F394143

General Info

Members Datasets Scaffolds Average Seq Length
298 230 596 300

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100124758|Ga0070699_1001247583
Length 329
Sequence MPQSSQRMTRTRDLLGYTGSPPDPRWPGGARVAVSIVVNFEEGAEFSVTDGDPENEAVYEIEQRLAGRPDPAIDSHFEYGSRAGWWRIMEVLGQHGAPATVSSSGQAVERLPLLAQDAVRRGHEISAHGWRWEGHADLDEAEERDRIARAVAAIKAVTGSRPVGWHTRSPGSVNTRRLLVEEGGFLYDSDAYNDDLPYFVRVGDKRHLVLPYAFDTNDMQFFHTNRFSGAADFAAYVIDALDRLDREGAHAPKMMSIGLHLRMIGRPGRIGALDRILRHIANRGDAWIARRVDIANHWLAQFPETQSSPLSNHGVRGYRPHGGPQCPHR

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
88 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
114 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
115 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
192 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
193 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
194 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
195 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
196 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
197 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
198 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
199 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
200 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
201 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
202 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
203 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
204 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
205 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
206 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
207 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
208 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
209 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
210 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
211 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
212 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
213 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
214 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
215 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
216 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
217 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
218 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
219 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
220 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
221 2842733646 Variovorax sp. R-72446 Isolate Unclassified
222 2855730933 Achromobacter sp. HZ28 Isolate Nodule
223 2855767633 Achromobacter sp. HZ34 Isolate Nodule
224 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
225 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
226 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
227 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
228 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
229 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
230 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.64
Metatranscriptomes 0
Isolates 4.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.79
Nodule 1.68
Rhizoplane 2.68
Rhizosphere 67.79
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100124758 3300005518 Bacteria 2266
2 JGI25151J46595_10038080 3300003187 Bacteria 1794
