 Bacteria 14342
42 Ga0182008_10002592 3300014497 Bacteria 11226
43 Ga0183361_10003 3300016635 Bacteria 577277
44 Ga0163161_10000072 3300017792 Bacteria 102352
45 Ga0163161_10024093 3300017792 Bacteria 4297
46 Ga0207425_1007154 3300025245 Bacteria 2977
47 Ga0209148_1002768 3300025254 Bacteria 5523
48 Ga0209129_1001245 3300025258 Bacteria 14596
49 Ga0209455_1000491 3300025272 Bacteria 29006
50 Ga0209673_1001625 3300025273 Bacteria 19511
51 Ga0209130_1001584 3300025284 Bacteria 14297
52 Ga0209676_1027646 3300025292 Bacteria 1782
53 Ga0209025_1000121 3300025294 Bacteria 208700
54 Ga0209025_1000152 3300025294 Bacteria 171558
55 Ga0209025_1003549 3300025294 Bacteria 14627
56 Ga0209758_1000060 3300025297 Bacteria 324326
57 Ga0209758_1000983 3300025297 Bacteria 38351
58 Ga0209758_1001597 3300025297 Bacteria 25919
59 Ga0209050_1002798 3300025298 Bacteria 13965
60 Ga0207426_1000928 3300025302 Bacteria 29240
61 Ga0209257_1000589 3300025304 Bacteria 60641
62 Ga0207710_10016060 3300025900 Bacteria 3167
63 Ga0207710_10105420 3300025900 Bacteria 1334
64 Ga0207695_10012518 3300025913 Bacteria 10174
65 Ga0207695_10141956 3300025913 Bacteria 2349
66 Ga0207695_10303442 3300025913 Bacteria 1488
67 Ga0207694_10231927 3300025924 Bacteria 1507
68 Ga0207711_10130486 3300025941 Bacteria 2253
69 Ga0207675_100036047 3300026118 Bacteria 4613
70 Ga0209371_1000470 3300027312 Bacteria 39753
71 Ga0209282_1000039 3300027666 Bacteria 128517
72 Ga0307515_10125968 3300028794 Bacteria 2861
73 Ga0268256_1000403 3300030500 Bacteria 39336
74 Ga0265328_10031127 3300031239 Bacteria 1984
75 Ga0265325_10027365 3300031241 Bacteria 3081
76 Ga0265339_10015966 3300031249 Bacteria 4488
77 Ga0265316_10075187 3300031344 Bacteria 2598
78 Ga0307513_10080954 3300031456 Bacteria 3348
79 Ga0307513_10114175 3300031456 Bacteria 2687
80 Ga0307513_10273492 3300031456 Bacteria 1471
81 Ga0307513_10314416 3300031456 Bacteria 1327
82 Ga0265314_10127070 3300031711 Bacteria 1595
83 Ga0307405_10046568 3300031731 Bacteria 2665
84 Ga0307413_10122426 3300031824 Bacteria 1764
85 Ga0307410_10129559 3300031852 Bacteria 1851
86 Ga0307406_10069689 3300031901 Bacteria 2300
87 Ga0307407_10007304 3300031903 Bacteria 4994
88 Ga0307412_10212430 3300031911 Bacteria 1477
89 Ga0307409_100017572 3300031995 Bacteria 4773
90 Ga0307416_100256948 3300032002 Bacteria 1704
91 Ga0307414_10110734 3300032004 Bacteria 2089
92 Ga0307411_10002563 3300032005 Bacteria 8106
93 Ga0307415_100012533 3300032126 Bacteria 4905
94 Ga0316583_10080573 3300032133 Bacteria 1138
95 Ga0316585_10025622 3300032137 Bacteria 1831
96 Ga0316574_0026786 3300035398 Bacteria 3468
97 Ga0316582_0018385 3300036647 Bacteria 4067
98 Ga0316584_0115948 3300036712 Bacteria 2003
99 Ga0395900_0111546 3300037418 Bacteria 2809
100 Ga0395901_0152950 3300038443 Bacteria 2424
101 Ga0395901_0380207 3300038443 Bacteria 1453
102 Ga0436365_0552994 3300039437 Bacteria 6127
103 Ga0436360_0181426 3300039438 Bacteria 2258
104 Ga0436360_0668465 3300039438 Bacteria 2419
105 Ga0436360_0921882 3300039438 Bacteria 1466
106 Ga0436360_0983805 3300039438 Bacteria 1429
107 Ga0436360_1193615 3300039438 Bacteria 2446
108 Ga0436361_0199286 3300039447 Bacteria 1990
109 Ga0436361_0884026 3300039447 Bacteria 4124
110 Ga0436363_0360175 3300039450 Bacteria 11887
111 Ga0436363_0826108 3300039450 Bacteria 1388
112 Ga0451577_0000001 3300042876 Bacteria 2461803
113 Ga0495603_0012371 3300046455 Bacteria 5167
114 Ga0495638_0004478 3300046460 Bacteria 10581
115 Ga0495638_0017763 3300046460 Bacteria 4737
116 Ga0495585_0012196 3300046492 Bacteria 5064
117 Ga0495610_0023399 3300046512 Bacteria 3360
118 Ga0495616_0000338 3300046513 Bacteria 37114
119 Ga0495628_0011056 3300046516 Bacteria 7639
120 Ga0495663_0014782 3300046525 Bacteria 2192
121 Ga0495654_0002141 3300046530 Bacteria 12881
122 Ga0495621_0000476 3300046539 Bacteria 9887
123 Ga0495668_0127800 3300046616 Bacteria 1391
