F397120

General Info

Members Datasets Scaffolds Average Seq Length
303 178 302 345

Family's Representative Sequence

Representative Sequence 3300034816|Ga0373930_0000108|Ga0373930_0000108_7382_8620
Length 412
Sequence MVVQVKKRRLEFKPHKMVFANRNAISDGAMPVSVSNYFGGGFCEALDLAVLLGNMAGQNSPPMPRTVTLFTGQWADLPLAQLLPLVKKMGYDGVELACWGDHFEVDRALAEPDYCKKKCALLAKHGLQCFAISSHLVGQAICDLIDERHQAILPADVWGDGKPEGVRQRAAEKMKLTAKAARKFFDAKPAELKIQNSKFKTAATVNGFTGSSIWHALYAFPPTSQEFLNKGYADFAKRWLPILDVFEKENVNFALEVHPTEIAFDIASAKRALEAVKNHPRFGFNYDPSHLGYQGVDYVKFIREFPDRIFHAHMKDVWWGHGDGTVGVFGGHTDFTDPRRFWDFRSLGHGDINFEDIIVALNDVGYRGPLSVEWEDGRMDRVHGATESCAFVRKLDFAPNQAAFDAAFSKKK

Samples

Sample ID Description Type Environment
1 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
89 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
90 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
91 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
92 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
95 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
96 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
97 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
120 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
121 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
122 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
136 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
137 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
138 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
139 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
142 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
168 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
169 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
178 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 0.99
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0
Rhizoplane 0.99
Rhizosphere 91.75
Stem 0
Stem Tuber 0
Unclassified 5.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000033 3300002704 Bacteria 105391
2 rootH2_10003802 3300003320 Bacteria 24313
3 rootH2_10077012 3300003320 Bacteria 8249
4 Ga0055540_1010086 3300003792 Bacteria 3178
5 Ga0070658_10002917 3300005327 Bacteria 14185
6 Ga0070658_10099059 3300005327 Bacteria 2408
7 Ga0070670_100336929 3300005331 Bacteria 1323
8 Ga0070661_100108192 3300005344 Bacteria 2074
9 Ga0070668_100065442 3300005347 Bacteria 2820
10 Ga0070671_100015019 3300005355 Bacteria 6254
11 Ga0070667_100033071 3300005367 Bacteria 4318
12 Ga0070709_10020039 3300005434 Bacteria 3876
13 Ga0070714_100011194 3300005435 Bacteria 7112
14 Ga0070714_100316646 3300005435 Bacteria 1458
15 Ga0070713_100020588 3300005436 Bacteria 5060
16 Ga0070711_100010030 3300005439 Bacteria 5847
17 Ga0070708_100048998 3300005445 Bacteria 3737
18 Ga0070708_100118166 3300005445 Bacteria 2442
19 Ga0070681_10017121 3300005458 Bacteria 7246
20 Ga0068867_100000167 3300005459 Bacteria 42774
21 Ga0070706_100077200 3300005467 Bacteria 3083
22 Ga0070706_100189608 3300005467 Bacteria 1921
23 Ga0070707_100138840 3300005468 Bacteria 2365
24 Ga0070698_100095676 3300005471 Bacteria 2947
25 Ga0070698_100137743 3300005471 Bacteria 2394
26 Ga0070698_100145617 3300005471 Bacteria 2318
27 Ga0070699_100030821 3300005518 Bacteria 4630
28 Ga0070697_100077096 3300005536 Bacteria 2741
29 Ga0070697_100173373 3300005536 Bacteria 1826
30 Ga0068853_100139949 3300005539 Unclassified 2172
31 Ga0070696_100000035 3300005546 Bacteria 63075
32 Ga0070665_100000082 3300005548 Bacteria 184202
33 Ga0068855_100015074 3300005563 Bacteria 9308
34 Ga0068855_100103914 3300005563 Bacteria 3268
35 Ga0068855_100148119 3300005563 Bacteria 2671
36 Ga0068855_100266960 3300005563 Bacteria 1904
37 Ga0068855_100369197 3300005563 Bacteria 1578
38 Ga0070664_100000132 3300005564 Bacteria 49808
39 Ga0070664_100139147 3300005564 Bacteria 2137
40 Ga0068856_100001056 3300005614 Bacteria 29195
41 Ga0068856_100010439 3300005614 Bacteria 9014
42 Ga0068856_100262787 3300005614 Bacteria 1742
43 Ga0068856_100423581 3300005614 Bacteria 1351
44 Ga0068863_100003955 3300005841 Bacteria 14646
45 Ga0068858_100004237 3300005842 Bacteria 14116
46 Ga0068860_100184910 3300005843 Bacteria 2015
47 Ga0081455_10147475 3300005937 Bacteria 1818
48 Ga0081538_10101243 3300005981 Unclassified 1450
49 Ga0081540_1034541 3300005983 Bacteria 2725
50 Ga0081539_10105850 3300005985 Bacteria 1425
51 Ga0070717_10000148 3300006028 Bacteria 52362
52 Ga0070717_10042236 3300006028 Bacteria 3719
53 Ga0070717_10149965 3300006028 Bacteria 2017
54 Ga0075366_10023698 3300006195 Bacteria 3576