3 Ga0070658_10089654 3300005327 Bacteria 2532
4 Ga0070670_100208317 3300005331 Bacteria 1700
5 Ga0070670_100313202 3300005331 Bacteria 1374
6 Ga0068869_100157801 3300005334 Bacteria 1764
7 Ga0070680_100144262 3300005336 Bacteria 1997
8 Ga0070689_100376362 3300005340 Bacteria 1196
9 Ga0070668_100067852 3300005347 Bacteria 2772
10 Ga0070713_100284332 3300005436 Bacteria 1518
11 Ga0070710_10020872 3300005437 Bacteria 3404
12 Ga0070710_10065023 3300005437 Bacteria 2088
13 Ga0070705_100049729 3300005440 Bacteria 2436
14 Ga0070708_100114628 3300005445 Bacteria 2480
15 Ga0070706_100010475 3300005467 Bacteria 8607
16 Ga0070706_100138132 3300005467 Bacteria 2274
17 Ga0070707_100235554 3300005468 Bacteria 1782
18 Ga0070698_100002091 3300005471 Bacteria 22152
19 Ga0070698_100043416 3300005471 Bacteria 4609
20 Ga0070699_100200501 3300005518 Bacteria 1774
21 Ga0070697_100100923 3300005536 Bacteria 2397
22 Ga0068853_100303399 3300005539 Bacteria 1476
23 Ga0070696_100296639 3300005546 Bacteria 1237
24 Ga0070696_100427085 3300005546 Unclassified 1041
25 Ga0070665_100133877 3300005548 Bacteria 2480
26 Ga0070665_100161241 3300005548 Bacteria 2245
27 Ga0068855_100246376 3300005563 Bacteria 1994
28 Ga0068857_100088068 3300005577 Bacteria 2778
29 Ga0068864_100231953 3300005618 Bacteria 1707
30 Ga0068864_100389177 3300005618 Bacteria 1323
31 Ga0068861_100169202 3300005719 Bacteria 1810
32 Ga0081455_10104603 3300005937 Bacteria 2264
33 Ga0081540_1007113 3300005983 Bacteria 8033
34 Ga0070717_10124782 3300006028 Bacteria 2209
35 Ga0075365_10058693 3300006038 Bacteria 2562
36 Ga0075368_10007310 3300006042 Bacteria 3894
37 Ga0075363_100008792 3300006048 Bacteria 4722
38 Ga0075364_10005111 3300006051 Bacteria 7604
39 Ga0075364_10182292 3300006051 Bacteria 1421
40 Ga0070716_100102906 3300006173 Bacteria 1755
41 Ga0070712_100218815 3300006175 Bacteria 1506
42 Ga0075362_10033352 3300006177 Bacteria 2239
43 Ga0075362_10103643 3300006177 Bacteria 1333
44 Ga0075369_10037571 3300006186 Bacteria 2063
45 Ga0075366_10015336 3300006195 Bacteria 4389
46 Ga0075366_10063852 3300006195 Bacteria 2189
47 Ga0075370_10037101 3300006353 Bacteria 2739
48 Ga0075428_100029777 3300006844 Bacteria 6039
49 Ga0075431_100004420 3300006847 Bacteria 13783
50 Ga0075431_100317131 3300006847 Bacteria 1572
51 Ga0075433_10001898 3300006852 Bacteria 15723
52 Ga0075434_100013813 3300006871 Bacteria 7700
53 Ga0075434_100132278 3300006871 Bacteria 2514
54 Ga0075429_100104390 3300006880 Bacteria 2475
55 Ga0075436_100013463 3300006914 Bacteria 5600
56 Ga0075435_100014603 3300007076 Bacteria 5877
57 Ga0075435_100065760 3300007076 Bacteria 2948
58 Ga0105240_10206717 3300009093 Bacteria 2297
59 Ga0105240_10282063 3300009093 Bacteria 1908
60 Ga0105247_10107615 3300009101 Bacteria 1790
61 Ga0114129_10000722 3300009147 Bacteria 41913
62 Ga0114129_10009937 3300009147 Bacteria 13563
63 Ga0114129_10100569 3300009147 Bacteria 4001
64 Ga0105241_10040169 3300009174 Bacteria 3531
65 Ga0105242_10654002 3300009176 Bacteria 1022
66 Ga0105248_10028807 3300009177 Bacteria 6189
67 Ga0105237_10083851 3300009545 Bacteria 3178
68 Ga0105238_10007744 3300009551 Bacteria 10742
69 Ga0157374_10049623 3300013296 Bacteria 3898
70 Ga0157372_10258010 3300013307 Bacteria 2024