124 Ga0495625_0011249 3300046660 Bacteria 7318
125 Ga0495588_0001055 3300046674 Bacteria 11982
126 Ga0495669_0023075 3300046684 Bacteria 2706
127 Ga0495669_0099312 3300046684 Bacteria 1351
128 Ga0495613_0114665 3300046689 Bacteria 1939
129 Ga0495671_0030710 3300046692 Bacteria 2750
130 Ga0495674_0016418 3300047319 Bacteria 6905
131 Ga0495676_0047094 3300047321 Bacteria 3491
132 Ga0495680_0019670 3300047322 Bacteria 5697
133 Ga0495681_0002572 3300047470 Bacteria 12896
134 Ga0495686_0008628 3300047472 Bacteria 7445
135 Ga0495686_0058474 3300047472 Bacteria 2403
136 Ga0495602_0059459 3300048088 Bacteria 3336
137 Ga0496105_0175269 3300048908 Bacteria 1757
138 Ga0496106_0000109 3300048909 Bacteria 64454
139 Ga0496110_0099373 3300048913 Bacteria 2609
140 Ga0496116_0025021 3300048919 Bacteria 4399
141 Ga0496117_0000033 3300048920 Bacteria 345605
142 Ga0496117_0002854 3300048920 Bacteria 21021
143 Ga0496117_0004670 3300048920 Bacteria 14883
144 Ga0496117_0052846 3300048920 Bacteria 2859
145 Ga0496117_0081505 3300048920 Bacteria 2123
146 Ga0496118_0003855 3300048921 Bacteria 18427
147 Ga0496118_0039627 3300048921 Bacteria 3756
148 Ga0496118_0146096 3300048921 Bacteria 1489
149 Ga0496118_0199408 3300048921 Bacteria 1187
150 Ga0496119_0014779 3300048922 Bacteria 6076
151 Ga0496119_0017334 3300048922 Bacteria 5420
152 Ga0496119_0063535 3300048922 Bacteria 2195
153 Ga0496119_0120990 3300048922 Bacteria 1439
154 Ga0496119_0176324 3300048922 Bacteria 1124
155 Ga0496119_0203704 3300048922 Bacteria 1022
156 Ga0496120_0001142 3300048923 Bacteria 34112
157 Ga0496121_0000033 3300048924 Bacteria 377542
158 Ga0496121_0163105 3300048924 Bacteria 1627
159 Ga0496122_0000720 3300048925 Bacteria 64794
160 Ga0496122_0005203 3300048925 Bacteria 15624
161 Ga0496122_0043156 3300048925 Bacteria 3537
162 Ga0496122_0113143 3300048925 Bacteria 1774
163 Ga0496122_0190259 3300048925 Bacteria 1212
164 Ga0496123_0000018 3300048926 Bacteria 404553
165 Ga0496123_0000338 3300048926 Bacteria 88635
166 Ga0496123_0043990 3300048926 Bacteria 3058
167 Ga0496123_0133754 3300048926 Bacteria 1368
168 Ga0496124_0000940 3300048927 Bacteria 46669
169 Ga0496124_0010474 3300048927 Bacteria 9382
170 Ga0496124_0069102 3300048927 Bacteria 2934
171 Ga0496124_0151063 3300048927 Bacteria 1822
172 Ga0496125_0000152 3300048928 Bacteria 153295
173 Ga0496125_0000161 3300048928 Bacteria 150707
174 Ga0496125_0082077 3300048928 Bacteria 2459
175 Ga0496126_0000212 3300048929 Bacteria 128871
176 Ga0496126_0086029 3300048929 Bacteria 2771
177 Ga0496126_0181542 3300048929 Bacteria 1787
178 Ga0496126_0210974 3300048929 Bacteria 1635
179 Ga0496126_0297832 3300048929 Bacteria 1332
180 Ga0496126_0330277 3300048929 Bacteria 1251
181 Ga0501031_0035681 3300049568 Bacteria 3244
182 Ga0501032_0084978 3300049569 Bacteria 2104
183 Ga0501033_0001677 3300049570 Bacteria 19371
184 Ga0501033_0048832 3300049570 Bacteria 3143
185 Ga0501034_0016490 3300049571 Bacteria 7580
186 Ga0501034_0062849 3300049571 Bacteria 3727
187 Ga0501036_0111748 3300049572 Bacteria 2309
188 Ga0501037_0010169 3300049573 Bacteria 6902
189 Ga0501038_0000048 3300049574 Bacteria 104260
190 Ga0501038_0004291 3300049574 Bacteria 13257
191 Ga0501038_0079397 3300049574 Bacteria 2767
192 Ga0501039_0001766 3300049575 Bacteria 15962
193 Ga0501043_0005414 3300049579 Bacteria 10315
194 Ga0501043_0068466 3300049579 Bacteria 2787
195 Ga0501046_0000935 3300049580 Bacteria 28596
196 Ga0501047_0072052 3300049581 Bacteria 3325
197 Ga0501047_0072552 3300049581 Bacteria 3314
198 Ga0501047_0186324 3300049581 Bacteria 1941
199 Ga0501047_0372548 3300049581 Bacteria 1263
200 Ga0501048_0018044 3300049582 Bacteria 5193
201 Ga0501067_0050065 3300049583 Bacteria 2315
202 Ga0501069_0015291 3300049585 Bacteria 4112
203 Ga0501069_0059610 3300049585 Bacteria 2130
204 Ga0501070_0357850 3300049586 Bacteria 1184
