F399268

General Info

Members Datasets Scaffolds Average Seq Length
307 180 614 163

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100469843|Ga0307416_1004698432
Length 186
Sequence VTRISVRVDGASYEDDVEPRTLLVHYLREQLGKVGTVVGCDTSNCGACTVHLDGEAVKSCTVFAVQADGCEVTTIEGIASPQGELHPVQKAFHEMHGLQCGFCTPGMIMASIDLLKDNPDPSEDEVREGIEGNLCRCTGYQNIVRAVRQAASEMSGAGTSGQRSGNGHVSPAVVDTAAAPHVAVQS

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013052 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
104 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
105 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
147 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
153 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
154 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
161 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
168 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
177 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
178 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
179 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
180 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.83
Metatranscriptomes 5.86
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 1.95
Rhizosphere 94.79
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100469843 3300032002 Bacteria 1315
2 MRS1b_contig_5905697 2162886011 Bacteria 1318
3 JGI25407J50210_10017427 3300003373 Bacteria 1865
4 JGI25405J52794_10009539 3300003911 Bacteria 1834
5 Ga0058863_11942003 3300004799 Bacteria 1313
6 Ga0058862_12734917 3300004803 Bacteria 609
7 Ga0065712_10019545 3300005290 Bacteria 2123
8 Ga0065715_10004121 3300005293 Bacteria 5892
9 Ga0065707_10162154 3300005295 Bacteria 1554
10 Ga0065707_10192691 3300005295 Bacteria 1352
11 Ga0070658_10481103 3300005327 Bacteria 1072
12 Ga0070683_100186576 3300005329 Bacteria 1969
13 Ga0070683_100257052 3300005329 Bacteria 1661
14 Ga0070683_100802033 3300005329 Bacteria 903
15 Ga0070666_10025897 3300005335 Bacteria 3826
16 Ga0070680_100751577 3300005336 Bacteria 840
17 Ga0070682_100018929 3300005337 Bacteria 4033
18 Ga0070682_100230486 3300005337 Bacteria 1324
19 Ga0068868_100365652 3300005338 Bacteria 1238
20 Ga0068868_101275014 3300005338 Bacteria 682
21 Ga0070689_100286086 3300005340 Bacteria 1369
22 Ga0070689_100899988 3300005340 Bacteria 783
23 Ga0070661_100005244 3300005344 Bacteria 8924
24 Ga0070675_100156522 3300005354 Bacteria 1957
25 Ga0070673_100205079 3300005364 Bacteria 1700
26 Ga0070673_101148285 3300005364 Bacteria 727
27 Ga0070659_100001227 3300005366 Bacteria 18625
28 Ga0070659_100183958 3300005366 Bacteria 1715
29 Ga0070709_10567908 3300005434 Bacteria 870
30 Ga0070714_100000002 3300005435 Bacteria 386673
31 Ga0070714_100672046 3300005435 Bacteria 998
32 Ga0070713_100553367 3300005436 Bacteria 1089
33 Ga0070700_100679771 3300005441 Bacteria 816
34 Ga0070694_100399920 3300005444 Bacteria 1075
35 Ga0070663_101347596 3300005455 Bacteria 631
36 Ga0070706_100007971 3300005467 Bacteria 9884
37 Ga0070679_100175002 3300005530 Bacteria 2119
