F395944

General Info

Members Datasets Scaffolds Average Seq Length
301 200 602 256

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10000499|Ga0207684_100004994
Length 278
Sequence MSPRDSAALWHDLGMRPVVIAANWKMNTTPADAGELAVIIAGRTRVEGVIRVICPPFVALAAVRDALAEAYPRVEVGAQDVHHELAGAYTGDISAPMLNGLASWVIIGHSERRRDHGETDERIGRKLARAVESGLRPILCVGEQLADRDAGRAVAVVDGQLAGCLAGHDPAALTDAGLVIAYEPVWAIGTGRNALGSDAAAMAAAIRTTLARLGWGASANDVPILYGGSVTAANIGEFLAEPSIDGALVGGASLKPDEMAGIVGRAGVTAVARLAAVP

Samples

Sample ID Description Type Environment
1 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
117 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
143 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 1.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.3
Rhizosphere 89.7
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207684_10000499 3300025910 Bacteria 49704
2 Ga0065707_10000528 3300005295 Bacteria 36759
3 Ga0070683_100090270 3300005329 Bacteria 2877
4 Ga0070670_100013675 3300005331 Bacteria 6955
5 Ga0068869_100028882 3300005334 Bacteria 3879
6 Ga0070682_100059617 3300005337 Bacteria 2411
7 Ga0070682_100168394 3300005337 Bacteria 1520
8 Ga0068868_100122027 3300005338 Bacteria 2126
9 Ga0070660_100029263 3300005339 Bacteria 4127
10 Ga0070687_100001422 3300005343 Bacteria 8412
11 Ga0070661_100446920 3300005344 Bacteria 1028
12 Ga0070692_10041779 3300005345 Bacteria 2351
13 Ga0070669_100019766 3300005353 Bacteria 4812
14 Ga0070675_100012622 3300005354 Bacteria 6625
15 Ga0070674_100030043 3300005356 Bacteria 3587
16 Ga0070673_100490745 3300005364 Bacteria 1110
17 Ga0070659_100213542 3300005366 Bacteria 1590
18 Ga0070703_10042829 3300005406 Bacteria 1417
19 Ga0070714_100013044 3300005435 Bacteria 6649
20 Ga0070701_10078292 3300005438 Bacteria 1784
21 Ga0070705_100149784 3300005440 Bacteria 1546
22 Ga0070705_100291448 3300005440 Bacteria 1165
23 Ga0070700_100010965 3300005441 Bacteria 5011
24 Ga0070700_100036229 3300005441 Bacteria 2991
25 Ga0070694_100020251 3300005444 Bacteria 4238
26 Ga0070694_100030487 3300005444 Bacteria 3528
27 Ga0070708_100033328 3300005445 Bacteria 4475
28 Ga0070708_100096455 3300005445 Bacteria 2701
29 Ga0070663_100037440 3300005455 Bacteria 3377
30 Ga0070678_100018762 3300005456 Bacteria 4491
31 Ga0070662_100035745 3300005457 Bacteria 3511
32 Ga0070685_10056308 3300005466 Bacteria 2285
33 Ga0070685_10371980 3300005466 Bacteria 982
34 Ga0070706_100001782 3300005467 Bacteria 22296
35 Ga0070706_100051511 3300005467 Bacteria 3799
36 Ga0070707_100006916 3300005468 Bacteria 10510
37 Ga0070707_100023517 3300005468 Bacteria 5829
38 Ga0070699_100022286 3300005518 Bacteria 5458
39 Ga0070684_100152210 3300005535 Bacteria 2096
40 Ga0070684_100224874 3300005535 Bacteria 1713
41 Ga0070684_100290306 3300005535 Bacteria 1499
42 Ga0070686_100054382 3300005544 Bacteria 2560
43 Ga0070695_100032004 3300005545 Bacteria 3286
44 Ga0070695_100163298 3300005545 Bacteria 1565
45 Ga0070696_100012324 3300005546 Bacteria 5734
46 Ga0070696_100019349 3300005546 Bacteria 4611