205 Ga0501071_0194112 3300049587 Bacteria 1524
206 Ga0501073_0004474 3300049589 Bacteria 10498
207 Ga0501073_0122894 3300049589 Bacteria 1799
208 Ga0501074_0000740 3300049590 Bacteria 20523
209 Ga0501080_0055583 3300049742 Bacteria 3687
210 Ga0501080_0057484 3300049742 Bacteria 3621
211 Ga0501080_0348536 3300049742 Bacteria 1337
212 Ga0501083_0016385 3300049744 Bacteria 5187
213 Ga0501035_0021464 3300049822 Bacteria 5935
214 Ga0501035_0117543 3300049822 Bacteria 2327
215 Ga0501035_0178993 3300049822 Bacteria 1828
216 Ga0501044_0019288 3300049823 Bacteria 7297
217 Ga0501044_0037803 3300049823 Bacteria 5044
218 Ga0501044_0265138 3300049823 Bacteria 1655
219 nmdc:mga03683_13552_c1 3300050489 Bacteria 3004
220 nmdc:mga03n38_26022_c1 3300050490 Bacteria 2412
221 nmdc:mga00v17_159016_c1 3300050491 Bacteria 1454
222 nmdc:mga00v17_33_c1 3300050491 Bacteria 87180
223 nmdc:mga00v17_78216_c1 3300050491 Bacteria 2061
224 nmdc:mga0yw44_275076_c1 3300050492 Bacteria 1125
225 nmdc:mga0yw44_802_c1 3300050492 Bacteria 11699
226 nmdc:mga0k408_52466_c1 3300050493 Bacteria 2364
227 nmdc:mga06z11_9993_c1 3300050494 Bacteria 4023
228 nmdc:mga0qj67_36601_c1 3300050509 Bacteria 3841
229 nmdc:mga0sz30_75_c1 3300050516 Bacteria 38479
230 Ga0500651_0000540 3300053093 Bacteria 19274
231 Ga0500555_011614 3300053103 Bacteria 2532
232 Ga0500562_026562 3300053108 Bacteria 1518
233 Ga0500571_000093 3300053110 Bacteria 29025
234 Ga0500592_010969 3300053116 Bacteria 1447
235 Ga0500595_000696 3300053119 Bacteria 20077
236 Ga0500642_0000637 3300053130 Bacteria 10458
237 Ga0500655_000200 3300053133 Bacteria 14341
238 Ga0500561_0000677 3300053137 Bacteria 5411
239 Ga0500568_0000307 3300053139 Bacteria 39094
240 Ga0500568_0000829 3300053139 Bacteria 21735
241 Ga0500573_0031836 3300053140 Bacteria 3044
242 Ga0500577_0054777 3300053142 Bacteria 1512
243 Ga0500588_0003775 3300053146 Bacteria 3229
244 Ga0500604_0005095 3300053151 Bacteria 3473
245 Ga0500604_0006035 3300053151 Bacteria 3198
246 Ga0500604_0007440 3300053151 Bacteria 2901
247 Ga0500616_0000708 3300053153 Bacteria 38639
248 Ga0500624_000246 3300053157 Bacteria 19109
249 Ga0500634_0001722 3300053161 Bacteria 8741
250 Ga0500634_0004051 3300053161 Bacteria 6688
251 Ga0500636_0018046 3300053177 Bacteria 4171
252 Ga0500609_000657 3300053731 Bacteria 5269
253 Ga0500609_002992 3300053731 Bacteria 2403
254 Ga0501082_0053100 3300060353 Bacteria 3493
255 Ga0501082_0090048 3300060353 Bacteria 2649

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0026786 Ga0316574_0026786_185_973 262
2 3300036647 Ga0316582_0018385 Ga0316582_0018385_3176_3964 262
3 3300036712 Ga0316584_0115948 Ga0316584_0115948_125_913 262
4 3300046689 Ga0495613_0114665 Ga0495613_0114665_1088_1927 279
5 iso_pu_bacteria 2921296804 2921297436 280
6 3300048920 Ga0496117_0052846 Ga0496117_0052846_1964_2842 292
7 3300046455 Ga0495603_0012371 Ga0495603_0012371_75_1004 293
8 3300046684 Ga0495669_0099312 Ga0495669_0099312_40_969 293
9 3300046684 Ga0495669_0023075 Ga0495669_0023075_1803_2696 297
10 3300039438 Ga0436360_1193615 Ga0436360_1193615_13_912 299
11 3300032133 Ga0316583_10080573 Ga0316583_100805732 304
12 3300032137 Ga0316585_10025622 Ga0316585_100256222 304
13 3300049572 Ga0501036_0111748 Ga0501036_0111748_535_1458 307
14 3300049581 Ga0501047_0072552 Ga0501047_0072552_1530_2453 307
15 iso_pu_bacteria 2899275550 2899276125 308
16 iso_pu_bacteria 8057132660 8057133169 308
17 iso_pu_bacteria 2834578030 2834579070 310
18 iso_pu_bacteria 2891373044 2891376934 313
19 iso_pu_bacteria 2989771324 2989775276 313
20 iso_pu_bacteria 3005445848 3005450694 313
21 3300025245 Ga0207425_1007154 Ga0207425_10071545 314
22 3300025258 Ga0209129_1001245 Ga0209129_100124513 314
23 3300025294 Ga0209025_1003549 Ga0209025_100354913 314
24 3300025297 Ga0209758_1000983 Ga0209758_10009835 314
25 3300025297 Ga0209758_1001597 Ga0209758_100159719 314