38 Ga0070679_100573850 3300005530 Bacteria 1072
39 Ga0070684_100054232 3300005535 Bacteria 3492
40 Ga0070684_100467348 3300005535 Bacteria 1167
41 Ga0068853_102136264 3300005539 Bacteria 543
42 Ga0070695_100091958 3300005545 Bacteria 2027
43 Ga0070695_100206652 3300005545 Bacteria 1407
44 Ga0070693_100295548 3300005547 Bacteria 1090
45 Ga0068854_100358846 3300005578 Bacteria 1195
46 Ga0068856_100035179 3300005614 Bacteria 4908
47 Ga0068856_100266836 3300005614 Bacteria 1728
48 Ga0068856_101316446 3300005614 Bacteria 738
49 Ga0068851_10777625 3300005834 Bacteria 594
50 Ga0081455_10061098 3300005937 Bacteria 3172
51 Ga0081455_10601946 3300005937 Bacteria 716
52 Ga0081538_10011994 3300005981 Bacteria 6981
53 Ga0075428_100004711 3300006844 Bacteria 15095
54 Ga0075428_100013959 3300006844 Bacteria 8943
55 Ga0075428_100215418 3300006844 Bacteria 2075
56 Ga0075430_100038214 3300006846 Bacteria 4068
57 Ga0075431_100021505 3300006847 Bacteria 6598
58 Ga0075429_100018186 3300006880 Bacteria 6083
59 Ga0075429_100042149 3300006880 Bacteria 3973
60 Ga0105240_10031993 3300009093 Bacteria 6815
61 Ga0105240_10207449 3300009093 Bacteria 2292
62 Ga0111539_10002516 3300009094 Bacteria 24292
63 Ga0105245_10058128 3300009098 Bacteria 3480
64 Ga0114129_10102144 3300009147 Bacteria 3966
65 Ga0105242_10076355 3300009176 Bacteria 2793
66 Ga0105237_10384518 3300009545 Bacteria 1408
67 Ga0105238_10299296 3300009551 Bacteria 1592
68 Ga0105238_10351129 3300009551 Bacteria 1464
69 Ga0105239_10152384 3300010375 Bacteria 2580
70 Ga0105239_10367459 3300010375 Bacteria 1625
71 Ga0105239_11127543 3300010375 Bacteria 903
72 Ga0154014_145382 3300013052 Bacteria 618
73 Ga0157371_10742616 3300013102 Bacteria 737
74 Ga0157370_10294213 3300013104 Bacteria 1499
75 Ga0157370_11349417 3300013104 Bacteria 642
76 Ga0157369_10019440 3300013105 Bacteria 7599
77 Ga0157369_12334494 3300013105 Bacteria 542
78 Ga0157374_10030686 3300013296 Bacteria 4883
79 Ga0157372_10000205 3300013307 Bacteria 65769
80 Ga0157372_10229400 3300013307 Bacteria 2152
81 Ga0157380_10526644 3300014326 Bacteria 1154
82 Ga0157377_10093214 3300014745 Bacteria 1782
83 Ga0157376_10802330 3300014969 Bacteria 954
84 Ga0197907_10415910 3300020069 Bacteria 4652
85 Ga0206356_10081714 3300020070 Bacteria 658
86 Ga0206349_1404376 3300020075 Bacteria 2117
87 Ga0206351_10918954 3300020077 Bacteria 1147
88 Ga0206352_10679076 3300020078 Bacteria 4252
89 Ga0206350_10416963 3300020080 Bacteria 3034
90 Ga0206354_11211807 3300020081 Bacteria 1784
91 Ga0206353_10010607 3300020082 Bacteria 5269
92 Ga0206353_10350920 3300020082 Bacteria 1167
93 Ga0154015_1294248 3300020610 Bacteria 977
94 Ga0224712_10049095 3300022467 Bacteria 1633
95 Ga0224712_10138209 3300022467 Bacteria 1070
96 Ga0224712_10350835 3300022467 Bacteria 697
97 Ga0207426_1068448 3300025302 Bacteria 998
98 Ga0207656_10542860 3300025321 Bacteria 592
99 Ga0207653_10000097 3300025885 Bacteria 63261
100 Ga0207692_10715811 3300025898 Bacteria 650
101 Ga0207647_10049286 3300025904 Bacteria 2613