71 Ga0163163_10229953 3300014325 Bacteria 1903
72 Ga0157380_10117825 3300014326 Bacteria 2243
73 Ga0213875_10000944 3300021388 Bacteria 20886
74 Ga0209025_1000382 3300025294 Bacteria 91921
75 Ga0209758_1010417 3300025297 Bacteria 5566
76 Ga0209257_1023224 3300025304 Bacteria 2186
77 Ga0207697_10011928 3300025315 Bacteria 3661
78 Ga0207647_10004275 3300025904 Bacteria 10591
79 Ga0207699_10162922 3300025906 Bacteria 1486
80 Ga0207705_10219050 3300025909 Bacteria 1445
81 Ga0207684_10280290 3300025910 Bacteria 1437
82 Ga0207671_10154556 3300025914 Bacteria 1774
83 Ga0207693_10070199 3300025915 Bacteria 2742
84 Ga0207693_10168703 3300025915 Bacteria 1724
85 Ga0207657_10171251 3300025919 Bacteria 1759
86 Ga0207646_10122491 3300025922 Bacteria 2337
87 Ga0207694_10092163 3300025924 Bacteria 2392
88 Ga0207694_10155903 3300025924 Bacteria 1842
89 Ga0207650_10303625 3300025925 Bacteria 1304
90 Ga0207650_10375840 3300025925 Bacteria 1173
91 Ga0207700_10022812 3300025928 Bacteria 4300
92 Ga0207700_10065725 3300025928 Bacteria 2768
93 Ga0207664_10043832 3300025929 Bacteria 3502
94 Ga0207706_10226116 3300025933 Bacteria 1638
95 Ga0207665_10008975 3300025939 Bacteria 6563
96 Ga0207665_10131711 3300025939 Bacteria 1776
97 Ga0207661_10064149 3300025944 Bacteria 2977
98 Ga0207668_10048055 3300025972 Bacteria 2926
99 Ga0207703_10153848 3300026035 Bacteria 2008
100 Ga0207639_10433563 3300026041 Bacteria 1190
101 Ga0207678_10081529 3300026067 Bacteria 2769
102 Ga0207678_10399788 3300026067 Bacteria 1189
103 Ga0207674_10151374 3300026116 Bacteria 2277
104 Ga0207675_100078335 3300026118 Bacteria 3096
105 Ga0207683_10356397 3300026121 Bacteria 1343
106 Ga0209971_1044884 3300027682 Bacteria 1065
107 Ga0209974_10020878 3300027876 Bacteria 2170
108 Ga0268266_10299881 3300028379 Bacteria 1499
109 Ga0268264_10356615 3300028381 Bacteria 1394
110 Ga0265323_10001849 3300028653 Bacteria 10019
111 Ga0265322_10044714 3300028654 Bacteria 1261
112 Ga0265336_10000362 3300028666 Bacteria 29324
113 Ga0265338_10001385 3300028800 Bacteria 39441
114 Ga0265324_10007008 3300029957 Bacteria 4633
115 Ga0265320_10008275 3300031240 Bacteria 6374
116 Ga0265325_10012115 3300031241 Bacteria 4938
117 Ga0265329_10031825 3300031242 Bacteria 1712
118 Ga0265340_10000367 3300031247 Bacteria 23969
119 Ga0265340_10044905 3300031247 Bacteria 2160
120 Ga0265339_10004754 3300031249 Bacteria 9205
121 Ga0265327_10035914 3300031251 Bacteria 2732
122 Ga0265316_10023070 3300031344 Bacteria 5233
123 Ga0307513_10096291 3300031456 Bacteria 2998
124 Ga0307408_100004412 3300031548 Bacteria 9549
125 Ga0265313_10002718 3300031595 Bacteria 14973
126 Ga0265313_10033423 3300031595 Bacteria 2614
127 Ga0265314_10143551 3300031711 Bacteria 1473
128 Ga0265342_10005087 3300031712 Bacteria 10131
129 Ga0265342_10060129 3300031712 Bacteria 2242
130 Ga0307405_10002072 3300031731 Bacteria 8733
131 Ga0307405_10028547 3300031731 Bacteria 3251
132 Ga0307405_10165284 3300031731 Bacteria 1572
133 Ga0307410_10007047 3300031852 Bacteria 6123
134 Ga0307410_10110489 3300031852 Bacteria 1988
135 Ga0307407_10014156 3300031903 Bacteria 3897
136 Ga0307412_10012122 3300031911 Bacteria 5012
137 Ga0307409_100005071 3300031995 Bacteria 7509
138 Ga0307416_100004945 3300032002 Bacteria 8120
139 Ga0307414_10141353 3300032004 Bacteria 1885