26 3300048909 Ga0496106_0000109 Ga0496106_0000109_9671_10624 314
27 3300048922 Ga0496119_0120990 Ga0496119_0120990_30_983 314
28 3300053139 Ga0500568_0000307 Ga0500568_0000307_28791_29744 314
29 3300053151 Ga0500604_0005095 Ga0500604_0005095_2101_3054 314
30 iso_pu_bacteria 2554235003 2554249580 315
31 iso_pu_bacteria 2558860242 2559298071 315
32 iso_pu_bacteria 2600255279 2601612952 315
33 iso_pu_bacteria 2600255308 2601748498 315
34 iso_pu_bacteria 2643221693 2644519986 315
35 iso_pu_bacteria 2671180139 2671693165 315
36 iso_pu_bacteria 2751185800 2753359106 315
37 iso_pu_bacteria 2758568016 2758641347 315
38 iso_pu_bacteria 2808606387 2808989401 315
39 iso_pu_bacteria 2854681122 2854681602 315
40 iso_pu_bacteria 2854911287 2854914741 315
41 iso_pu_bacteria 2899845264 2899846193 315
42 iso_pu_bacteria 2926760298 2926765497 315
43 iso_pu_bacteria 2929138655 2929144262 315
44 iso_pu_bacteria 2933594066 2933596906 315
45 iso_pu_bacteria 2937843397 2937843484 315
46 iso_pu_bacteria 2979089926 2979095261 315
47 iso_pu_bacteria 2979095461 2979097513 315
48 iso_pu_bacteria 2979100975 2979103023 315
49 iso_pu_bacteria 8005658619 8005661313 315
50 3300005548 Ga0070665_100025367 Ga0070665_1000253672 316
51 3300005937 Ga0081455_10062226 Ga0081455_100622262 316
52 3300006042 Ga0075368_10002035 Ga0075368_100020352 316
53 3300006051 Ga0075364_10141684 Ga0075364_101416842 316
54 3300006177 Ga0075362_10034346 Ga0075362_100343463 316
55 3300006186 Ga0075369_10086504 Ga0075369_100865042 316
56 3300006195 Ga0075366_10005425 Ga0075366_100054256 316
57 3300006948 Ga0099826_10000076 Ga0099826_1000007633 316
58 3300027312 Ga0209371_1000470 Ga0209371_100047024 316
59 3300027666 Ga0209282_1000039 Ga0209282_100003985 316
60 3300030500 Ga0268256_1000403 Ga0268256_100040316 316
61 3300046674 Ga0495588_0001055 Ga0495588_0001055_7828_8787 316
62 3300046692 Ga0495671_0030710 Ga0495671_0030710_1167_2126 316
63 3300047470 Ga0495681_0002572 Ga0495681_0002572_6549_7508 316
64 3300048922 Ga0496119_0014779 Ga0496119_0014779_4451_5410 316
65 3300048922 Ga0496119_0017334 Ga0496119_0017334_721_1680 316
66 3300048922 Ga0496119_0063535 Ga0496119_0063535_30_989 316
67 3300048922 Ga0496119_0203704 Ga0496119_0203704_34_993 316
68 3300048923 Ga0496120_0001142 Ga0496120_0001142_2273_3232 316
69 3300048925 Ga0496122_0000720 Ga0496122_0000720_6312_7271 316
70 3300048925 Ga0496122_0190259 Ga0496122_0190259_96_1055 316
71 3300048926 Ga0496123_0000338 Ga0496123_0000338_30153_31112 316
72 3300048927 Ga0496124_0151063 Ga0496124_0151063_124_1083 316
73 3300048928 Ga0496125_0082077 Ga0496125_0082077_366_1325 316
74 3300048929 Ga0496126_0330277 Ga0496126_0330277_240_1199 316
75 3300053161 Ga0500634_0004051 Ga0500634_0004051_835_1794 316
76 iso_pu_bacteria 2904578770 2904581640 316
77 iso_pu_bacteria 2919119836 2919125065 316
78 3300048924 Ga0496121_0163105 Ga0496121_0163105_522_1541 317
79 3300025294 Ga0209025_1000121 Ga0209025_1000121144 318
80 3300048920 Ga0496117_0002854 Ga0496117_0002854_4549_5535 318
81 3300048925 Ga0496122_0005203 Ga0496122_0005203_9672_10658 318
82 3300048926 Ga0496123_0000018 Ga0496123_0000018_44485_45471 318
83 3300048927 Ga0496124_0000940 Ga0496124_0000940_37928_38914 318
84 3300048928 Ga0496125_0000161 Ga0496125_0000161_71943_72929 318
85 3300048929 Ga0496126_0000212 Ga0496126_0000212_65484_66470 318
86 3300049569 Ga0501032_0084978 Ga0501032_0084978_375_1349 318
87 3300049571 Ga0501034_0016490 Ga0501034_0016490_3632_4606 318
88 3300003763 Ga0055529_1006927 Ga0055529_10069272 320
89 3300005295 Ga0065707_10083216 Ga0065707_100832165 320
90 3300009094 Ga0111539_10238142 Ga0111539_102381421 320
91 3300009101 Ga0105247_10033141 Ga0105247_100331412 320
92 3300014326 Ga0157380_10001745 Ga0157380_100017457 320
93 3300025254 Ga0209148_1002768 Ga0209148_10027682 320
94 3300025272 Ga0209455_1000491 Ga0209455_100049119 320