47 Ga0070696_100277109 3300005546 Bacteria 1277
48 Ga0070693_100124340 3300005547 Bacteria 1604
49 Ga0070704_100128059 3300005549 Bacteria 1962
50 Ga0070704_100238011 3300005549 Bacteria 1489
51 Ga0068855_100083252 3300005563 Bacteria 3706
52 Ga0068857_100041950 3300005577 Bacteria 4057
53 Ga0068854_100347972 3300005578 Bacteria 1212
54 Ga0070702_100003063 3300005615 Bacteria 7395
55 Ga0070702_100241209 3300005615 Bacteria 1220
56 Ga0068852_100013783 3300005616 Bacteria 6197
57 Ga0068859_100013801 3300005617 Bacteria 8099
58 Ga0068864_100068601 3300005618 Bacteria 3081
59 Ga0068864_100181379 3300005618 Bacteria 1925
60 Ga0068864_100298885 3300005618 Bacteria 1507
61 Ga0068861_100113488 3300005719 Bacteria 2174
62 Ga0068858_100193118 3300005842 Bacteria 1924
63 Ga0068862_100337479 3300005844 Bacteria 1395
64 Ga0081539_10002781 3300005985 Bacteria 23522
65 Ga0081539_10004082 3300005985 Bacteria 16687
66 Ga0070717_10097803 3300006028 Unclassified 2487
67 Ga0097621_100293634 3300006237 Bacteria 1434
68 Ga0075428_100003711 3300006844 Bacteria 16729
69 Ga0075428_100117410 3300006844 Bacteria 2898
70 Ga0075430_100002830 3300006846 Bacteria 14517
71 Ga0075431_100003412 3300006847 Bacteria 15415
72 Ga0075431_100009875 3300006847 Bacteria 9584
73 Ga0075431_100078614 3300006847 Bacteria 3405
74 Ga0075433_10512801 3300006852 Bacteria 1055
75 Ga0075429_100004219 3300006880 Bacteria 12310
76 Ga0075429_100056932 3300006880 Bacteria 3403
77 Ga0075429_100060102 3300006880 Bacteria 3311
78 Ga0075429_100086345 3300006880 Bacteria 2735
79 Ga0068865_100124699 3300006881 Bacteria 1921
80 Ga0097620_100013800 3300006931 Bacteria 8099
81 Ga0111539_10041781 3300009094 Bacteria 5510
82 Ga0111539_10727346 3300009094 Bacteria 1155
83 Ga0105245_10018349 3300009098 Bacteria 6117
84 Ga0105245_10151243 3300009098 Bacteria 2195
85 Ga0105245_10286728 3300009098 Bacteria 1611
86 Ga0105247_10202932 3300009101 Bacteria 1333
87 Ga0114129_10003176 3300009147 Bacteria 23053
88 Ga0114129_10007357 3300009147 Bacteria 15676
89 Ga0114129_10008894 3300009147 Bacteria 14316
90 Ga0114129_10466265 3300009147 Bacteria 1655
91 Ga0105243_10035680 3300009148 Bacteria 3855
92 Ga0105243_10171706 3300009148 Bacteria 1878
93 Ga0105243_10268068 3300009148 Bacteria 1532
94 Ga0105242_10280840 3300009176 Bacteria 1512
95 Ga0105242_10397624 3300009176 Bacteria 1285
96 Ga0105238_10425435 3300009551 Bacteria 1323
97 Ga0105249_10080774 3300009553 Bacteria 3021
98 Ga0105249_10215326 3300009553 Bacteria 1887
99 Ga0105246_10069236 3300011119 Bacteria 2478
100 Ga0157378_10149028 3300013297 Bacteria 2179
101 Ga0157372_10694476 3300013307 Bacteria 1184
102 Ga0157375_10007333 3300013308 Bacteria 9653
103 Ga0163163_10108104 3300014325 Bacteria 2808
104 Ga0163163_10187857 3300014325 Bacteria 2114
105 Ga0163163_10191409 3300014325 Bacteria 2094
106 Ga0157380_10188570 3300014326 Bacteria 1818
107 Ga0157377_10088225 3300014745 Bacteria 1826
108 Ga0157379_10053165 3300014968 Bacteria 3618