140 Ga0307411_10011704 3300032005 Bacteria 4750
141 Ga0307411_10024252 3300032005 Bacteria 3612
142 Ga0307415_100005679 3300032126 Bacteria 6646
143 Ga0307507_10067723 3300033179 Bacteria 3263
144 Ga0307510_10007621 3300033180 Bacteria 12903
145 Ga0373932_0016734 3300035112 Bacteria 1875
146 Ga0373954_0021128 3300035118 Bacteria 2946
147 Ga0373935_0177974 3300035692 Bacteria 1459
148 Ga0373933_0007562 3300035724 Bacteria 5935
149 Ga0436364_0080442 3300037853 Bacteria 24108
150 Ga0436364_0239376 3300037853 Bacteria 1167
151 Ga0436365_1829173 3300039437 Bacteria 3592
152 Ga0436361_0559550 3300039447 Bacteria 2076
153 Ga0436361_1134895 3300039447 Bacteria 1396
154 Ga0450911_000234 3300042115 Bacteria 21144
155 Ga0495592_0115139 3300046454 Bacteria 1898
156 Ga0495629_0018866 3300046459 Bacteria 4930
157 Ga0495638_0007636 3300046460 Bacteria 7732
158 Ga0495638_0015865 3300046460 Bacteria 5048
159 Ga0495638_0059106 3300046460 Bacteria 2375
160 Ga0495651_0001791 3300046462 Bacteria 16560
161 Ga0495651_0067110 3300046462 Bacteria 2737
162 Ga0495651_0097666 3300046462 Bacteria 2193
163 Ga0495653_0101859 3300046463 Bacteria 2079
164 Ga0495662_0047561 3300046476 Bacteria 2071
165 Ga0495594_0196807 3300046499 Bacteria 1149
166 Ga0495606_0059517 3300046507 Bacteria 2450
167 Ga0495606_0129548 3300046507 Bacteria 1501
168 Ga0495608_0301803 3300046511 Bacteria 991
169 Ga0495628_0105483 3300046516 Bacteria 2171
170 Ga0495643_0005934 3300046522 Bacteria 8149
171 Ga0495643_0108716 3300046522 Bacteria 1412
172 Ga0495648_0002080 3300046524 Bacteria 18945
173 Ga0495587_0133422 3300046536 Bacteria 1419
174 Ga0495597_0009832 3300046542 Bacteria 4705
175 Ga0495645_0163683 3300046543 Bacteria 1536
176 Ga0495622_0031859 3300046557 Bacteria 2462
177 Ga0495667_0003248 3300046559 Bacteria 10900
178 Ga0495667_0060174 3300046559 Bacteria 2491
179 Ga0495668_0053317 3300046616 Bacteria 2236
180 Ga0495625_0126312 3300046660 Bacteria 1736
181 Ga0495625_0253791 3300046660 Bacteria 1141
182 Ga0495635_0103643 3300046663 Bacteria 1944
183 Ga0495657_0009405 3300046675 Bacteria 7408
184 Ga0495657_0018031 3300046675 Bacteria 5117
185 Ga0495623_0020624 3300046679 Bacteria 4259
186 Ga0495646_0118473 3300046680 Bacteria 1500
187 Ga0495646_0184829 3300046680 Bacteria 1142
188 Ga0495669_0087925 3300046684 Bacteria 1432
189 Ga0495624_0031941 3300046690 Bacteria 3417
190 Ga0495600_0022580 3300046809 Bacteria 4041
191 Ga0495604_0003838 3300047317 Bacteria 11970
192 Ga0495604_0008833 3300047317 Bacteria 7964
193 Ga0495680_0005498 3300047322 Bacteria 11904
194 Ga0495683_0054126 3300047323 Bacteria 2001
195 Ga0495687_003427 3300047443 Bacteria 11505
196 Ga0495681_0053896 3300047470 Bacteria 1881
197 Ga0495684_0154428 3300047471 Bacteria 1715
198 Ga0495686_0147409 3300047472 Bacteria 1384
199 Ga0495686_0187820 3300047472 Bacteria 1193
200 Ga0495602_0048249 3300048088 Bacteria 3829
201 Ga0495602_0427642 3300048088 Bacteria 939
202 Ga0496102_0028176 3300048905 Bacteria 5017
203 Ga0496104_0098874 3300048907 Bacteria 2793
204 Ga0496104_0110940 3300048907 Bacteria 2630
205 Ga0496105_0024595 3300048908 Bacteria 4894
206 Ga0496109_0118364 3300048912 Bacteria 2466
207 Ga0496111_0031797 3300048914 Bacteria 3761
208 Ga0496112_0035576 3300048915 Bacteria 4852