95 3300025900 Ga0207710_10016060 Ga0207710_100160602 320
96 3300028794 Ga0307515_10125968 Ga0307515_101259683 320
97 3300031456 Ga0307513_10273492 Ga0307513_102734922 320
98 3300031456 Ga0307513_10314416 Ga0307513_103144162 320
99 3300046460 Ga0495638_0004478 Ga0495638_0004478_8751_9713 320
100 3300046660 Ga0495625_0011249 Ga0495625_0011249_712_1674 320
101 3300047472 Ga0495686_0008628 Ga0495686_0008628_5762_6724 320
102 3300003856 Ga0058692_1002934 Ga0058692_10029342 321
103 3300005289 Ga0065704_10144283 Ga0065704_101442832 321
104 3300013100 Ga0157373_10036315 Ga0157373_100363152 321
105 3300013102 Ga0157371_10000449 Ga0157371_100004497 321
106 3300013104 Ga0157370_10000208 Ga0157370_100002082 321
107 3300048921 Ga0496118_0199408 Ga0496118_0199408_76_1068 321
108 3300048922 Ga0496119_0176324 Ga0496119_0176324_68_1060 321
109 3300048929 Ga0496126_0297832 Ga0496126_0297832_146_1138 321
110 3300049574 Ga0501038_0000048 Ga0501038_0000048_85245_86264 321
111 3300050489 nmdc:mga03683_13552_c1 nmdc:mga03683_13552_c1_238_1230 321
112 3300050490 nmdc:mga03n38_26022_c1 nmdc:mga03n38_26022_c1_121_1113 321
113 3300050491 nmdc:mga00v17_33_c1 nmdc:mga00v17_33_c1_20154_21146 321
114 3300050492 nmdc:mga0yw44_802_c1 nmdc:mga0yw44_802_c1_10171_11163 321
115 3300050516 nmdc:mga0sz30_75_c1 nmdc:mga0sz30_75_c1_8376_9368 321
116 3300053137 Ga0500561_0000677 Ga0500561_0000677_96_1088 321
117 3300053157 Ga0500624_000246 Ga0500624_000246_9953_10945 321
118 3300053161 Ga0500634_0001722 Ga0500634_0001722_5975_6967 321
119 iso_pu_bacteria 2511231027 2511390842 321
120 iso_pu_bacteria 2765235802 2765466834 321
121 iso_pu_bacteria 2767802442 2770196156 321
122 iso_pu_bacteria 2775506902 2776268474 321
123 iso_pu_bacteria 2775506904 2776282055 321
124 iso_pu_bacteria 2839993093 2839997838 321
125 iso_pu_bacteria 2840764183 2840765107 321
126 iso_pu_bacteria 2842871566 2842876252 321
127 iso_pu_bacteria 2928521798 2928526369 321
128 iso_pu_bacteria 2954011201 2954012215 321
129 iso_pu_bacteria 3002141150 3002146206 321
130 3300006846 Ga0075430_100043482 Ga0075430_1000434822 322
131 3300026118 Ga0207675_100036047 Ga0207675_1000360472 322
132 3300049585 Ga0501069_0059610 Ga0501069_0059610_123_1139 322
133 3300049822 Ga0501035_0117543 Ga0501035_0117543_559_1575 322
134 3300050509 nmdc:mga0qj67_36601_c1 nmdc:mga0qj67_36601_c1_2141_3109 322
135 3300053140 Ga0500573_0031836 Ga0500573_0031836_1644_2645 322
136 3300009036 Ga0105244_10057900 Ga0105244_100579002 323
137 3300037418 Ga0395900_0111546 Ga0395900_0111546_1243_2241 323
138 3300038443 Ga0395901_0380207 Ga0395901_0380207_134_1132 323
139 3300042876 Ga0451577_0000001 Ga0451577_0000001_235770_236762 323
140 3300048920 Ga0496117_0000033 Ga0496117_0000033_139596_140594 323
141 3300048920 Ga0496117_0004670 Ga0496117_0004670_6328_7326 323
142 3300048921 Ga0496118_0003855 Ga0496118_0003855_8518_9516 323
143 3300048921 Ga0496118_0039627 Ga0496118_0039627_822_1820 323
144 3300048924 Ga0496121_0000033 Ga0496121_0000033_292372_293370 323
145 3300048925 Ga0496122_0113143 Ga0496122_0113143_359_1357 323
146 3300048926 Ga0496123_0043990 Ga0496123_0043990_1034_2032 323
147 3300048926 Ga0496123_0133754 Ga0496123_0133754_359_1357 323
148 3300048927 Ga0496124_0010474 Ga0496124_0010474_1355_2353 323
149 3300048927 Ga0496124_0069102 Ga0496124_0069102_1389_2387 323
150 3300048928 Ga0496125_0000152 Ga0496125_0000152_93248_94246 323
151 3300048929 Ga0496126_0181542 Ga0496126_0181542_147_1145 323
152 3300050491 nmdc:mga00v17_159016_c1 nmdc:mga00v17_159016_c1_97_1095 323
153 3300050491 nmdc:mga00v17_78216_c1 nmdc:mga00v17_78216_c1_460_1458 323
154 3300050492 nmdc:mga0yw44_275076_c1 nmdc:mga0yw44_275076_c1_68_1066 323
155 3300050493 nmdc:mga0k408_52466_c1 nmdc:mga0k408_52466_c1_1141_2139 323
156 3300050494 nmdc:mga06z11_9993_c1 nmdc:mga06z11_9993_c1_125_1123 323
157 3300003215 JGI25153J46596_10000149 JGI25153J46596_1000014943 324