109 Ga0157376_10307670 3300014969 Bacteria 1502
110 Ga0163161_10231061 3300017792 Bacteria 1435
111 Ga0206356_10365663 3300020070 Bacteria 2367
112 Ga0206349_1454826 3300020075 Bacteria 2030
113 Ga0206352_10162311 3300020078 Bacteria 2473
114 Ga0213876_10082909 3300021384 Bacteria 1696
115 Ga0224712_10008224 3300022467 Bacteria 3079
116 Ga0207653_10009083 3300025885 Bacteria 3101
117 Ga0207643_10024408 3300025908 Bacteria 3336
118 Ga0207643_10333969 3300025908 Bacteria 949
119 Ga0207684_10030816 3300025910 Bacteria 4564
120 Ga0207707_10275419 3300025912 Bacteria 1458
121 Ga0207660_10145018 3300025917 Bacteria 1819
122 Ga0207662_10002757 3300025918 Bacteria 8877
123 Ga0207657_10061809 3300025919 Bacteria 3209
124 Ga0207652_10252326 3300025921 Bacteria 1591
125 Ga0207646_10007143 3300025922 Bacteria 11422
126 Ga0207646_10010248 3300025922 Bacteria 9175
127 Ga0207646_10082293 3300025922 Bacteria 2879
128 Ga0207646_10114716 3300025922 Bacteria 2419
129 Ga0207664_10009875 3300025929 Bacteria 6720
130 Ga0207690_10289938 3300025932 Bacteria 1277
131 Ga0207706_10016191 3300025933 Bacteria 6737
132 Ga0207686_10198775 3300025934 Bacteria 1434
133 Ga0207686_10301050 3300025934 Bacteria 1191
134 Ga0207686_10365234 3300025934 Bacteria 1091
135 Ga0207670_10098897 3300025936 Bacteria 2080
136 Ga0207689_10039563 3300025942 Bacteria 3903
137 Ga0207661_10157368 3300025944 Bacteria 1969
138 Ga0207661_10163208 3300025944 Bacteria 1934
139 Ga0207679_10265127 3300025945 Bacteria 1467
140 Ga0207667_10159134 3300025949 Bacteria 2323
141 Ga0207712_10169317 3300025961 Bacteria 1706
142 Ga0207668_10158108 3300025972 Bacteria 1763
143 Ga0207677_10357477 3300026023 Bacteria 1226
144 Ga0207678_10006454 3300026067 Bacteria 10406
145 Ga0207708_10566919 3300026075 Bacteria 959
146 Ga0207641_10865905 3300026088 Bacteria 896
147 Ga0207648_10002859 3300026089 Bacteria 18270
148 Ga0207676_10303073 3300026095 Bacteria 1460
149 Ga0207674_10094063 3300026116 Bacteria 2984
150 Ga0207675_100123806 3300026118 Bacteria 2448
151 Ga0207683_10061706 3300026121 Bacteria 3300
152 Ga0209999_1013572 3300027543 Bacteria 1477
153 Ga0209971_1013740 3300027682 Bacteria 1918
154 Ga0209998_10001019 3300027717 Bacteria 7052
155 Ga0209974_10015289 3300027876 Bacteria 2549
156 Ga0207428_10065604 3300027907 Bacteria 2863
157 Ga0265326_10006687 3300028558 Bacteria 3566
158 Ga0265326_10045639 3300028558 Bacteria 1242
159 Ga0265326_10046131 3300028558 Bacteria 1236
160 Ga0265319_1006646 3300028563 Bacteria 5324
161 Ga0265319_1013603 3300028563 Bacteria 3226
162 Ga0265319_1021489 3300028563 Bacteria 2369
163 Ga0265334_10053641 3300028573 Bacteria 1539
164 Ga0265334_10056946 3300028573 Bacteria 1483
165 Ga0265334_10070645 3300028573 Bacteria 1301
166 Ga0265334_10093788 3300028573 Bacteria 1093
167 Ga0265318_10018249 3300028577 Bacteria 2866
168 Ga0265318_10038129 3300028577 Bacteria 1838
169 Ga0265322_10022510 3300028654 Bacteria 1803
170 Ga0265336_10017615 3300028666 Bacteria 2325