55 Ga0075430_100018746 3300006846 Bacteria 5889
56 Ga0075431_100345891 3300006847 Bacteria 1496
57 Ga0068865_100191472 3300006881 Bacteria 1582
58 Ga0105240_10006545 3300009093 Bacteria 17107
59 Ga0105240_10017702 3300009093 Bacteria 9594
60 Ga0105240_10051245 3300009093 Bacteria 5197
61 Ga0105240_10060576 3300009093 Bacteria 4719
62 Ga0105240_10349190 3300009093 Bacteria 1679
63 Ga0105245_10154301 3300009098 Bacteria 2174
64 Ga0105243_10000014 3300009148 Bacteria 264650
65 Ga0105237_10290791 3300009545 Unclassified 1637
66 Ga0105238_10006997 3300009551 Bacteria 11278
67 Ga0105238_10038125 3300009551 Bacteria 4882
68 Ga0105238_10058676 3300009551 Unclassified 3857
69 Ga0157371_10138755 3300013102 Bacteria 1732
70 Ga0157370_10021364 3300013104 Bacteria 6449
71 Ga0157370_10074357 3300013104 Bacteria 3205
72 Ga0157370_10450707 3300013104 Bacteria 1183
73 Ga0157369_10241211 3300013105 Bacteria 1888
74 Ga0157374_10367040 3300013296 Bacteria 1432
75 Ga0163162_10103367 3300013306 Bacteria 2943
76 Ga0163162_10273878 3300013306 Bacteria 1820
77 Ga0157372_10076774 3300013307 Bacteria 3772
78 Ga0157372_10416672 3300013307 Bacteria 1565
79 Ga0206352_10850158 3300020078 Bacteria 4525
80 Ga0213872_10008865 3300021361 Bacteria 4845
81 Ga0213872_10014126 3300021361 Bacteria 3729
82 Ga0213872_10033525 3300021361 Bacteria 2353
83 Ga0213876_10002650 3300021384 Bacteria 10450
84 Ga0213876_10057946 3300021384 Bacteria 2045
85 Ga0213875_10060249 3300021388 Bacteria 1776
86 Ga0213871_10014521 3300021441 Unclassified 1870
87 Ga0209051_1001601 3300025303 Bacteria 18474
88 Ga0207680_10169402 3300025903 Bacteria 1470
89 Ga0207699_10050427 3300025906 Bacteria 2454
90 Ga0207645_10033373 3300025907 Bacteria 3309
91 Ga0207705_10001731 3300025909 Bacteria 17290
92 Ga0207684_10000678 3300025910 Bacteria 40382
93 Ga0207707_10017319 3300025912 Bacteria 6281
94 Ga0207695_10000104 3300025913 Bacteria 257201
95 Ga0207695_10009008 3300025913 Bacteria 12413
96 Ga0207695_10051358 3300025913 Bacteria 4330
97 Ga0207695_10054719 3300025913 Bacteria 4164
98 Ga0207695_10065866 3300025913 Bacteria 3723
99 Ga0207657_10109461 3300025919 Bacteria 2283
100 Ga0207646_10225633 3300025922 Bacteria 1692
101 Ga0207694_10004996 3300025924 Bacteria 10261
102 Ga0207694_10023281 3300025924 Bacteria 4702
103 Ga0207694_10034720 3300025924 Unclassified 3868
104 Ga0207659_10036013 3300025926 Bacteria 3425
105 Ga0207700_10085266 3300025928 Bacteria 2479
106 Ga0207700_10198675 3300025928 Bacteria 1689
107 Ga0207664_10040915 3300025929 Bacteria 3608
108 Ga0207644_10022630 3300025931 Bacteria 4295
109 Ga0207644_10150401 3300025931 Bacteria 1801
110 Ga0207706_10254682 3300025933 Bacteria 1533
111 Ga0207709_10000046 3300025935 Bacteria 240294
112 Ga0207691_10184176 3300025940 Bacteria 1823
113 Ga0207679_10002479 3300025945 Bacteria 11366
114 Ga0207679_10062854 3300025945 Bacteria 2769
115 Ga0207667_10032886 3300025949 Bacteria 5582
116 Ga0207667_10047585 3300025949 Bacteria 4539
117 Ga0207667_10050516 3300025949 Bacteria 4387
118 Ga0207667_10217928 3300025949 Bacteria 1956
119 Ga0207658_10031363 3300025986 Bacteria 3773
120 Ga0207703_10005231 3300026035 Bacteria 10477
121 Ga0207639_10157819 3300026041 Unclassified 1908
122 Ga0207702_10002180 3300026078 Bacteria 18766
123 Ga0207702_10004574 3300026078 Bacteria 12259
124 Ga0207702_10089835 3300026078 Bacteria 2687
125 Ga0207702_10140843 3300026078 Bacteria 2182
126 Ga0207641_10008030 3300026088 Bacteria 8747
127 Ga0207648_10000255 3300026089 Bacteria 57652
128 Ga0207676_10144366 3300026095 Bacteria 2042
129 Ga0207676_10434170 3300026095 Bacteria 1235
130 Ga0207674_10004518 3300026116 Bacteria 16708
131 Ga0207675_100467318 3300026118 Bacteria 1252
132 Ga0207683_10057724 3300026121 Bacteria 3407
133 Ga0268266_10000027 3300028379 Bacteria 426852
134 Ga0265337_1000547 3300028556 Bacteria 19990
135 Ga0265337_1005178 3300028556 Bacteria 5234
136 Ga0265319_1000027 3300028563 Bacteria 139786
137 Ga0265319_1004291 3300028563 Bacteria 7097
138 Ga0265319_1007337 3300028563 Bacteria 4970
139 Ga0265319_1007518 3300028563 Bacteria 4889
140 Ga0265319_1008143 3300028563 Bacteria 4624
141 Ga0265319_1008773 3300028563 Bacteria 4389
142 Ga0265319_1030844 3300028563 Bacteria 1870
143 Ga0265319_1035210 3300028563 Bacteria 1718
144 Ga0265334_10016362 3300028573 Bacteria 3070
145 Ga0265318_10027234 3300028577 Bacteria 2248
146 Ga0265336_10001288 3300028666 Bacteria 11789
147 Ga0265336_10011283 3300028666 Bacteria 3044
148 Ga0265338_10001642 3300028800 Bacteria 35774
149 Ga0265338_10019799 3300028800 Bacteria 7114