102 Ga0207685_10066440 3300025905 Bacteria 1447
103 Ga0207699_11010948 3300025906 Bacteria 615
104 Ga0207705_10607820 3300025909 Bacteria 850
105 Ga0207705_10741529 3300025909 Bacteria 763
106 Ga0207695_10049882 3300025913 Bacteria 4406
107 Ga0207695_10200055 3300025913 Bacteria 1912
108 Ga0207671_10406449 3300025914 Bacteria 1083
109 Ga0207660_10643145 3300025917 Bacteria 864
110 Ga0207657_10062019 3300025919 Bacteria 3202
111 Ga0207649_10742528 3300025920 Bacteria 763
112 Ga0207694_10317159 3300025924 Bacteria 1286
113 Ga0207659_10359028 3300025926 Bacteria 1210
114 Ga0207687_10061401 3300025927 Bacteria 2654
115 Ga0207664_10000038 3300025929 Bacteria 166264
116 Ga0207664_10107280 3300025929 Bacteria 2317
117 Ga0207664_10592265 3300025929 Bacteria 996
118 Ga0207690_10431984 3300025932 Bacteria 1055
119 Ga0207690_10564648 3300025932 Bacteria 926
120 Ga0207706_10020643 3300025933 Bacteria 5920
121 Ga0207709_10033250 3300025935 Bacteria 3026
122 Ga0207689_10161667 3300025942 Bacteria 1845
123 Ga0207661_10514512 3300025944 Bacteria 1094
124 Ga0207661_10605070 3300025944 Bacteria 1006
125 Ga0207679_10155399 3300025945 Bacteria 1867
126 Ga0207651_10558649 3300025960 Bacteria 996
127 Ga0207640_10325148 3300025981 Bacteria 1226
128 Ga0207677_10429334 3300026023 Bacteria 1127
129 Ga0207639_11845463 3300026041 Bacteria 565
130 Ga0207708_10077453 3300026075 Bacteria 2552
131 Ga0207702_10025584 3300026078 Bacteria 4900
132 Ga0207683_10911256 3300026121 Bacteria 816
133 Ga0207698_10029636 3300026142 Bacteria 3923
134 Ga0207698_11058469 3300026142 Bacteria 823
135 Ga0207428_10007821 3300027907 Bacteria 9731
136 Ga0307515_10110110 3300028794 Bacteria 3227
137 Ga0265338_10084742 3300028800 Bacteria 2644
138 Ga0307511_10004169 3300030521 Bacteria 14748
139 Ga0307512_10025725 3300030522 Bacteria 5208
140 Ga0265332_10232824 3300031238 Bacteria 763
141 Ga0307408_100022321 3300031548 Unclassified 4299
142 Ga0307408_100113536 3300031548 Bacteria 2085
143 Ga0307408_100290540 3300031548 Bacteria 1365
144 Ga0307408_100336987 3300031548 Bacteria 1275
145 Ga0265314_10219259 3300031711 Bacteria 1111
146 Ga0307405_10090524 3300031731 Bacteria 2024
147 Ga0307405_10101000 3300031731 Bacteria 1934
148 Ga0307405_10114935 3300031731 Bacteria 1830
149 Ga0307405_10260030 3300031731 Bacteria 1296
150 Ga0307413_10000297 3300031824 Bacteria 15353
151 Ga0307413_10101884 3300031824 Bacteria 1899
152 Ga0307413_11278856 3300031824 Bacteria 641
153 Ga0307518_10000734 3300031838 Bacteria 24656
154 Ga0307410_10007015 3300031852 Bacteria 6132
155 Ga0307410_10009557 3300031852 Bacteria 5446
156 Ga0307410_10063056 3300031852 Bacteria 2541
157 Ga0307410_10069613 3300031852 Bacteria 2434
158 Ga0307410_10130521 3300031852 Bacteria 1845
159 Ga0326468_10025781 3300031889 Bacteria 741
160 Ga0307406_10079297 3300031901 Bacteria 2177
161 Ga0307406_10109807 3300031901 Bacteria 1896
162 Ga0307406_10316978 3300031901 Bacteria 1204
163 Ga0307407_10007592 3300031903 Unclassified 4920
164 Ga0307407_10157084 3300031903 Bacteria 1484