209 Ga0496115_0327972 3300048918 Bacteria 1251
210 Ga0496116_0034878 3300048919 Bacteria 3541
211 Ga0496118_0038114 3300048921 Bacteria 3857
212 Ga0496119_0015989 3300048922 Bacteria 5736
213 Ga0496121_0008650 3300048924 Bacteria 11904
214 Ga0496121_0022215 3300048924 Bacteria 6170
215 Ga0496122_0000184 3300048925 Bacteria 144437
216 Ga0496122_0059512 3300048925 Bacteria 2820
217 Ga0496122_0084496 3300048925 Bacteria 2195
218 Ga0496123_0000738 3300048926 Bacteria 52962
219 Ga0496124_0032695 3300048927 Bacteria 4588
220 Ga0496125_0005052 3300048928 Bacteria 14882
221 Ga0496125_0011362 3300048928 Bacteria 8914
222 Ga0496125_0038222 3300048928 Bacteria 4159
223 Ga0496126_0100612 3300048929 Bacteria 2530
224 Ga0496126_0296884 3300048929 Bacteria 1334
225 Ga0501043_0022207 3300049579 Bacteria 4978
226 Ga0501035_0087220 3300049822 Bacteria 2750
227 nmdc:mga03n38_128835_c1 3300050490 Bacteria 1252
228 nmdc:mga00v17_109927_c1 3300050491 Bacteria 1748
229 nmdc:mga0k408_70259_c1 3300050493 Bacteria 2044
230 nmdc:mga07m45_36995_c1 3300050496 Bacteria 2722
231 nmdc:mga05p37_19320_c1 3300050507 Bacteria 8242
232 nmdc:mga05p37_3465_c1 3300050507 Bacteria 18430
233 nmdc:mga05p37_565154_c1 3300050507 Unclassified 1291
234 nmdc:mga05p37_83451_c1 3300050507 Bacteria 3936
235 nmdc:mga09592_61647_c1 3300050508 Bacteria 3172
236 nmdc:mga06r32_20979_c1 3300050510 Bacteria 6025
237 nmdc:mga06r32_46346_c1 3300050510 Bacteria 4148
238 nmdc:mga08y16_122828_c1 3300050511 Unclassified 2702
239 nmdc:mga0n895_41766_c1 3300050512 Bacteria 4460
240 nmdc:mga0n895_4605_c1 3300050512 Bacteria 11365
241 nmdc:mga0rr50_54709_c1 3300050513 Bacteria 2975
242 nmdc:mga08x19_17863_c1 3300050514 Bacteria 4343
243 nmdc:mga0a205_2972_c1 3300050515 Bacteria 15041
244 nmdc:mga0a205_303435_c1 3300050515 Bacteria 1469
245 nmdc:mga0a205_80159_c1 3300050515 Bacteria 3155
246 nmdc:mga0sz30_70504_c1 3300050516 Bacteria 1504
247 Ga0495601_0190913 3300053077 Bacteria 1339
248 Ga0495595_0076816 3300053084 Bacteria 1586
249 Ga0495619_0031216 3300053085 Bacteria 3451
250 Ga0500643_004762 3300053087 Bacteria 6015
251 Ga0500646_0012922 3300053090 Bacteria 2160
252 Ga0500646_0014415 3300053090 Bacteria 2052
253 Ga0500647_0019678 3300053091 Bacteria 3136
254 Ga0500583_0065753 3300053092 Bacteria 1723
255 Ga0500566_0005931 3300053094 Bacteria 7263
256 Ga0500566_0151336 3300053094 Bacteria 1220
257 Ga0500641_0007564 3300053096 Bacteria 3874
258 Ga0500641_0070500 3300053096 Bacteria 1470
259 Ga0500650_0067433 3300053098 Bacteria 1672
260 Ga0500557_000019 3300053105 Bacteria 93216
261 Ga0500572_003735 3300053111 Bacteria 3456
262 Ga0500594_0024548 3300053118 Bacteria 1537
263 Ga0500595_002052 3300053119 Bacteria 10289
264 Ga0500595_002500 3300053119 Bacteria 9090
265 Ga0500618_000400 3300053125 Bacteria 29831
266 Ga0500618_004902 3300053125 Bacteria 4158
267 Ga0500618_054066 3300053125 Bacteria 906
268 Ga0500642_0000087 3300053130 Bacteria 48287
269 Ga0500658_0019432 3300053134 Bacteria 2557
270 Ga0500658_0019758 3300053134 Bacteria 2538
271 Ga0500559_0002363 3300053136 Bacteria 9837
272 Ga0500559_0004560 3300053136 Bacteria 6553
273 Ga0500568_0035184 3300053139 Bacteria 2045
274 Ga0500577_0000122 3300053142 Bacteria 18843
275 Ga0500585_064438 3300053144 Bacteria 1320