150 Ga0265338_10033704 3300028800 Bacteria 4963
151 Ga0265338_10052649 3300028800 Bacteria 3650
152 Ga0265324_10006853 3300029957 Bacteria 4695
153 Ga0265324_10012050 3300029957 Bacteria 3274
154 Ga0307511_10024399 3300030521 Bacteria 5605
155 Ga0314311_1079142 3300030733 Bacteria 3186
156 Ga0314311_1252934 3300030733 Bacteria 2562
157 Ga0316183_1186681 3300030742 Bacteria 1189
158 Ga0265320_10000397 3300031240 Bacteria 35194
159 Ga0265320_10000663 3300031240 Bacteria 26297
160 Ga0265320_10004383 3300031240 Bacteria 9260
161 Ga0265320_10005870 3300031240 Bacteria 7814
162 Ga0265320_10012648 3300031240 Bacteria 4899
163 Ga0265320_10014174 3300031240 Bacteria 4553
164 Ga0265340_10062957 3300031247 Bacteria 1771
165 Ga0265339_10025834 3300031249 Bacteria 3367
166 Ga0265331_10007836 3300031250 Bacteria 6126
167 Ga0265331_10079456 3300031250 Bacteria 1526
168 Ga0265327_10000571 3300031251 Bacteria 62622
169 Ga0265327_10010679 3300031251 Bacteria 6419
170 Ga0265327_10054686 3300031251 Bacteria 2065
171 Ga0265316_10000019 3300031344 Bacteria 194648
172 Ga0265316_10003701 3300031344 Bacteria 15390
173 Ga0307513_10001443 3300031456 Bacteria 34174
174 Ga0307408_100001687 3300031548 Bacteria 16233
175 Ga0307408_100137410 3300031548 Bacteria 1914
176 Ga0307408_100343203 3300031548 Bacteria 1265
177 Ga0265313_10004808 3300031595 Bacteria 10174
178 Ga0265313_10058669 3300031595 Bacteria 1813
179 Ga0265314_10017993 3300031711 Bacteria 5529
180 Ga0265314_10025720 3300031711 Bacteria 4434
181 Ga0265314_10031200 3300031711 Bacteria 3937
182 Ga0316576_10089906 3300031727 Unclassified 2287
183 Ga0307410_10182873 3300031852 Bacteria 1588
184 Ga0307406_10000400 3300031901 Bacteria 25105
185 Ga0307407_10015663 3300031903 Bacteria 3757
186 Ga0307409_100019874 3300031995 Bacteria 4561
187 Ga0307409_100091792 3300031995 Bacteria 2490
188 Ga0307416_100066079 3300032002 Bacteria 2976
189 Ga0307414_10000006 3300032004 Bacteria 451918
190 Ga0307414_10265510 3300032004 Bacteria 1434
191 Ga0307411_10013488 3300032005 Bacteria 4511
192 Ga0307411_10233186 3300032005 Bacteria 1436
193 Ga0316593_10024966 3300032168 Bacteria 1899
194 Ga0307510_10236669 3300033180 Bacteria 1324
195 Ga0316596_1030749 3300033541 Bacteria 1393
196 Ga0373930_0000108 3300034816 Bacteria 8707
197 Ga0373928_0001767 3300035084 Bacteria 4203
198 Ga0373944_0002400 3300035089 Bacteria 4767
199 Ga0373949_0002236 3300035090 Bacteria 5057
200 Ga0373932_0000002 3300035112 Bacteria 711821
201 Ga0373962_0000219 3300035242 Bacteria 12050
202 Ga0373931_0000015 3300035691 Bacteria 236539
203 Ga0373935_0054462 3300035692 Bacteria 2547
204 Ga0373935_0308064 3300035692 Bacteria 1121
205 Ga0373927_0034353 3300035695 Bacteria 3299
206 Ga0373925_0000306 3300037068 Bacteria 51383
207 Ga0400489_42060 3300039093 Bacteria 3899
208 Ga0436365_0260004 3300039437 Bacteria 8103
209 Ga0436365_0410564 3300039437 Bacteria 47832
210 Ga0436365_1218194 3300039437 Bacteria 1832
211 Ga0436360_0814848 3300039438 Unclassified 2573
212 Ga0436360_1240369 3300039438 Bacteria 2294
213 Ga0436361_0129286 3300039447 Bacteria 9757
214 Ga0436361_0141003 3300039447 Unclassified 2749
215 Ga0436361_0227132 3300039447 Bacteria 3009
216 Ga0436361_0350489 3300039447 Bacteria 2221
217 Ga0436361_0353794 3300039447 Bacteria 3861
218 Ga0436361_0725944 3300039447 Bacteria 2103
219 Ga0436361_0825876 3300039447 Bacteria 2487
220 Ga0436363_1646369 3300039450 Bacteria 7670
221 Ga0436362_0199621 3300039453 Bacteria 3162
222 Ga0436362_0257224 3300039453 Bacteria 1674
223 Ga0439436_0001194 3300041404 Bacteria 7383
224 Ga0439439_0007579 3300041406 Bacteria 2543
225 Ga0439465_0000368 3300041413 Bacteria 12909
226 Ga0439465_0001593 3300041413 Bacteria 7385
227 Ga0451791_1932437 3300041451 Bacteria 1651
228 Ga0451802_0137042 3300041460 Bacteria 1210
229 Ga0451807_2565025 3300041486 Bacteria 1353
230 Ga0439432_026979 3300042006 Bacteria 1879
231 Ga0439449_0001555 3300042007 Bacteria 8987
232 Ga0439449_0003705 3300042007 Bacteria 5930
233 Ga0451577_0000027 3300042876 Bacteria 397014
234 Ga0451577_0000131 3300042876 Bacteria 167486
235 Ga0451577_0000410 3300042876 Bacteria 77885
236 Ga0451577_0005634 3300042876 Bacteria 12727
237 Ga0451577_0010308 3300042876 Bacteria 8946
238 Ga0451577_0115934 3300042876 Bacteria 2399
239 Ga0451577_0169982 3300042876 Bacteria 1964
240 Ga0451577_0372866 3300042876 Bacteria 1295
241 Ga0453683_0001693 3300044673 Bacteria 18377
242 Ga0453683_0002925 3300044673 Bacteria 12881
243 Ga0453683_0115656 3300044673 Bacteria 1687
244 Ga0453683_0178278 3300044673 Bacteria 1347