158 3300005937 Ga0081455_10141443 Ga0081455_101414432 324
159 3300025297 Ga0209758_1000060 Ga0209758_1000060312 324
160 3300025298 Ga0209050_1002798 Ga0209050_10027989 324
161 3300025304 Ga0209257_1000589 Ga0209257_10005892 324
162 3300031456 Ga0307513_10114175 Ga0307513_101141752 324
163 3300039438 Ga0436360_0181426 Ga0436360_0181426_750_1739 324
164 3300049570 Ga0501033_0001677 Ga0501033_0001677_12285_13277 324
165 3300049570 Ga0501033_0048832 Ga0501033_0048832_1285_2289 324
166 3300049573 Ga0501037_0010169 Ga0501037_0010169_3249_4241 324
167 3300049574 Ga0501038_0004291 Ga0501038_0004291_2831_3823 324
168 3300049574 Ga0501038_0079397 Ga0501038_0079397_1609_2613 324
169 3300049575 Ga0501039_0001766 Ga0501039_0001766_7409_8401 324
170 3300049579 Ga0501043_0005414 Ga0501043_0005414_2793_3785 324
171 3300049579 Ga0501043_0068466 Ga0501043_0068466_1036_2040 324
172 3300049580 Ga0501046_0000935 Ga0501046_0000935_8927_9919 324
173 3300049581 Ga0501047_0072052 Ga0501047_0072052_468_1460 324
174 3300049581 Ga0501047_0186324 Ga0501047_0186324_713_1705 324
175 3300049581 Ga0501047_0372548 Ga0501047_0372548_122_1126 324
176 3300049582 Ga0501048_0018044 Ga0501048_0018044_1476_2468 324
177 3300049583 Ga0501067_0050065 Ga0501067_0050065_146_1138 324
178 3300049585 Ga0501069_0015291 Ga0501069_0015291_1603_2595 324
179 3300049586 Ga0501070_0357850 Ga0501070_0357850_23_1027 324
180 3300049587 Ga0501071_0194112 Ga0501071_0194112_431_1423 324
181 3300049589 Ga0501073_0004474 Ga0501073_0004474_1945_2937 324
182 3300049589 Ga0501073_0122894 Ga0501073_0122894_616_1608 324
183 3300049590 Ga0501074_0000740 Ga0501074_0000740_15612_16604 324
184 3300049742 Ga0501080_0055583 Ga0501080_0055583_1846_2850 324
185 3300049742 Ga0501080_0057484 Ga0501080_0057484_1866_2858 324
186 3300049742 Ga0501080_0348536 Ga0501080_0348536_201_1193 324
187 3300049744 Ga0501083_0016385 Ga0501083_0016385_2848_3840 324
188 3300049822 Ga0501035_0021464 Ga0501035_0021464_1581_2573 324
189 3300049822 Ga0501035_0178993 Ga0501035_0178993_57_1061 324
190 3300049823 Ga0501044_0019288 Ga0501044_0019288_4487_5491 324
191 3300049823 Ga0501044_0037803 Ga0501044_0037803_2848_3840 324
192 3300049823 Ga0501044_0265138 Ga0501044_0265138_280_1284 324
193 3300053119 Ga0500595_000696 Ga0500595_000696_6734_7738 324
194 3300053130 Ga0500642_0000637 Ga0500642_0000637_4383_5387 324
195 3300053151 Ga0500604_0006035 Ga0500604_0006035_411_1415 324
196 3300053151 Ga0500604_0007440 Ga0500604_0007440_1090_2094 324
197 3300053153 Ga0500616_0000708 Ga0500616_0000708_29234_30235 324
198 3300053731 Ga0500609_000657 Ga0500609_000657_2121_3125 324
199 3300053731 Ga0500609_002992 Ga0500609_002992_391_1392 324
200 3300060353 Ga0501082_0053100 Ga0501082_0053100_1738_2730 324
201 3300060353 Ga0501082_0090048 Ga0501082_0090048_526_1530 324
202 3300005614 Ga0068856_100354514 Ga0068856_1003545142 325
203 3300006048 Ga0075363_100057121 Ga0075363_1000571213 325
204 3300009093 Ga0105240_10056875 Ga0105240_100568752 325
205 3300009093 Ga0105240_10120521 Ga0105240_101205211 325
206 3300009093 Ga0105240_10202063 Ga0105240_102020632 325
207 3300009174 Ga0105241_10177379 Ga0105241_101773792 325
208 3300009177 Ga0105248_10089888 Ga0105248_100898882 325
209 3300009545 Ga0105237_10588021 Ga0105237_105880211 325
210 3300009551 Ga0105238_10151768 Ga0105238_101517682 325
211 3300010375 Ga0105239_10201061 Ga0105239_102010612 325
212 3300013105 Ga0157369_10433101 Ga0157369_104331012 325
213 3300025913 Ga0207695_10012518 Ga0207695_100125188 325
214 3300025913 Ga0207695_10141956 Ga0207695_101419562 325
215 3300025913 Ga0207695_10303442 Ga0207695_103034421 325
216 3300025924 Ga0207694_10231927 Ga0207694_102319272 325
217 3300031456 Ga0307513_10080954 Ga0307513_100809542 325
218 3300039437 Ga0436365_0552994 Ga0436365_0552994_3011_4003 325
219 3300039438 Ga0436360_0668465 Ga0436360_0668465_40_1026 325