165 Ga0307407_10163549 3300031903 Bacteria 1459
166 Ga0307412_10087345 3300031911 Bacteria 2172
167 Ga0307412_10223667 3300031911 Bacteria 1444
168 Ga0307412_10608711 3300031911 Bacteria 926
169 Ga0307409_100006439 3300031995 Bacteria 6900
170 Ga0307409_100137960 3300031995 Bacteria 2096
171 Ga0307409_100248870 3300031995 Bacteria 1623
172 Ga0307409_100308987 3300031995 Bacteria 1474
173 Ga0307416_100015935 3300032002 Bacteria 5208
174 Ga0307416_100020068 3300032002 Bacteria 4758
175 Ga0307416_100050578 3300032002 Bacteria 3313
176 Ga0307416_100251790 3300032002 Bacteria 1719
177 Ga0307416_100363560 3300032002 Bacteria 1470
178 Ga0307416_100381036 3300032002 Bacteria 1440
179 Ga0307416_100381621 3300032002 Bacteria 1439
180 Ga0307416_100696908 3300032002 Bacteria 1104
181 Ga0307416_101474122 3300032002 Bacteria 786
182 Ga0307414_10084633 3300032004 Bacteria 2333
183 Ga0307414_10133128 3300032004 Bacteria 1933
184 Ga0307414_10275957 3300032004 Bacteria 1410
185 Ga0307414_10322895 3300032004 Bacteria 1315
186 Ga0307414_10525073 3300032004 Bacteria 1051
187 Ga0307411_10000582 3300032005 Bacteria 13043
188 Ga0307411_10033761 3300032005 Bacteria 3176
189 Ga0307411_10072532 3300032005 Bacteria 2338
190 Ga0307411_10105915 3300032005 Bacteria 2000
191 Ga0307415_100052159 3300032126 Unclassified 2779
192 Ga0307415_100067676 3300032126 Bacteria 2497
193 Ga0307415_100190879 3300032126 Bacteria 1616
194 Ga0307415_100229181 3300032126 Bacteria 1495
195 Ga0307415_100258390 3300032126 Bacteria 1419
196 Ga0307415_100907843 3300032126 Bacteria 812
197 Ga0316596_1004130 3300033541 Bacteria 3228
198 Ga0373936_0253860 3300035113 Bacteria 786
199 Ga0373927_0457923 3300035695 Bacteria 843
200 Ga0373925_0028706 3300037068 Bacteria 4077
201 Ga0373925_0696287 3300037068 Bacteria 838
202 Ga0395899_0011593 3300037312 Bacteria 6749
203 Ga0395899_0150171 3300037312 Bacteria 1652
204 Ga0395900_0002858 3300037418 Bacteria 18829
205 Ga0395900_0506344 3300037418 Bacteria 1157
206 Ga0395898_0021071 3300037466 Bacteria 6613
207 Ga0395898_0052929 3300037466 Bacteria 3965
208 Ga0395905_1259281 3300037471 Bacteria 643
209 Ga0395901_0002965 3300038443 Bacteria 17120
210 Ga0395901_0004169 3300038443 Bacteria 14591
211 Ga0395901_0562607 3300038443 Bacteria 1154
212 Ga0436361_0975701 3300039447 Bacteria 814
213 Ga0466972_0450252 3300044658 Bacteria 605
214 Ga0466965_0076125 3300044683 Bacteria 1693
215 Ga0466965_0215585 3300044683 Bacteria 1022
216 Ga0466965_0219270 3300044683 Bacteria 1013
217 Ga0466966_0088174 3300044684 Bacteria 1928
218 Ga0466966_0193039 3300044684 Bacteria 1233
219 Ga0466966_0467238 3300044684 Bacteria 758
220 Ga0466961_0029542 3300044693 Bacteria 3522
221 Ga0466961_0071091 3300044693 Bacteria 2209
222 Ga0466961_0191637 3300044693 Bacteria 1267
223 Ga0466961_0296812 3300044693 Bacteria 987
224 Ga0466961_0396801 3300044693 Bacteria 837
225 Ga0466961_0577693 3300044693 Bacteria 676
226 Ga0466963_0042641 3300044694 Bacteria 2980
227 Ga0466963_0116413 3300044694 Bacteria 1837
228 Ga0466963_0164621 3300044694 Bacteria 1544