245 Ga0453684_0000262 3300044712 Bacteria 226746
246 Ga0453684_0000529 3300044712 Bacteria 145936
247 Ga0453684_0001587 3300044712 Bacteria 62651
248 Ga0453684_0006989 3300044712 Bacteria 21118
249 Ga0453684_0055816 3300044712 Bacteria 5131
250 Ga0453684_0060363 3300044712 Bacteria 4878
251 Ga0453684_0073001 3300044712 Bacteria 4328
252 Ga0453684_0087256 3300044712 Bacteria 3867
253 Ga0453684_0533095 3300044712 Bacteria 1295
254 Ga0453684_1008789 3300044712 Bacteria 885
255 Ga0451576_0002347 3300045051 Bacteria 28544
256 Ga0451576_0006306 3300045051 Bacteria 14592
257 Ga0451576_0018383 3300045051 Bacteria 7664
258 Ga0451576_0034861 3300045051 Bacteria 5343
259 Ga0451576_0050582 3300045051 Bacteria 4358
260 Ga0451576_0059663 3300045051 Bacteria 3982
261 Ga0451576_0274375 3300045051 Bacteria 1763
262 Ga0451576_0485822 3300045051 Bacteria 1297
263 Ga0495580_0185104 3300046472 Bacteria 1438
264 Ga0495630_0090365 3300046517 Bacteria 2314
265 Ga0495643_0145318 3300046522 Bacteria 1179
266 Ga0495667_0017058 3300046559 Bacteria 4904
267 Ga0495613_0026823 3300046689 Bacteria 4290
268 Ga0495613_0296392 3300046689 Bacteria 1120
269 Ga0495624_0013815 3300046690 Bacteria 5498
270 Ga0495671_0004974 3300046692 Bacteria 7828
271 Ga0495674_0035690 3300047319 Bacteria 4483
272 Ga0495675_0188797 3300047444 Bacteria 1259
273 Ga0495684_0001536 3300047471 Bacteria 18500
274 Ga0495684_0027618 3300047471 Bacteria 4357
275 Ga0496121_0074197 3300048924 Bacteria 2723
276 Ga0496126_0090150 3300048929 Bacteria 2698
277 Ga0501032_0068725 3300049569 Bacteria 2364
278 Ga0501033_0002094 3300049570 Bacteria 17297
279 Ga0501033_0031311 3300049570 Bacteria 3998
280 Ga0501034_0001795 3300049571 Bacteria 27413
281 Ga0501034_0002696 3300049571 Bacteria 20903
282 Ga0501034_0050381 3300049571 Bacteria 4200
283 Ga0501036_0181934 3300049572 Bacteria 1769
284 Ga0501037_0001057 3300049573 Bacteria 20384
285 Ga0501038_0001000 3300049574 Bacteria 25442
286 Ga0501047_0232629 3300049581 Bacteria 1696
287 Ga0501073_0229584 3300049589 Bacteria 1282
288 Ga0501223_010843 3300049663 Bacteria 1830
289 Ga0501227_004204 3300049665 Bacteria 3096
290 Ga0501225_0007760 3300049705 Bacteria 3100
291 Ga0501080_0252991 3300049742 Bacteria 1606
292 Ga0501083_0000828 3300049744 Bacteria 20285
293 Ga0501035_0011240 3300049822 Bacteria 8293
294 Ga0501035_0016007 3300049822 Bacteria 6920
295 Ga0501044_0002137 3300049823 Bacteria 22644
296 Ga0501044_0005925 3300049823 Bacteria 13543
297 Ga0501044_0023793 3300049823 Bacteria 6513
298 nmdc:mga0yw44_94363_c1 3300050492 Bacteria 1896
299 nmdc:mga09592_380741_c1 3300050508 Bacteria 1220
300 nmdc:mga0qj67_89317_c1 3300050509 Bacteria 2475
301 Ga0500559_0006142 3300053136 Bacteria 5437
302 Ga0500627_0059418 3300053158 Bacteria 1680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_1008789 Ga0453684_1008789_25_852 275
2 3300045051 Ga0451576_0485822 Ga0451576_0485822_25_939 293
3 3300005985 Ga0081539_10105850 Ga0081539_101058502 303
4 3300045051 Ga0451576_0018383 Ga0451576_0018383_4204_5130 308
5 3300041486 Ga0451807_2565025 Ga0451807_2565025_16_990 311
6 3300005459 Ga0068867_100000167 Ga0068867_10000016740 322
7 3300005564 Ga0070664_100000132 Ga0070664_10000013230 322
8 3300006881 Ga0068865_100191472 Ga0068865_1001914722 322
9 3300009148 Ga0105243_10000014 Ga0105243_1000001488 322
10 3300025935 Ga0207709_10000046 Ga0207709_10000046169 322
11 3300025945 Ga0207679_10002479 Ga0207679_100024797 322
12 3300026089 Ga0207648_10000255 Ga0207648_1000025535 322
13 3300039453 Ga0436362_0257224 Ga0436362_0257224_196_1233 323
14 3300009093 Ga0105240_10349190 Ga0105240_103491902 324
15 3300039447 Ga0436361_0825876 Ga0436361_0825876_872_1909 326
16 3300005445 Ga0070708_100048998 Ga0070708_1000489983 327
17 3300005467 Ga0070706_100077200 Ga0070706_1000772002 327
18 3300005468 Ga0070707_100138840 Ga0070707_1001388403 327
19 iso_pu_bacteria 2894414249 2894415668 328
20 3300005327 Ga0070658_10002917 Ga0070658_100029172 329
21 3300005327 Ga0070658_10099059 Ga0070658_100990591 329
22 3300005331 Ga0070670_100336929 Ga0070670_1003369291 329
23 3300005344 Ga0070661_100108192 Ga0070661_1001081922 329
24 3300005355 Ga0070671_100015019 Ga0070671_1000150192 329
25 3300005563 Ga0068855_100266960 Ga0068855_1002669602 329
26 3300005564 Ga0070664_100139147 Ga0070664_1001391472 329
27 3300005614 Ga0068856_100262787 Ga0068856_1002627871 329
28 3300006846 Ga0075430_100018746 Ga0075430_1000187466 329
29 3300006847 Ga0075431_100345891 Ga0075431_1003458912 329
30 3300009098 Ga0105245_10154301 Ga0105245_101543013 329