220 3300039438 Ga0436360_0921882 Ga0436360_0921882_457_1443 325
221 3300039438 Ga0436360_0983805 Ga0436360_0983805_253_1239 325
222 3300039447 Ga0436361_0199286 Ga0436361_0199286_138_1124 325
223 3300039447 Ga0436361_0884026 Ga0436361_0884026_2788_3774 325
224 3300039450 Ga0436363_0826108 Ga0436363_0826108_189_1175 325
225 3300048908 Ga0496105_0175269 Ga0496105_0175269_629_1618 325
226 3300048913 Ga0496110_0099373 Ga0496110_0099373_756_1745 325
227 3300048920 Ga0496117_0081505 Ga0496117_0081505_1044_2030 325
228 3300048929 Ga0496126_0210974 Ga0496126_0210974_336_1325 325
229 iso_pu_bacteria 2821443989 2821445944 325
230 iso_pu_bacteria 2840878972 2840881946 325
231 3300053146 Ga0500588_0003775 Ga0500588_0003775_1395_2408 326
232 iso_pu_bacteria 2939669807 2939673677 326
233 iso_pu_bacteria 2996336353 2996338053 326
234 3300016635 Ga0183361_10003 Ga0183361_10003248 327
235 3300031711 Ga0265314_10127070 Ga0265314_101270702 327
236 3300039450 Ga0436363_0360175 Ga0436363_0360175_10254_11252 327
237 3300031239 Ga0265328_10031127 Ga0265328_100311272 328
238 3300031241 Ga0265325_10027365 Ga0265325_100273653 328
239 3300031249 Ga0265339_10015966 Ga0265339_100159662 328
240 3300031344 Ga0265316_10075187 Ga0265316_100751873 328
241 3300038443 Ga0395901_0152950 Ga0395901_0152950_1023_2012 328
242 iso_pu_bacteria 2889790730 2889794420 328
243 iso_pu_bacteria 2889914905 2889914931 328
244 3300005937 Ga0081455_10173394 Ga0081455_101733941 329
245 3300005983 Ga0081540_1087099 Ga0081540_10870992 329
246 iso_pu_bacteria 2909042592 2909046470 329
247 3300013104 Ga0157370_10005163 Ga0157370_1000516315 330
248 3300014497 Ga0182008_10002592 Ga0182008_1000259212 330
249 3300031731 Ga0307405_10046568 Ga0307405_100465683 330
250 3300031824 Ga0307413_10122426 Ga0307413_101224262 330
251 3300031852 Ga0307410_10129559 Ga0307410_101295591 330
252 3300031901 Ga0307406_10069689 Ga0307406_100696893 330
253 3300031903 Ga0307407_10007304 Ga0307407_100073044 330
254 3300031911 Ga0307412_10212430 Ga0307412_102124302 330
255 3300031995 Ga0307409_100017572 Ga0307409_1000175722 330
256 3300032002 Ga0307416_100256948 Ga0307416_1002569481 330
257 3300032004 Ga0307414_10110734 Ga0307414_101107341 330
258 3300032005 Ga0307411_10002563 Ga0307411_100025636 330
259 3300032126 Ga0307415_100012533 Ga0307415_1000125332 330
260 3300046516 Ga0495628_0011056 Ga0495628_0011056_6463_7470 330
261 3300049571 Ga0501034_0062849 Ga0501034_0062849_2131_3147 330
262 iso_pu_bacteria 2945909444 2945914119 330
263 iso_pu_bacteria 2945945610 2945947410 330
264 iso_pu_bacteria 2945972063 2945972110 330
265 iso_pu_bacteria 2945984333 2945984385 330
266 3300046492 Ga0495585_0012196 Ga0495585_0012196_663_1691 331
267 3300047319 Ga0495674_0016418 Ga0495674_0016418_47_1057 331
268 3300047322 Ga0495680_0019670 Ga0495680_0019670_4170_5177 331
269 3300048088 Ga0495602_0059459 Ga0495602_0059459_904_1911 331
270 3300049568 Ga0501031_0035681 Ga0501031_0035681_49_1050 331
271 3300025900 Ga0207710_10105420 Ga0207710_101054202 332
272 iso_pu_bacteria 2844533157 2844539959 332
273 3300006186 Ga0075369_10067639 Ga0075369_100676391 333
274 3300025941 Ga0207711_10130486 Ga0207711_101304862 333
275 3300047472 Ga0495686_0058474 Ga0495686_0058474_182_1192 333
276 3300048919 Ga0496116_0025021 Ga0496116_0025021_569_1579 333
277 3300048921 Ga0496118_0146096 Ga0496118_0146096_340_1350 333
278 3300005548 Ga0070665_100004072 Ga0070665_10000407210 334
279 3300011119 Ga0105246_10062776 Ga0105246_100627761 334
280 3300017792 Ga0163161_10000072 Ga0163161_1000007233 334
281 3300017792 Ga0163161_10024093 Ga0163161_100240933 334
282 3300025273 Ga0209673_1001625 Ga0209673_100162519 334
283 3300025292 Ga0209676_1027646 Ga0209676_10276462 334
284 3300046460 Ga0495638_0017763 Ga0495638_0017763_1780_2859 334
285 3300046512 Ga0495610_0023399 Ga0495610_0023399_1335_2414 334