229 Ga0466963_0259346 3300044694 Bacteria 1220
230 Ga0466963_0351005 3300044694 Bacteria 1039
231 Ga0466964_0204435 3300044706 Bacteria 950
232 Ga0466971_0041256 3300044719 Bacteria 2073
233 Ga0466971_0069086 3300044719 Bacteria 1603
234 Ga0466971_0164136 3300044719 Bacteria 1040
235 Ga0466971_0324240 3300044719 Bacteria 742
236 Ga0466971_0473392 3300044719 Bacteria 616
237 Ga0466970_0031468 3300044765 Bacteria 2802
238 Ga0466970_0316810 3300044765 Bacteria 881
239 Ga0466970_0439012 3300044765 Bacteria 747
240 Ga0466970_0718664 3300044765 Bacteria 583
241 Ga0466957_0008146 3300044842 Bacteria 5950
242 Ga0466957_0014584 3300044842 Bacteria 4578
243 Ga0466957_0239062 3300044842 Bacteria 1204
244 Ga0466957_0268214 3300044842 Bacteria 1139
245 Ga0466957_0366199 3300044842 Bacteria 980
246 Ga0466960_0035895 3300044901 Bacteria 2319
247 Ga0466960_0110896 3300044901 Bacteria 1425
248 Ga0466960_0376416 3300044901 Bacteria 814
249 Ga0466960_0425334 3300044901 Bacteria 768
250 Ga0466959_0031242 3300045049 Bacteria 3941
251 Ga0466959_0041845 3300045049 Bacteria 3381
252 Ga0466959_0183169 3300045049 Bacteria 1464
253 Ga0466959_0250206 3300045049 Bacteria 1222
254 Ga0466958_0005720 3300045836 Bacteria 6716
255 Ga0466958_0031280 3300045836 Bacteria 3163
256 Ga0466958_0078679 3300045836 Bacteria 2027
257 Ga0466958_0084153 3300045836 Bacteria 1961
258 Ga0466958_0118585 3300045836 Bacteria 1655
259 Ga0466967_0005270 3300045976 Bacteria 8919
260 Ga0466967_0010758 3300045976 Bacteria 6880
261 Ga0466967_0071279 3300045976 Bacteria 3111
262 Ga0466967_0268341 3300045976 Bacteria 1635
263 Ga0466967_0288617 3300045976 Bacteria 1576
264 Ga0466967_0437871 3300045976 Bacteria 1276
265 Ga0466967_0694866 3300045976 Bacteria 1007
266 Ga0495596_0124088 3300046500 Bacteria 1002
267 Ga0495616_0165494 3300046513 Bacteria 992
268 Ga0495620_0205677 3300046515 Bacteria 756
269 Ga0495598_0126421 3300046537 Bacteria 872
270 Ga0495656_0068585 3300046615 Bacteria 1568
271 Ga0495668_0342050 3300046616 Bacteria 821
272 Ga0495659_0301056 3300046664 Bacteria 678
273 Ga0495661_0359197 3300046665 Bacteria 716
274 Ga0495670_0276263 3300046691 Bacteria 898
275 Ga0495677_0162267 3300047445 Bacteria 863
276 Ga0495677_0266700 3300047445 Bacteria 671
277 Ga0495614_0503327 3300048089 Bacteria 577
278 Ga0495615_0140693 3300048090 Bacteria 712
279 Ga0496110_0712241 3300048913 Bacteria 906
280 Ga0496111_0132813 3300048914 Bacteria 1843
281 Ga0496112_0261177 3300048915 Bacteria 1681
282 Ga0496113_0004842 3300048916 Bacteria 8333
283 Ga0496113_0642298 3300048916 Bacteria 849
284 Ga0496114_0689129 3300048917 Bacteria 897
285 Ga0501299_077316 3300049522 Bacteria 733
286 Ga0501311_066938 3300049527 Bacteria 590
287 Ga0501031_0702417 3300049568 Bacteria 649
288 Ga0501036_0221700 3300049572 Bacteria 1588
289 Ga0501039_0483324 3300049575 Bacteria 973
290 Ga0501047_0392442 3300049581 Bacteria 1221
291 Ga0501068_0002107 3300049584 Bacteria 10609
292 Ga0501216_094666 3300049660 Bacteria 650
293 Ga0501225_0322847 3300049705 Bacteria 528