31 3300013102 Ga0157371_10138755 Ga0157371_101387552 329
32 3300013104 Ga0157370_10074357 Ga0157370_100743572 329
33 3300013105 Ga0157369_10241211 Ga0157369_102412112 329
34 3300013296 Ga0157374_10367040 Ga0157374_103670402 329
35 3300013307 Ga0157372_10076774 Ga0157372_100767743 329
36 3300013307 Ga0157372_10416672 Ga0157372_104166722 329
37 3300020078 Ga0206352_10850158 Ga0206352_108501584 329
38 3300025907 Ga0207645_10033373 Ga0207645_100333734 329
39 3300025909 Ga0207705_10001731 Ga0207705_100017311 329
40 3300025913 Ga0207695_10000104 Ga0207695_1000010482 329
41 3300025922 Ga0207646_10225633 Ga0207646_102256332 329
42 3300025926 Ga0207659_10036013 Ga0207659_100360132 329
43 3300025928 Ga0207700_10198675 Ga0207700_101986752 329
44 3300025931 Ga0207644_10022630 Ga0207644_100226302 329
45 3300025931 Ga0207644_10150401 Ga0207644_101504012 329
46 3300025933 Ga0207706_10254682 Ga0207706_102546822 329
47 3300025940 Ga0207691_10184176 Ga0207691_101841761 329
48 3300025945 Ga0207679_10062854 Ga0207679_100628542 329
49 3300025949 Ga0207667_10217928 Ga0207667_102179282 329
50 3300026095 Ga0207676_10144366 Ga0207676_101443662 329
51 3300026095 Ga0207676_10434170 Ga0207676_104341701 329
52 3300026116 Ga0207674_10004518 Ga0207674_100045182 329
53 3300026118 Ga0207675_100467318 Ga0207675_1004673181 329
54 3300026121 Ga0207683_10057724 Ga0207683_100577244 329
55 3300031595 Ga0265313_10058669 Ga0265313_100586692 329
56 3300031852 Ga0307410_10182873 Ga0307410_101828731 329
57 3300031995 Ga0307409_100091792 Ga0307409_1000917923 329
58 3300032005 Ga0307411_10013488 Ga0307411_100134882 329
59 3300032005 Ga0307411_10233186 Ga0307411_102331861 329
60 3300045051 Ga0451576_0059663 Ga0451576_0059663_189_1214 329
61 3300046472 Ga0495580_0185104 Ga0495580_0185104_97_1122 329
62 3300046517 Ga0495630_0090365 Ga0495630_0090365_58_1083 329
63 3300046559 Ga0495667_0017058 Ga0495667_0017058_2153_3178 329
64 3300046689 Ga0495613_0026823 Ga0495613_0026823_2559_3584 329
65 3300046689 Ga0495613_0296392 Ga0495613_0296392_37_1062 329
66 3300046690 Ga0495624_0013815 Ga0495624_0013815_3343_4368 329
67 3300047319 Ga0495674_0035690 Ga0495674_0035690_335_1360 329
68 3300047471 Ga0495684_0001536 Ga0495684_0001536_14885_15910 329
69 3300047471 Ga0495684_0027618 Ga0495684_0027618_3222_4247 329
70 3300049571 Ga0501034_0001795 Ga0501034_0001795_17655_18680 329
71 3300049581 Ga0501047_0232629 Ga0501047_0232629_369_1394 329
72 3300049742 Ga0501080_0252991 Ga0501080_0252991_108_1133 329
73 3300049823 Ga0501044_0005925 Ga0501044_0005925_7434_8459 329
74 3300050508 nmdc:mga09592_380741_c1 nmdc:mga09592_380741_c1_142_1167 329
75 3300050509 nmdc:mga0qj67_89317_c1 nmdc:mga0qj67_89317_c1_91_1116 329
76 3300013306 Ga0163162_10103367 Ga0163162_101033672 330
77 3300035692 Ga0373935_0308064 Ga0373935_0308064_52_1095 330
78 3300042876 Ga0451577_0000027 Ga0451577_0000027_200922_201914 330
79 3300042876 Ga0451577_0000410 Ga0451577_0000410_6817_7809 330
80 3300042876 Ga0451577_0005634 Ga0451577_0005634_8723_9715 330
81 3300042876 Ga0451577_0010308 Ga0451577_0010308_1600_2592 330
82 3300042876 Ga0451577_0115934 Ga0451577_0115934_904_1896 330
83 3300042876 Ga0451577_0372866 Ga0451577_0372866_234_1226 330
84 3300044673 Ga0453683_0001693 Ga0453683_0001693_13164_14156 330
85 3300044673 Ga0453683_0002925 Ga0453683_0002925_4991_5983 330
86 3300044673 Ga0453683_0115656 Ga0453683_0115656_473_1465 330
87 3300044673 Ga0453683_0178278 Ga0453683_0178278_83_1075 330
88 3300044712 Ga0453684_0000262 Ga0453684_0000262_9336_10328 330
89 3300044712 Ga0453684_0000529 Ga0453684_0000529_93397_94389 330
90 3300044712 Ga0453684_0001587 Ga0453684_0001587_1583_2575 330
91 3300044712 Ga0453684_0055816 Ga0453684_0055816_3790_4782 330
92 3300044712 Ga0453684_0087256 Ga0453684_0087256_2102_3094 330
93 3300044712 Ga0453684_0533095 Ga0453684_0533095_199_1191 330
94 3300045051 Ga0451576_0002347 Ga0451576_0002347_19629_20621 330
95 3300045051 Ga0451576_0006306 Ga0451576_0006306_406_1440 330
96 3300005347 Ga0070668_100065442 Ga0070668_1000654422 331
97 3300005445 Ga0070708_100118166 Ga0070708_1001181662 331
98 3300005467 Ga0070706_100189608 Ga0070706_1001896082 331
99 3300005471 Ga0070698_100095676 Ga0070698_1000956763 331
100 3300005471 Ga0070698_100137743 Ga0070698_1001377432 331
101 3300005536 Ga0070697_100173373 Ga0070697_1001733732 331
102 3300005937 Ga0081455_10147475 Ga0081455_101474752 331
103 3300005983 Ga0081540_1034541 Ga0081540_10345412 331
104 3300006028 Ga0070717_10042236 Ga0070717_100422363 331