286 3300046513 Ga0495616_0000338 Ga0495616_0000338_24281_25360 334
287 3300046525 Ga0495663_0014782 Ga0495663_0014782_436_1515 334
288 3300046530 Ga0495654_0002141 Ga0495654_0002141_5296_6375 334
289 3300046539 Ga0495621_0000476 Ga0495621_0000476_6971_8050 334
290 3300046616 Ga0495668_0127800 Ga0495668_0127800_234_1313 334
291 3300047321 Ga0495676_0047094 Ga0495676_0047094_2003_3082 334
292 3300048925 Ga0496122_0043156 Ga0496122_0043156_1840_2919 334
293 3300048929 Ga0496126_0086029 Ga0496126_0086029_235_1314 334
294 3300053108 Ga0500562_026562 Ga0500562_026562_377_1456 334
295 3300053110 Ga0500571_000093 Ga0500571_000093_261_1340 334
296 3300053116 Ga0500592_010969 Ga0500592_010969_10_1089 334
297 3300053133 Ga0500655_000200 Ga0500655_000200_1760_2839 334
298 3300053139 Ga0500568_0000829 Ga0500568_0000829_17937_19016 334
299 3300053177 Ga0500636_0018046 Ga0500636_0018046_1322_2401 334
300 3300053093 Ga0500651_0000540 Ga0500651_0000540_8241_9338 335
301 3300053103 Ga0500555_011614 Ga0500555_011614_101_1198 335
302 3300053142 Ga0500577_0054777 Ga0500577_0054777_49_1146 335
303 3300003187 JGI25151J46595_10000619 JGI25151J46595_100006192 336
304 3300003354 JGI25160J50197_1014967 JGI25160J50197_10149673 336
305 3300025284 Ga0209130_1001584 Ga0209130_10015844 336
306 3300025294 Ga0209025_1000152 Ga0209025_100015225 336
307 3300025302 Ga0207426_1000928 Ga0207426_100092825 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01791

DeoC

DeoC/LacD family aldolase

98

342

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c6m-assembly2.cif.gz_C crystal structure of deoxyribose-phosphate aldolase from shewanella halifaxensis 0.9347 62 320
1ktn-assembly1.cif.gz_A structural genomics, protein ec1535 0.9322 63 321
7p76-assembly12.cif.gz_L re-engineered 2-deoxy-d-ribose-5-phosphate aldolase catalysing asymmetric michael addition reactions, schiff base complex with cinnamaldehyde 0.9321 63 321
6z9i-assembly2.cif.gz_B escherichia coli d-2-deoxyribose-5-phosphate aldolase - n21k mutant complex with reaction products 0.932 63 321
7p76-assembly9.cif.gz_I re-engineered 2-deoxy-d-ribose-5-phosphate aldolase catalysing asymmetric michael addition reactions, schiff base complex with cinnamaldehyde 0.9307 63 319
ID Description Score Start End Superfamily
af_B0UYS4_42_315_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9784 63 332 3.20.20.70
af_B0UYS4_42_315_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9608 63 332 3.20.20.70
1jcjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9254 57 321 3.20.20.70
1jcjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9183 57 321 3.20.20.70
af_Q4DZ14_56_274_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9171 69 316 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A0N4YXV3-F1-model_v4 deoxyribose-phosphate aldolase (EC 4.1.2.4) (2-deoxy-D-ribose 5-phosphate aldolase) (Phosphodeoxyriboaldolase) 1.001 206 314 GO:0004139
GO:0005737
GO:0009264
GO:0016052
GO:0046386
AF-A0A529NGL4-F1-model_v4 deoxyribose-phosphate aldolase (EC 4.1.2.4) (2-deoxy-D-ribose 5-phosphate aldolase) (Phosphodeoxyriboaldolase) 0.9998 176 301 GO:0004139
GO:0005737
GO:0009264
GO:0016052
AF-A0A1B6DGS3-F1-model_v4 deoxyribose-phosphate aldolase (EC 4.1.2.4) (2-deoxy-D-ribose 5-phosphate aldolase) (Phosphodeoxyriboaldolase) 0.9982 189 295 GO:0004139
GO:0005737
GO:0009264
GO:0016052
GO:0046386
AF-G7YCW1-F1-model_v4 deoxyribose-phosphate aldolase (EC 4.1.2.4) (2-deoxy-D-ribose 5-phosphate aldolase) (Phosphodeoxyriboaldolase) 0.997 153 325 GO:0004139
GO:0005737
GO:0009264
GO:0016052
GO:0046386
AF-A0A3D4ACB7-F1-model_v4 deoxyribose-phosphate aldolase (EC 4.1.2.4) (2-deoxy-D-ribose 5-phosphate aldolase) (Phosphodeoxyriboaldolase) 0.9969 203 311 GO:0004139
GO:0005737
GO:0009264
GO:0016052

Feature Viewer

pLDDT pTM Quality
88.02 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map