171 Ga0265338_10259178 3300028800 Bacteria 1279
172 Ga0265324_10014646 3300029957 Bacteria 2897
173 Ga0265320_10037019 3300031240 Bacteria 2461
174 Ga0265320_10073043 3300031240 Bacteria 1613
175 Ga0265325_10024231 3300031241 Bacteria 3303
176 Ga0265339_10157755 3300031249 Bacteria 1143
177 Ga0265327_10186615 3300031251 Bacteria 945
178 Ga0265316_10026801 3300031344 Bacteria 4786
179 Ga0265316_10224061 3300031344 Bacteria 1386
180 Ga0307408_100112383 3300031548 Unclassified 2095
181 Ga0316579_10002583 3300031691 Bacteria 6858
182 Ga0316579_10180992 3300031691 Bacteria 1019
183 Ga0316579_10218905 3300031691 Bacteria 921
184 Ga0265314_10076835 3300031711 Bacteria 2217
185 Ga0265342_10125076 3300031712 Bacteria 1444
186 Ga0316577_10003224 3300031733 Bacteria 8208
187 Ga0307412_10453932 3300031911 Bacteria 1057
188 Ga0307409_100026738 3300031995 Bacteria 4076
189 Ga0307416_100295261 3300032002 Bacteria 1607
190 Ga0307416_100755820 3300032002 Bacteria 1065
191 Ga0373942_0033515 3300035207 Bacteria 1370
192 Ga0373931_0109560 3300035691 Bacteria 1565
193 Ga0373947_0445532 3300035725 Bacteria 877
194 Ga0373937_0361852 3300036401 Bacteria 1375
195 Ga0373937_0551689 3300036401 Bacteria 1095
196 Ga0316582_0042589 3300036647 Bacteria 2845
197 Ga0373925_0142180 3300037068 Bacteria 1879
198 Ga0373925_0569343 3300037068 Bacteria 932
199 Ga0400489_50150 3300039093 Bacteria 2511
200 Ga0436365_1850772 3300039437 Bacteria 6850
201 Ga0439458_0038565 3300042157 Bacteria 1154
202 Ga0439434_0136857 3300042435 Bacteria 806
203 Ga0451577_0658157 3300042876 Bacteria 950
204 Ga0466969_0053951 3300044656 Bacteria 1970
205 Ga0453683_0013174 3300044673 Bacteria 5406
206 Ga0453683_0071976 3300044673 Bacteria 2164
207 Ga0453683_0073383 3300044673 Bacteria 2142
208 Ga0453683_0118457 3300044673 Bacteria 1666
209 Ga0466966_0017518 3300044684 Bacteria 4732
210 Ga0453684_0252892 3300044712 Bacteria 2023
211 Ga0453684_0552329 3300044712 Bacteria 1268
212 Ga0466971_0000915 3300044719 Bacteria 12098
213 Ga0466970_0010635 3300044765 Bacteria 4674
214 Ga0466957_0033300 3300044842 Bacteria 3091
215 Ga0466959_0002638 3300045049 Bacteria 11510
216 Ga0451576_0000073 3300045051 Bacteria 253094
217 Ga0451576_0162689 3300045051 Bacteria 2329
218 Ga0495628_0032639 3300046516 Bacteria 4202
219 Ga0495644_0106556 3300046523 Bacteria 1062
220 Ga0495645_0180061 3300046543 Bacteria 1449
221 Ga0495647_0054334 3300046681 Bacteria 1565
222 Ga0495674_0165739 3300047319 Bacteria 1847
223 Ga0496101_0069236 3300048904 Bacteria 2581
224 Ga0496101_0130007 3300048904 Bacteria 1912
225 Ga0496102_0081007 3300048905 Bacteria 2992
226 Ga0496102_0167221 3300048905 Bacteria 2070
227 Ga0496104_0063458 3300048907 Bacteria 3503
228 Ga0496104_0146888 3300048907 Bacteria 2264
229 Ga0496104_0976293 3300048907 Bacteria 751
230 Ga0496105_0017133 3300048908 Bacteria 5801
231 Ga0496105_0230007 3300048908 Bacteria 1507
232 Ga0496106_0244916 3300048909 Bacteria 1433
233 Ga0496108_0008809 3300048911 Bacteria 8178
234 Ga0496108_0349740 3300048911 Bacteria 1290