105 3300013104 Ga0157370_10021364 Ga0157370_100213645 331
106 3300013306 Ga0163162_10273878 Ga0163162_102738782 331
107 3300021361 Ga0213872_10033525 Ga0213872_100335252 331
108 3300025903 Ga0207680_10169402 Ga0207680_101694021 331
109 3300025910 Ga0207684_10000678 Ga0207684_1000067811 331
110 3300031727 Ga0316576_10089906 Ga0316576_100899062 331
111 3300039447 Ga0436361_0350489 Ga0436361_0350489_973_2007 331
112 3300039447 Ga0436361_0353794 Ga0436361_0353794_1437_2471 331
113 3300042876 Ga0451577_0000131 Ga0451577_0000131_47975_48970 331
114 3300044712 Ga0453684_0060363 Ga0453684_0060363_376_1371 331
115 3300045051 Ga0451576_0034861 Ga0451576_0034861_514_1509 331
116 3300045051 Ga0451576_0274375 Ga0451576_0274375_408_1439 331
117 3300003320 rootH2_10077012 rootH2_100770128 332
118 3300005367 Ga0070667_100033071 Ga0070667_1000330712 332
119 3300005434 Ga0070709_10020039 Ga0070709_100200394 332
120 3300005435 Ga0070714_100316646 Ga0070714_1003166462 332
121 3300005436 Ga0070713_100020588 Ga0070713_1000205882 332
122 3300005471 Ga0070698_100145617 Ga0070698_1001456172 332
123 3300005518 Ga0070699_100030821 Ga0070699_1000308214 332
124 3300005536 Ga0070697_100077096 Ga0070697_1000770962 332
125 3300005539 Ga0068853_100139949 Ga0068853_1001399492 332
126 3300005546 Ga0070696_100000035 Ga0070696_1000000357 332
127 3300005548 Ga0070665_100000082 Ga0070665_100000082110 332
128 3300005563 Ga0068855_100015074 Ga0068855_1000150745 332
129 3300005614 Ga0068856_100001056 Ga0068856_10000105619 332
130 3300005614 Ga0068856_100010439 Ga0068856_1000104392 332
131 3300005614 Ga0068856_100423581 Ga0068856_1004235812 332
132 3300005841 Ga0068863_100003955 Ga0068863_1000039557 332
133 3300005842 Ga0068858_100004237 Ga0068858_10000423713 332
134 3300005843 Ga0068860_100184910 Ga0068860_1001849101 332
135 3300005981 Ga0081538_10101243 Ga0081538_101012432 332
136 3300006028 Ga0070717_10149965 Ga0070717_101499652 332
137 3300009093 Ga0105240_10006545 Ga0105240_1000654514 332
138 3300009093 Ga0105240_10017702 Ga0105240_100177027 332
139 3300009545 Ga0105237_10290791 Ga0105237_102907911 332
140 3300009551 Ga0105238_10006997 Ga0105238_100069976 332
141 3300009551 Ga0105238_10058676 Ga0105238_100586765 332
142 3300021361 Ga0213872_10008865 Ga0213872_100088653 332
143 3300021361 Ga0213872_10014126 Ga0213872_100141261 332
144 3300021384 Ga0213876_10002650 Ga0213876_100026502 332
145 3300021384 Ga0213876_10057946 Ga0213876_100579462 332
146 3300021388 Ga0213875_10060249 Ga0213875_100602492 332
147 3300021441 Ga0213871_10014521 Ga0213871_100145212 332
148 3300025906 Ga0207699_10050427 Ga0207699_100504272 332
149 3300025913 Ga0207695_10009008 Ga0207695_1000900813 332
150 3300025913 Ga0207695_10065866 Ga0207695_100658661 332
151 3300025924 Ga0207694_10004996 Ga0207694_100049967 332
152 3300025924 Ga0207694_10034720 Ga0207694_100347205 332
153 3300025928 Ga0207700_10085266 Ga0207700_100852662 332
154 3300025949 Ga0207667_10032886 Ga0207667_100328864 332
155 3300025949 Ga0207667_10047585 Ga0207667_100475853 332
156 3300025986 Ga0207658_10031363 Ga0207658_100313634 332
157 3300026035 Ga0207703_10005231 Ga0207703_100052312 332
158 3300026041 Ga0207639_10157819 Ga0207639_101578192 332
159 3300026078 Ga0207702_10002180 Ga0207702_100021805 332
160 3300026078 Ga0207702_10004574 Ga0207702_100045749 332
161 3300026078 Ga0207702_10089835 Ga0207702_100898352 332
162 3300026088 Ga0207641_10008030 Ga0207641_100080306 332
163 3300028379 Ga0268266_10000027 Ga0268266_10000027110 332
164 3300028563 Ga0265319_1000027 Ga0265319_100002721 332
165 3300028563 Ga0265319_1030844 Ga0265319_10308442 332
166 3300028800 Ga0265338_10052649 Ga0265338_100526493 332
167 3300031240 Ga0265320_10014174 Ga0265320_100141743 332
168 3300031247 Ga0265340_10062957 Ga0265340_100629571 332
169 3300031249 Ga0265339_10025834 Ga0265339_100258344 332
170 3300031250 Ga0265331_10079456 Ga0265331_100794561 332
171 3300031251 Ga0265327_10000571 Ga0265327_1000057112 332
172 3300031251 Ga0265327_10010679 Ga0265327_100106794 332
173 3300031344 Ga0265316_10000019 Ga0265316_10000019166 332
174 3300031711 Ga0265314_10017993 Ga0265314_100179933 332
175 3300031711 Ga0265314_10031200 Ga0265314_100312001 332
176 3300032168 Ga0316593_10024966 Ga0316593_100249663 332
177 3300033541 Ga0316596_1030749 Ga0316596_10307491 332
178 3300039093 Ga0400489_42060 Ga0400489_42060_188_1186 332
179 3300039437 Ga0436365_0260004 Ga0436365_0260004_890_1927 332
180 3300039437 Ga0436365_0410564 Ga0436365_0410564_3075_4112 332
181 3300039437 Ga0436365_1218194 Ga0436365_1218194_630_1667 332