294 Ga0501035_1081731 3300049822 Bacteria 627
295 nmdc:mga05p37_148027_c1 3300050507 Bacteria 2874
296 nmdc:mga09592_3538_c1 3300050508 Bacteria 12612
297 nmdc:mga06r32_55234_c1 3300050510 Bacteria 3809
298 nmdc:mga08y16_38757_c1 3300050511 Bacteria 5002
299 Ga0495619_0220427 3300053085 Bacteria 1314
300 Ga0500593_048168 3300053117 Bacteria 1895
301 Ga0466962_0012320 3300061719 Bacteria 4111
302 Ga0466962_0088108 3300061719 Bacteria 1486
303 Ga0466962_0229373 3300061719 Bacteria 910
304 2586059221 2585427649 Bacteria 9053857
305 2809592024 2808606522 Bacteria 9488490
306 2855390852 2855386786 Bacteria 4752232
307 2866613903 2866612099 Bacteria 7543886
308 Ga0307416_100469843
309 MRS1b_contig_5905697
310 JGI25407J50210_10017427
311 JGI25405J52794_10009539
312 Ga0058863_11942003
313 Ga0058862_12734917
314 Ga0065712_10019545
315 Ga0065715_10004121
316 Ga0065707_10162154
317 Ga0065707_10192691
318 Ga0070658_10481103
319 Ga0070683_100186576
320 Ga0070683_100257052
321 Ga0070683_100802033
322 Ga0070666_10025897
323 Ga0070680_100751577
324 Ga0070682_100018929
325 Ga0070682_100230486
326 Ga0068868_100365652
327 Ga0068868_101275014
328 Ga0070689_100286086
329 Ga0070689_100899988
330 Ga0070661_100005244
331 Ga0070675_100156522
332 Ga0070673_100205079
333 Ga0070673_101148285
334 Ga0070659_100001227
335 Ga0070659_100183958
336 Ga0070709_10567908
337 Ga0070714_100000002
338 Ga0070714_100672046
339 Ga0070713_100553367
340 Ga0070700_100679771
341 Ga0070694_100399920
342 Ga0070663_101347596
343 Ga0070706_100007971
344 Ga0070679_100175002
345 Ga0070679_100573850
346 Ga0070684_100054232
347 Ga0070684_100467348
348 Ga0068853_102136264
349 Ga0070695_100091958
350 Ga0070695_100206652
351 Ga0070693_100295548
352 Ga0068854_100358846
353 Ga0068856_100035179
354 Ga0068856_100266836
355 Ga0068856_101316446
356 Ga0068851_10777625
357 Ga0081455_10061098
358 Ga0081455_10601946
359 Ga0081538_10011994
360 Ga0075428_100004711
361 Ga0075428_100013959
362 Ga0075428_100215418
363 Ga0075430_100038214
364 Ga0075431_100021505
365 Ga0075429_100018186
366 Ga0075429_100042149
367 Ga0105240_10031993
368 Ga0105240_10207449
369 Ga0111539_10002516
370 Ga0105245_10058128
371 Ga0114129_10102144
372 Ga0105242_10076355
373 Ga0105237_10384518
374 Ga0105238_10299296
375 Ga0105238_10351129
376 Ga0105239_10152384
377 Ga0105239_10367459
378 Ga0105239_11127543
379 Ga0154014_145382
380 Ga0157371_10742616
381 Ga0157370_10294213
382 Ga0157370_11349417
383 Ga0157369_10019440
384 Ga0157369_12334494
385 Ga0157374_10030686
386 Ga0157372_10000205
387 Ga0157372_10229400
388 Ga0157380_10526644
389 Ga0157377_10093214
390 Ga0157376_10802330
391 Ga0197907_10415910
392 Ga0206356_10081714
393 Ga0206349_1404376
394 Ga0206351_10918954
395 Ga0206352_10679076
396 Ga0206350_10416963
397 Ga0206354_11211807
398 Ga0206353_10010607
399 Ga0206353_10350920
400 Ga0154015_1294248
401 Ga0224712_10049095
402 Ga0224712_10138209
403 Ga0224712_10350835
404 Ga0207426_1068448
405 Ga0207656_10542860
406 Ga0207653_10000097
407 Ga0207692_10715811
408 Ga0207647_10049286