235 Ga0496109_0052850 3300048912 Bacteria 3704
236 Ga0496109_0064246 3300048912 Bacteria 3358
237 Ga0496109_0080997 3300048912 Bacteria 2992
238 Ga0496109_0132611 3300048912 Bacteria 2326
239 Ga0496110_0027255 3300048913 Bacteria 4897
240 Ga0496110_0037842 3300048913 Bacteria 4195
241 Ga0496111_0194866 3300048914 Bacteria 1506
242 Ga0496111_0396166 3300048914 Bacteria 1020
243 Ga0496112_0039988 3300048915 Bacteria 4584
244 Ga0496112_0071074 3300048915 Bacteria 3439
245 Ga0496113_0025501 3300048916 Bacteria 4214
246 Ga0496113_0059789 3300048916 Bacteria 2871
247 Ga0496113_0136163 3300048916 Bacteria 1930
248 Ga0496113_0201381 3300048916 Bacteria 1583
249 Ga0496114_0023716 3300048917 Bacteria 5008
250 Ga0496114_0353036 3300048917 Bacteria 1301
251 Ga0501031_0194547 3300049568 Bacteria 1324
252 Ga0501036_0023063 3300049572 Bacteria 5239
253 Ga0501039_0147947 3300049575 Bacteria 1846
254 Ga0501041_0546020 3300049577 Bacteria 738
255 Ga0501046_0086918 3300049580 Bacteria 2410
256 Ga0501048_0039107 3300049582 Bacteria 3404
257 Ga0501048_0283633 3300049582 Bacteria 1178
258 Ga0501068_0028737 3300049584 Bacteria 3290
259 Ga0501068_0231091 3300049584 Bacteria 1176
260 Ga0501068_0329326 3300049584 Bacteria 980
261 Ga0501069_0004599 3300049585 Bacteria 7140
262 Ga0501071_0043238 3300049587 Bacteria 3230
263 Ga0501071_0067849 3300049587 Bacteria 2595
264 Ga0501071_0085405 3300049587 Bacteria 2314
265 Ga0501071_0156973 3300049587 Bacteria 1699
266 Ga0501072_0202724 3300049588 Bacteria 1582
267 Ga0501072_0213475 3300049588 Bacteria 1538
268 Ga0501073_0044987 3300049589 Bacteria 3111
269 Ga0501075_0009323 3300049591 Bacteria 6868
270 Ga0501075_0070460 3300049591 Bacteria 2642
271 Ga0501075_0125509 3300049591 Bacteria 1954
272 Ga0501075_0486630 3300049591 Bacteria 941
273 Ga0501076_0018977 3300049592 Bacteria 5248
274 Ga0501076_0156557 3300049592 Bacteria 1855
275 Ga0501076_0169972 3300049592 Bacteria 1777
276 Ga0501077_0052156 3300049593 Bacteria 2598
277 Ga0501079_0122510 3300049741 Bacteria 2022
278 Ga0501080_0554762 3300049742 Bacteria 1023
279 Ga0501081_0356981 3300049743 Bacteria 1078
280 Ga0501045_0149936 3300049824 Bacteria 1735
281 nmdc:mga05p37_112074_c1 3300050507 Bacteria 3355
282 nmdc:mga05p37_4659_c1 3300050507 Bacteria 16026
283 nmdc:mga05p37_80_c1 3300050507 Bacteria 85054
284 nmdc:mga09592_118919_c1 3300050508 Bacteria 2268
285 nmdc:mga09592_5985_c1 3300050508 Bacteria 9918
286 nmdc:mga09592_8049_c1 3300050508 Bacteria 8575
287 nmdc:mga0qj67_3287_c1 3300050509 Bacteria 11644
288 nmdc:mga06r32_12523_c1 3300050510 Bacteria 7655
289 nmdc:mga06r32_3235_c1 3300050510 Bacteria 14572
290 nmdc:mga06r32_68018_c1 3300050510 Bacteria 3440
291 nmdc:mga08y16_434668_c1 3300050511 Bacteria 1340
292 nmdc:mga08y16_66946_c1 3300050511 Bacteria 3748
293 nmdc:mga0rr50_229188_c1 3300050513 Bacteria 1536
294 nmdc:mga0a205_49219_c1 3300050515 Bacteria 4067
295 Ga0495619_0156944 3300053085 Bacteria 1570
296 Ga0501084_0106181 3300054114 Bacteria 2359