182 3300039438 Ga0436360_0814848 Ga0436360_0814848_73_1110 332
183 3300039438 Ga0436360_1240369 Ga0436360_1240369_836_1873 332
184 3300039447 Ga0436361_0129286 Ga0436361_0129286_4883_5920 332
185 3300039447 Ga0436361_0141003 Ga0436361_0141003_262_1299 332
186 3300039447 Ga0436361_0227132 Ga0436361_0227132_696_1733 332
187 3300039447 Ga0436361_0725944 Ga0436361_0725944_114_1151 332
188 3300039450 Ga0436363_1646369 Ga0436363_1646369_1109_2146 332
189 3300039453 Ga0436362_0199621 Ga0436362_0199621_1011_2048 332
190 3300049569 Ga0501032_0068725 Ga0501032_0068725_1316_2350 332
191 3300049570 Ga0501033_0002094 Ga0501033_0002094_5610_6644 332
192 3300049571 Ga0501034_0002696 Ga0501034_0002696_1786_2853 332
193 3300049572 Ga0501036_0181934 Ga0501036_0181934_619_1686 332
194 3300049573 Ga0501037_0001057 Ga0501037_0001057_18076_19143 332
195 3300049574 Ga0501038_0001000 Ga0501038_0001000_8420_9487 332
196 3300049822 Ga0501035_0016007 Ga0501035_0016007_2119_3153 332
197 3300049823 Ga0501044_0002137 Ga0501044_0002137_16714_17748 332
198 3300005435 Ga0070714_100011194 Ga0070714_1000111941 333
199 3300005458 Ga0070681_10017121 Ga0070681_100171214 333
200 3300005563 Ga0068855_100103914 Ga0068855_1001039143 333
201 3300009093 Ga0105240_10051245 Ga0105240_100512453 333
202 3300025912 Ga0207707_10017319 Ga0207707_100173194 333
203 3300025913 Ga0207695_10051358 Ga0207695_100513583 333
204 3300025929 Ga0207664_10040915 Ga0207664_100409151 333
205 3300025949 Ga0207667_10050516 Ga0207667_100505162 333
206 3300028563 Ga0265319_1004291 Ga0265319_10042917 333
207 3300028563 Ga0265319_1007337 Ga0265319_10073374 333
208 3300031240 Ga0265320_10000397 Ga0265320_1000039729 333
209 3300031240 Ga0265320_10000663 Ga0265320_100006635 333
210 3300031240 Ga0265320_10005870 Ga0265320_100058709 333
211 3300049570 Ga0501033_0031311 Ga0501033_0031311_2890_3948 333
212 3300049571 Ga0501034_0050381 Ga0501034_0050381_926_2011 333
213 3300049589 Ga0501073_0229584 Ga0501073_0229584_190_1233 333
214 3300049822 Ga0501035_0011240 Ga0501035_0011240_2754_3812 333
215 3300049823 Ga0501044_0023793 Ga0501044_0023793_2823_3881 333
216 3300003792 Ga0055540_1010086 Ga0055540_10100863 334
217 3300005439 Ga0070711_100010030 Ga0070711_1000100303 334
218 3300005563 Ga0068855_100369197 Ga0068855_1003691971 334
219 3300009551 Ga0105238_10038125 Ga0105238_100381252 334
220 3300025303 Ga0209051_1001601 Ga0209051_100160118 334
221 3300025924 Ga0207694_10023281 Ga0207694_100232812 334
222 3300026078 Ga0207702_10140843 Ga0207702_101408433 334
223 3300028556 Ga0265337_1000547 Ga0265337_100054710 334
224 3300028563 Ga0265319_1035210 Ga0265319_10352102 334
225 3300028573 Ga0265334_10016362 Ga0265334_100163622 334
226 3300028666 Ga0265336_10001288 Ga0265336_1000128811 334
227 3300028666 Ga0265336_10011283 Ga0265336_100112833 334
228 3300028800 Ga0265338_10001642 Ga0265338_1000164211 334
229 3300028800 Ga0265338_10019799 Ga0265338_100197995 334
230 3300028800 Ga0265338_10033704 Ga0265338_100337044 334
231 3300031240 Ga0265320_10012648 Ga0265320_100126484 334
232 3300031344 Ga0265316_10003701 Ga0265316_100037016 334
233 3300031711 Ga0265314_10025720 Ga0265314_100257204 334
234 3300033180 Ga0307510_10236669 Ga0307510_102366691 334
235 3300034816 Ga0373930_0000108 Ga0373930_0000108_7382_8620 334
236 3300035084 Ga0373928_0001767 Ga0373928_0001767_2870_4108 334
237 3300035089 Ga0373944_0002400 Ga0373944_0002400_1665_2903 334
238 3300035090 Ga0373949_0002236 Ga0373949_0002236_2431_3669 334
239 3300035112 Ga0373932_0000002 Ga0373932_0000002_348679_349917 334
240 3300035242 Ga0373962_0000219 Ga0373962_0000219_7196_8434 334
241 3300035691 Ga0373931_0000015 Ga0373931_0000015_81090_82328 334
242 3300035692 Ga0373935_0054462 Ga0373935_0054462_1327_2478 334
243 3300035695 Ga0373927_0034353 Ga0373927_0034353_1777_3015 334
244 3300037068 Ga0373925_0000306 Ga0373925_0000306_334_1572 334
245 3300045051 Ga0451576_0050582 Ga0451576_0050582_1584_2624 334
246 3300047444 Ga0495675_0188797 Ga0495675_0188797_66_1118 334
247 3300003320 rootH2_10003802 rootH2_100038027 335
248 3300006028 Ga0070717_10000148 Ga0070717_1000014823 335
249 3300009093 Ga0105240_10060576 Ga0105240_100605762 335
250 3300013104 Ga0157370_10450707 Ga0157370_104507071 335
251 3300025913 Ga0207695_10054719 Ga0207695_100547192 335
252 3300028556 Ga0265337_1005178 Ga0265337_10051783 335
253 3300028563 Ga0265319_1007518 Ga0265319_10075183 335
254 3300028563 Ga0265319_1008143 Ga0265319_10081432 335
255 3300028563 Ga0265319_1008773 Ga0265319_10087732 335