409 Ga0207685_10066440
410 Ga0207699_11010948
411 Ga0207705_10607820
412 Ga0207705_10741529
413 Ga0207695_10049882
414 Ga0207695_10200055
415 Ga0207671_10406449
416 Ga0207660_10643145
417 Ga0207657_10062019
418 Ga0207649_10742528
419 Ga0207694_10317159
420 Ga0207659_10359028
421 Ga0207687_10061401
422 Ga0207664_10000038
423 Ga0207664_10107280
424 Ga0207664_10592265
425 Ga0207690_10431984
426 Ga0207690_10564648
427 Ga0207706_10020643
428 Ga0207709_10033250
429 Ga0207689_10161667
430 Ga0207661_10514512
431 Ga0207661_10605070
432 Ga0207679_10155399
433 Ga0207651_10558649
434 Ga0207640_10325148
435 Ga0207677_10429334
436 Ga0207639_11845463
437 Ga0207708_10077453
438 Ga0207702_10025584
439 Ga0207683_10911256
440 Ga0207698_10029636
441 Ga0207698_11058469
442 Ga0207428_10007821
443 Ga0307515_10110110
444 Ga0265338_10084742
445 Ga0307511_10004169
446 Ga0307512_10025725
447 Ga0265332_10232824
448 Ga0307408_100022321
449 Ga0307408_100113536
450 Ga0307408_100290540
451 Ga0307408_100336987
452 Ga0265314_10219259
453 Ga0307405_10090524
454 Ga0307405_10101000
455 Ga0307405_10114935
456 Ga0307405_10260030
457 Ga0307413_10000297
458 Ga0307413_10101884
459 Ga0307413_11278856
460 Ga0307518_10000734
461 Ga0307410_10007015
462 Ga0307410_10009557
463 Ga0307410_10063056
464 Ga0307410_10069613
465 Ga0307410_10130521
466 Ga0326468_10025781
467 Ga0307406_10079297
468 Ga0307406_10109807
469 Ga0307406_10316978
470 Ga0307407_10007592
471 Ga0307407_10157084
472 Ga0307407_10163549
473 Ga0307412_10087345
474 Ga0307412_10223667
475 Ga0307412_10608711
476 Ga0307409_100006439
477 Ga0307409_100137960
478 Ga0307409_100248870
479 Ga0307409_100308987
480 Ga0307416_100015935
481 Ga0307416_100020068
482 Ga0307416_100050578
483 Ga0307416_100251790
484 Ga0307416_100363560
485 Ga0307416_100381036
486 Ga0307416_100381621
487 Ga0307416_100696908
488 Ga0307416_101474122
489 Ga0307414_10084633
490 Ga0307414_10133128
491 Ga0307414_10275957
492 Ga0307414_10322895
493 Ga0307414_10525073
494 Ga0307411_10000582
495 Ga0307411_10033761
496 Ga0307411_10072532
497 Ga0307411_10105915
498 Ga0307415_100052159
499 Ga0307415_100067676
500 Ga0307415_100190879
501 Ga0307415_100229181
502 Ga0307415_100258390
503 Ga0307415_100907843
504 Ga0316596_1004130
505 Ga0373936_0253860
506 Ga0373927_0457923
507 Ga0373925_0028706
508 Ga0373925_0696287
509 Ga0395899_0011593
510 Ga0395899_0150171
511 Ga0395900_0002858
512 Ga0395900_0506344
513 Ga0395898_0021071
514 Ga0395898_0052929
515 Ga0395905_1259281
516 Ga0395901_0002965
517 Ga0395901_0004169
518 Ga0395901_0562607
519 Ga0436361_0975701
520 Ga0466972_0450252
521 Ga0466965_0076125
522 Ga0466965_0215585
523 Ga0466965_0219270
524 Ga0466966_0088174
525 Ga0466966_0193039
526 Ga0466966_0467238
527 Ga0466961_0029542
528 Ga0466961_0071091
529 Ga0466961_0191637
530 Ga0466961_0296812
531 Ga0466961_0396801
532 Ga0466961_0577693
533 Ga0466963_0042641
534 Ga0466963_0116413
535 Ga0466963_0164621
536 Ga0466963_0259346
537 Ga0466963_0351005
538 Ga0466964_0204435
539 Ga0466971_0041256
540 Ga0466971_0069086