297 Ga0501084_0287304 3300054114 Bacteria 1389
298 Ga0501082_0035004 3300060353 Bacteria 4328
299 Ga0466962_0002836 3300061719 Bacteria 8253
300 Ga0530510_0001749 3300061734 Bacteria 14798
301 Ga0530510_0111487 3300061734 Bacteria 2004
302 Ga0207684_10000499
303 Ga0065707_10000528
304 Ga0070683_100090270
305 Ga0070670_100013675
306 Ga0068869_100028882
307 Ga0070682_100059617
308 Ga0070682_100168394
309 Ga0068868_100122027
310 Ga0070660_100029263
311 Ga0070687_100001422
312 Ga0070661_100446920
313 Ga0070692_10041779
314 Ga0070669_100019766
315 Ga0070675_100012622
316 Ga0070674_100030043
317 Ga0070673_100490745
318 Ga0070659_100213542
319 Ga0070703_10042829
320 Ga0070714_100013044
321 Ga0070701_10078292
322 Ga0070705_100149784
323 Ga0070705_100291448
324 Ga0070700_100010965
325 Ga0070700_100036229
326 Ga0070694_100020251
327 Ga0070694_100030487
328 Ga0070708_100033328
329 Ga0070708_100096455
330 Ga0070663_100037440
331 Ga0070678_100018762
332 Ga0070662_100035745
333 Ga0070685_10056308
334 Ga0070685_10371980
335 Ga0070706_100001782
336 Ga0070706_100051511
337 Ga0070707_100006916
338 Ga0070707_100023517
339 Ga0070699_100022286
340 Ga0070684_100152210
341 Ga0070684_100224874
342 Ga0070684_100290306
343 Ga0070686_100054382
344 Ga0070695_100032004
345 Ga0070695_100163298
346 Ga0070696_100012324
347 Ga0070696_100019349
348 Ga0070696_100277109
349 Ga0070693_100124340
350 Ga0070704_100128059
351 Ga0070704_100238011
352 Ga0068855_100083252
353 Ga0068857_100041950
354 Ga0068854_100347972
355 Ga0070702_100003063
356 Ga0070702_100241209
357 Ga0068852_100013783
358 Ga0068859_100013801
359 Ga0068864_100068601
360 Ga0068864_100181379
361 Ga0068864_100298885
362 Ga0068861_100113488
363 Ga0068858_100193118
364 Ga0068862_100337479
365 Ga0081539_10002781
366 Ga0081539_10004082
367 Ga0070717_10097803
368 Ga0097621_100293634
369 Ga0075428_100003711
370 Ga0075428_100117410
371 Ga0075430_100002830
372 Ga0075431_100003412
373 Ga0075431_100009875
374 Ga0075431_100078614
375 Ga0075433_10512801
376 Ga0075429_100004219
377 Ga0075429_100056932
378 Ga0075429_100060102
379 Ga0075429_100086345
380 Ga0068865_100124699
381 Ga0097620_100013800
382 Ga0111539_10041781
383 Ga0111539_10727346
384 Ga0105245_10018349
385 Ga0105245_10151243
386 Ga0105245_10286728
387 Ga0105247_10202932
388 Ga0114129_10003176
389 Ga0114129_10007357
390 Ga0114129_10008894
391 Ga0114129_10466265
392 Ga0105243_10035680
393 Ga0105243_10171706
394 Ga0105243_10268068
395 Ga0105242_10280840
396 Ga0105242_10397624
397 Ga0105238_10425435
398 Ga0105249_10080774
399 Ga0105249_10215326
400 Ga0105246_10069236
401 Ga0157378_10149028
402 Ga0157372_10694476
403 Ga0157375_10007333
404 Ga0163163_10108104
405 Ga0163163_10187857
406 Ga0163163_10191409
407 Ga0157380_10188570
408 Ga0157377_10088225
409 Ga0157379_10053165
410 Ga0157376_10307670
411 Ga0163161_10231061
412 Ga0206356_10365663
413 Ga0206349_1454826
414 Ga0206352_10162311
415 Ga0213876_10082909
416 Ga0224712_10008224
417 Ga0207653_10009083