256 3300028577 Ga0265318_10027234 Ga0265318_100272341 335
257 3300029957 Ga0265324_10006853 Ga0265324_100068532 335
258 3300029957 Ga0265324_10012050 Ga0265324_100120502 335
259 3300030521 Ga0307511_10024399 Ga0307511_100243993 335
260 3300031240 Ga0265320_10004383 Ga0265320_100043836 335
261 3300031250 Ga0265331_10007836 Ga0265331_100078366 335
262 3300031548 Ga0307408_100001687 Ga0307408_1000016876 335
263 3300031548 Ga0307408_100137410 Ga0307408_1001374102 335
264 3300031595 Ga0265313_10004808 Ga0265313_100048086 335
265 3300031901 Ga0307406_10000400 Ga0307406_1000040017 335
266 3300031903 Ga0307407_10015663 Ga0307407_100156632 335
267 3300031995 Ga0307409_100019874 Ga0307409_1000198744 335
268 3300032002 Ga0307416_100066079 Ga0307416_1000660792 335
269 3300032004 Ga0307414_10000006 Ga0307414_10000006348 335
270 3300042876 Ga0451577_0169982 Ga0451577_0169982_834_1874 335
271 3300044712 Ga0453684_0006989 Ga0453684_0006989_8432_9472 335
272 3300044712 Ga0453684_0073001 Ga0453684_0073001_2706_3746 335
273 3300048929 Ga0496126_0090150 Ga0496126_0090150_569_1576 335
274 3300049663 Ga0501223_010843 Ga0501223_010843_449_1501 335
275 3300049665 Ga0501227_004204 Ga0501227_004204_364_1416 335
276 3300049744 Ga0501083_0000828 Ga0501083_0000828_5881_6927 335
277 3300053136 Ga0500559_0006142 Ga0500559_0006142_1655_2707 335
278 3300053158 Ga0500627_0059418 Ga0500627_0059418_410_1462 335
279 3300025919 Ga0207657_10109461 Ga0207657_101094612 336
280 3300031251 Ga0265327_10054686 Ga0265327_100546862 336
281 3300048924 Ga0496121_0074197 Ga0496121_0074197_1136_2146 336
282 3300030733 Ga0314311_1079142 Ga0314311_10791422 337
283 3300030733 Ga0314311_1252934 Ga0314311_12529342 337
284 3300030742 Ga0316183_1186681 Ga0316183_11866811 337
285 3300031456 Ga0307513_10001443 Ga0307513_1000144324 337
286 3300032004 Ga0307414_10265510 Ga0307414_102655102 337
287 3300041404 Ga0439436_0001194 Ga0439436_0001194_952_2004 337
288 3300041406 Ga0439439_0007579 Ga0439439_0007579_354_1406 337
289 3300041413 Ga0439465_0000368 Ga0439465_0000368_3229_4281 337
290 3300041413 Ga0439465_0001593 Ga0439465_0001593_5577_6626 337
291 3300041451 Ga0451791_1932437 Ga0451791_1932437_228_1280 337
292 3300041460 Ga0451802_0137042 Ga0451802_0137042_56_1108 337
293 3300042006 Ga0439432_026979 Ga0439432_026979_636_1688 337
294 3300042007 Ga0439449_0001555 Ga0439449_0001555_801_1853 337
295 3300042007 Ga0439449_0003705 Ga0439449_0003705_4789_5841 337
296 3300046522 Ga0495643_0145318 Ga0495643_0145318_105_1157 337
297 3300046692 Ga0495671_0004974 Ga0495671_0004974_3872_4924 337
298 3300049705 Ga0501225_0007760 Ga0501225_0007760_1024_2076 337
299 3300002704 JGI25155J39150_1000033 JGI25155J39150_100003360 341
300 3300005563 Ga0068855_100148119 Ga0068855_1001481192 341
301 3300006195 Ga0075366_10023698 Ga0075366_100236982 341
302 3300031548 Ga0307408_100343203 Ga0307408_1003432031 341
303 3300050492 nmdc:mga0yw44_94363_c1 nmdc:mga0yw44_94363_c1_673_1698 341

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

83

395

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zds-assembly1.cif.gz_F crystal structure of sco6571 from streptomyces coelicolor a3(2) 0.9804 3 323
2zds-assembly1.cif.gz_F crystal structure of sco6571 from streptomyces coelicolor a3(2) 0.9744 3 323
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.858 2 317
3p6l-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_1903) from parabacteroides distasonis atcc 8503 at 1.85 a resolution 0.8183 2 317
6wn6-assembly1.cif.gz_A crystal structure of 3-keto-d-glucoside 4-epimerase, ycjr, from e. coli, apo form 0.812 3 316
ID Description Score Start End Superfamily
2zdsA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9802 3 322 3.20.20.150
2zdsA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9741 3 322 3.20.20.150
af_Q2G1E4_1_314_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.85 4 321 3.20.20.150
af_Q2G1E4_1_314_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8448 4 321 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8343 1 317 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A357FUL4-F1-model_v4 AP endonuclease 0.9949 1 122 GO:0004519
AF-X0XQR7-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9947 1 204
AF-A0A3B8PPD1-F1-model_v4 AP endonuclease 0.9944 1 210 GO:0004519
AF-A0A520LG69-F1-model_v4 Sugar phosphate isomerase/epimerase 0.993 1 232 GO:0016853
AF-A0A7K2XCR6-F1-model_v4 Sugar phosphate isomerase/epimerase 0.992 1 115 GO:0016853

Feature Viewer

pLDDT pTM Quality
94.24 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map