276 Ga0500588_0030341 3300053146 Bacteria 1550
277 Ga0500589_099135 3300053147 Bacteria 1268
278 Ga0500622_0042204 3300053156 Bacteria 2371
279 Ga0500627_0109013 3300053158 Bacteria 1246
280 Ga0500627_0111399 3300053158 Bacteria 1232
281 Ga0500634_0014619 3300053161 Bacteria 4145
282 Ga0500636_0000168 3300053177 Bacteria 34492
283 Ga0500599_001334 3300053736 Bacteria 2823
284 Ga0500601_001059 3300053737 Bacteria 3123
285 Ga0500661_009579 3300055283 Bacteria 1772
286 2511395057 2511231028 Bacteria 8046582
287 2513590282 2513237087 Bacteria 5817514
288 2739791725 2739367756 Bacteria 4553612
289 2842737451 2842733646 Bacteria 5716726
290 2855731369 2855730933 Bacteria 7047938
291 2855768075 2855767633 Bacteria 7049357
292 2874629292 2874628541 Bacteria 8630250
293 2904547774 2904541872 Bacteria 8915136
294 2929166985 2929160207 Bacteria 9075316
295 2935964025 2935959822 Bacteria 7869783
296 3005711552 3005710791 Bacteria 7622528
297 8016587006 8016583857 Bacteria 10421953
298 8018150574 8018150411 Bacteria 5549903
299 Ga0070699_100124758
300 JGI25151J46595_10038080
301 Ga0070658_10089654
302 Ga0070670_100208317
303 Ga0070670_100313202
304 Ga0068869_100157801
305 Ga0070680_100144262
306 Ga0070689_100376362
307 Ga0070668_100067852
308 Ga0070713_100284332
309 Ga0070710_10020872
310 Ga0070710_10065023
311 Ga0070705_100049729
312 Ga0070708_100114628
313 Ga0070706_100010475
314 Ga0070706_100138132
315 Ga0070707_100235554
316 Ga0070698_100002091
317 Ga0070698_100043416
318 Ga0070699_100200501
319 Ga0070697_100100923
320 Ga0068853_100303399
321 Ga0070696_100296639
322 Ga0070696_100427085
323 Ga0070665_100133877
324 Ga0070665_100161241
325 Ga0068855_100246376
326 Ga0068857_100088068
327 Ga0068864_100231953
328 Ga0068864_100389177
329 Ga0068861_100169202
330 Ga0081455_10104603
331 Ga0081540_1007113
332 Ga0070717_10124782
333 Ga0075365_10058693
334 Ga0075368_10007310
335 Ga0075363_100008792
336 Ga0075364_10005111
337 Ga0075364_10182292
338 Ga0070716_100102906
339 Ga0070712_100218815
340 Ga0075362_10033352
341 Ga0075362_10103643
342 Ga0075369_10037571
343 Ga0075366_10015336
344 Ga0075366_10063852
345 Ga0075370_10037101
346 Ga0075428_100029777
347 Ga0075431_100004420
348 Ga0075431_100317131
349 Ga0075433_10001898
350 Ga0075434_100013813
351 Ga0075434_100132278
352 Ga0075429_100104390
353 Ga0075436_100013463
354 Ga0075435_100014603
355 Ga0075435_100065760
356 Ga0105240_10206717
357 Ga0105240_10282063
358 Ga0105247_10107615
359 Ga0114129_10000722
360 Ga0114129_10009937
361 Ga0114129_10100569
362 Ga0105241_10040169
363 Ga0105242_10654002
364 Ga0105248_10028807
365 Ga0105237_10083851
366 Ga0105238_10007744
367 Ga0157374_10049623
368 Ga0157372_10258010
369 Ga0163163_10229953
370 Ga0157380_10117825
371 Ga0213875_10000944
372 Ga0209025_1000382
373 Ga0209758_1010417
374 Ga0209257_1023224
375 Ga0207697_10011928
376 Ga0207647_10004275
377 Ga0207699_10162922
378 Ga0207705_10219050
379 Ga0207684_10280290
380 Ga0207671_10154556
381 Ga0207693_10070199
382 Ga0207693_10168703
383 Ga0207657_10171251
384 Ga0207646_10122491
385 Ga0207694_10092163
386 Ga0207694_10155903
387 Ga0207650_10303625
388 Ga0207650_10375840
389 Ga0207700_10022812
390 Ga0207700_10065725
391 Ga0207664_10043832
392 Ga0207706_10226116
393 Ga0207665_10008975
394 Ga0207665_10131711