418 Ga0207643_10024408
419 Ga0207643_10333969
420 Ga0207684_10030816
421 Ga0207707_10275419
422 Ga0207660_10145018
423 Ga0207662_10002757
424 Ga0207657_10061809
425 Ga0207652_10252326
426 Ga0207646_10007143
427 Ga0207646_10010248
428 Ga0207646_10082293
429 Ga0207646_10114716
430 Ga0207664_10009875
431 Ga0207690_10289938
432 Ga0207706_10016191
433 Ga0207686_10198775
434 Ga0207686_10301050
435 Ga0207686_10365234
436 Ga0207670_10098897
437 Ga0207689_10039563
438 Ga0207661_10157368
439 Ga0207661_10163208
440 Ga0207679_10265127
441 Ga0207667_10159134
442 Ga0207712_10169317
443 Ga0207668_10158108
444 Ga0207677_10357477
445 Ga0207678_10006454
446 Ga0207708_10566919
447 Ga0207641_10865905
448 Ga0207648_10002859
449 Ga0207676_10303073
450 Ga0207674_10094063
451 Ga0207675_100123806
452 Ga0207683_10061706
453 Ga0209999_1013572
454 Ga0209971_1013740
455 Ga0209998_10001019
456 Ga0209974_10015289
457 Ga0207428_10065604
458 Ga0265326_10006687
459 Ga0265326_10045639
460 Ga0265326_10046131
461 Ga0265319_1006646
462 Ga0265319_1013603
463 Ga0265319_1021489
464 Ga0265334_10053641
465 Ga0265334_10056946
466 Ga0265334_10070645
467 Ga0265334_10093788
468 Ga0265318_10018249
469 Ga0265318_10038129
470 Ga0265322_10022510
471 Ga0265336_10017615
472 Ga0265338_10259178
473 Ga0265324_10014646
474 Ga0265320_10037019
475 Ga0265320_10073043
476 Ga0265325_10024231
477 Ga0265339_10157755
478 Ga0265327_10186615
479 Ga0265316_10026801
480 Ga0265316_10224061
481 Ga0307408_100112383
482 Ga0316579_10002583
483 Ga0316579_10180992
484 Ga0316579_10218905
485 Ga0265314_10076835
486 Ga0265342_10125076
487 Ga0316577_10003224
488 Ga0307412_10453932
489 Ga0307409_100026738
490 Ga0307416_100295261
491 Ga0307416_100755820
492 Ga0373942_0033515
493 Ga0373931_0109560
494 Ga0373947_0445532
495 Ga0373937_0361852
496 Ga0373937_0551689
497 Ga0316582_0042589
498 Ga0373925_0142180
499 Ga0373925_0569343
500 Ga0400489_50150
501 Ga0436365_1850772
502 Ga0439458_0038565
503 Ga0439434_0136857
504 Ga0451577_0658157
505 Ga0466969_0053951
506 Ga0453683_0013174
507 Ga0453683_0071976
508 Ga0453683_0073383
509 Ga0453683_0118457
510 Ga0466966_0017518
511 Ga0453684_0252892
512 Ga0453684_0552329
513 Ga0466971_0000915
514 Ga0466970_0010635
515 Ga0466957_0033300
516 Ga0466959_0002638
517 Ga0451576_0000073
518 Ga0451576_0162689
519 Ga0495628_0032639
520 Ga0495644_0106556
521 Ga0495645_0180061
522 Ga0495647_0054334
523 Ga0495674_0165739
524 Ga0496101_0069236
525 Ga0496101_0130007
526 Ga0496102_0081007
527 Ga0496102_0167221
528 Ga0496104_0063458
529 Ga0496104_0146888
530 Ga0496104_0976293
531 Ga0496105_0017133
532 Ga0496105_0230007
533 Ga0496106_0244916
534 Ga0496108_0008809
535 Ga0496108_0349740
536 Ga0496109_0052850
537 Ga0496109_0064246
538 Ga0496109_0080997
539 Ga0496109_0132611
540 Ga0496110_0027255
541 Ga0496110_0037842
542 Ga0496111_0194866
543 Ga0496111_0396166
544 Ga0496112_0039988
545 Ga0496112_0071074
546 Ga0496113_0025501
547 Ga0496113_0059789
548 Ga0496113_0136163
549 Ga0496113_0201381
550 Ga0496114_0023716