541 Ga0466971_0164136
542 Ga0466971_0324240
543 Ga0466971_0473392
544 Ga0466970_0031468
545 Ga0466970_0316810
546 Ga0466970_0439012
547 Ga0466970_0718664
548 Ga0466957_0008146
549 Ga0466957_0014584
550 Ga0466957_0239062
551 Ga0466957_0268214
552 Ga0466957_0366199
553 Ga0466960_0035895
554 Ga0466960_0110896
555 Ga0466960_0376416
556 Ga0466960_0425334
557 Ga0466959_0031242
558 Ga0466959_0041845
559 Ga0466959_0183169
560 Ga0466959_0250206
561 Ga0466958_0005720
562 Ga0466958_0031280
563 Ga0466958_0078679
564 Ga0466958_0084153
565 Ga0466958_0118585
566 Ga0466967_0005270
567 Ga0466967_0010758
568 Ga0466967_0071279
569 Ga0466967_0268341
570 Ga0466967_0288617
571 Ga0466967_0437871
572 Ga0466967_0694866
573 Ga0495596_0124088
574 Ga0495616_0165494
575 Ga0495620_0205677
576 Ga0495598_0126421
577 Ga0495656_0068585
578 Ga0495668_0342050
579 Ga0495659_0301056
580 Ga0495661_0359197
581 Ga0495670_0276263
582 Ga0495677_0162267
583 Ga0495677_0266700
584 Ga0495614_0503327
585 Ga0495615_0140693
586 Ga0496110_0712241
587 Ga0496111_0132813
588 Ga0496112_0261177
589 Ga0496113_0004842
590 Ga0496113_0642298
591 Ga0496114_0689129
592 Ga0501299_077316
593 Ga0501311_066938
594 Ga0501031_0702417
595 Ga0501036_0221700
596 Ga0501039_0483324
597 Ga0501047_0392442
598 Ga0501068_0002107
599 Ga0501216_094666
600 Ga0501225_0322847
601 Ga0501035_1081731
602 nmdc:mga05p37_148027_c1
603 nmdc:mga09592_3538_c1
604 nmdc:mga06r32_55234_c1
605 nmdc:mga08y16_38757_c1
606 Ga0495619_0220427
607 Ga0500593_048168
608 Ga0466962_0012320
609 Ga0466962_0088108
610 Ga0466962_0229373
611 2586059221
612 2809592024
613 2855390852
614 2866613903

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

74

148

0.96

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

6

83

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9859 1 151
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9842 2 151
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9807 1 153
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9788 1 154
1t3q-assembly1.cif.gz_D crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.9746 1 150
ID Description Score Start End Superfamily
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9928 1 75 3.10.20.30
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9886 77 152 1.10.150.120
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9879 1 75 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9862 1 75 3.10.20.30
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9826 77 151 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A523EJK4-F1-model_v4 (2Fe-2S)-binding protein 0.9967 1 149 GO:0016491
GO:0046872
GO:0051537
AF-W4MFL7-F1-model_v4 Carbon monoxide dehydrogenase 0.9958 1 152 GO:0016491
GO:0046872
GO:0051537
AF-A0A7V9D3B5-F1-model_v4 (2Fe-2S)-binding protein 0.9957 1 151 GO:0016491
GO:0046872
GO:0051537
AF-A0A521G6U6-F1-model_v4 (2Fe-2S)-binding protein 0.9955 1 150 GO:0016491
GO:0046872
GO:0051537
AF-A0A1S2PX67-F1-model_v4 Carbon monoxide dehydrogenase 0.9955 1 150 GO:0016491
GO:0046872
GO:0051537

Map