551 Ga0496114_0353036
552 Ga0501031_0194547
553 Ga0501036_0023063
554 Ga0501039_0147947
555 Ga0501041_0546020
556 Ga0501046_0086918
557 Ga0501048_0039107
558 Ga0501048_0283633
559 Ga0501068_0028737
560 Ga0501068_0231091
561 Ga0501068_0329326
562 Ga0501069_0004599
563 Ga0501071_0043238
564 Ga0501071_0067849
565 Ga0501071_0085405
566 Ga0501071_0156973
567 Ga0501072_0202724
568 Ga0501072_0213475
569 Ga0501073_0044987
570 Ga0501075_0009323
571 Ga0501075_0070460
572 Ga0501075_0125509
573 Ga0501075_0486630
574 Ga0501076_0018977
575 Ga0501076_0156557
576 Ga0501076_0169972
577 Ga0501077_0052156
578 Ga0501079_0122510
579 Ga0501080_0554762
580 Ga0501081_0356981
581 Ga0501045_0149936
582 nmdc:mga05p37_112074_c1
583 nmdc:mga05p37_4659_c1
584 nmdc:mga05p37_80_c1
585 nmdc:mga09592_118919_c1
586 nmdc:mga09592_5985_c1
587 nmdc:mga09592_8049_c1
588 nmdc:mga0qj67_3287_c1
589 nmdc:mga06r32_12523_c1
590 nmdc:mga06r32_3235_c1
591 nmdc:mga06r32_68018_c1
592 nmdc:mga08y16_434668_c1
593 nmdc:mga08y16_66946_c1
594 nmdc:mga0rr50_229188_c1
595 nmdc:mga0a205_49219_c1
596 Ga0495619_0156944
597 Ga0501084_0106181
598 Ga0501084_0287304
599 Ga0501082_0035004
600 Ga0466962_0002836
601 Ga0530510_0001749
602 Ga0530510_0111487

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

18

266

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y8f-assembly1.cif.gz_A-2 crystal structure of triosephosphate isomerase from clostridium perfringens 0.9739 1 250
1b9b-assembly1.cif.gz_B triosephosphate isomerase of thermotoga maritima 0.9719 2 255
1btm-assembly1.cif.gz_B triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid 0.9691 2 253
4y96-assembly1.cif.gz_A crystal structure of triosephosphate isomerase from gemmata obscuriglobus 0.9691 1 253
2btm-assembly1.cif.gz_B does the his12-lys13 pair play a role in the adaptation of thermophilic tims to high temperatures? 0.9686 2 253
ID Description Score Start End Superfamily
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9691 1 253 3.20.20.70
6bveB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9643 1 251 3.20.20.70
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9615 1 253 3.20.20.70
4g1kC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9597 1 253 3.20.20.70
af_P0A858_1_255_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9592 1 255 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A350G4Z6-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9916 1 122 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-X1PPG5-F1-model_v4 Triosephosphate isomerase 0.9891 1 148 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A2W6AIF6-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9879 12 255 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A7C1JF11-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9875 1 254 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A3B9J899-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9869 73 254 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166

Map