395 Ga0207661_10064149
396 Ga0207668_10048055
397 Ga0207703_10153848
398 Ga0207639_10433563
399 Ga0207678_10081529
400 Ga0207678_10399788
401 Ga0207674_10151374
402 Ga0207675_100078335
403 Ga0207683_10356397
404 Ga0209971_1044884
405 Ga0209974_10020878
406 Ga0268266_10299881
407 Ga0268264_10356615
408 Ga0265323_10001849
409 Ga0265322_10044714
410 Ga0265336_10000362
411 Ga0265338_10001385
412 Ga0265324_10007008
413 Ga0265320_10008275
414 Ga0265325_10012115
415 Ga0265329_10031825
416 Ga0265340_10000367
417 Ga0265340_10044905
418 Ga0265339_10004754
419 Ga0265327_10035914
420 Ga0265316_10023070
421 Ga0307513_10096291
422 Ga0307408_100004412
423 Ga0265313_10002718
424 Ga0265313_10033423
425 Ga0265314_10143551
426 Ga0265342_10005087
427 Ga0265342_10060129
428 Ga0307405_10002072
429 Ga0307405_10028547
430 Ga0307405_10165284
431 Ga0307410_10007047
432 Ga0307410_10110489
433 Ga0307407_10014156
434 Ga0307412_10012122
435 Ga0307409_100005071
436 Ga0307416_100004945
437 Ga0307414_10141353
438 Ga0307411_10011704
439 Ga0307411_10024252
440 Ga0307415_100005679
441 Ga0307507_10067723
442 Ga0307510_10007621
443 Ga0373932_0016734
444 Ga0373954_0021128
445 Ga0373935_0177974
446 Ga0373933_0007562
447 Ga0436364_0080442
448 Ga0436364_0239376
449 Ga0436365_1829173
450 Ga0436361_0559550
451 Ga0436361_1134895
452 Ga0450911_000234
453 Ga0495592_0115139
454 Ga0495629_0018866
455 Ga0495638_0007636
456 Ga0495638_0015865
457 Ga0495638_0059106
458 Ga0495651_0001791
459 Ga0495651_0067110
460 Ga0495651_0097666
461 Ga0495653_0101859
462 Ga0495662_0047561
463 Ga0495594_0196807
464 Ga0495606_0059517
465 Ga0495606_0129548
466 Ga0495608_0301803
467 Ga0495628_0105483
468 Ga0495643_0005934
469 Ga0495643_0108716
470 Ga0495648_0002080
471 Ga0495587_0133422
472 Ga0495597_0009832
473 Ga0495645_0163683
474 Ga0495622_0031859
475 Ga0495667_0003248
476 Ga0495667_0060174
477 Ga0495668_0053317
478 Ga0495625_0126312
479 Ga0495625_0253791
480 Ga0495635_0103643
481 Ga0495657_0009405
482 Ga0495657_0018031
483 Ga0495623_0020624
484 Ga0495646_0118473
485 Ga0495646_0184829
486 Ga0495669_0087925
487 Ga0495624_0031941
488 Ga0495600_0022580
489 Ga0495604_0003838
490 Ga0495604_0008833
491 Ga0495680_0005498
492 Ga0495683_0054126
493 Ga0495687_003427
494 Ga0495681_0053896
495 Ga0495684_0154428
496 Ga0495686_0147409
497 Ga0495686_0187820
498 Ga0495602_0048249
499 Ga0495602_0427642
500 Ga0496102_0028176
501 Ga0496104_0098874
502 Ga0496104_0110940
503 Ga0496105_0024595
504 Ga0496109_0118364
505 Ga0496111_0031797
506 Ga0496112_0035576
507 Ga0496115_0327972
508 Ga0496116_0034878
509 Ga0496118_0038114
510 Ga0496119_0015989
511 Ga0496121_0008650
512 Ga0496121_0022215
513 Ga0496122_0000184
514 Ga0496122_0059512
515 Ga0496122_0084496
516 Ga0496123_0000738
517 Ga0496124_0032695
518 Ga0496125_0005052
519 Ga0496125_0011362
520 Ga0496125_0038222
521 Ga0496126_0100612
522 Ga0496126_0296884
523 Ga0501043_0022207
524 Ga0501035_0087220
525 nmdc:mga03n38_128835_c1
526 nmdc:mga00v17_109927_c1
527 nmdc:mga0k408_70259_c1
528 nmdc:mga07m45_36995_c1
529 nmdc:mga05p37_19320_c1
530 nmdc:mga05p37_3465_c1
531 nmdc:mga05p37_565154_c1
532 nmdc:mga05p37_83451_c1
533 nmdc:mga09592_61647_c1
534 nmdc:mga06r32_20979_c1
535 nmdc:mga06r32_46346_c1
536 nmdc:mga08y16_122828_c1
537 nmdc:mga0n895_41766_c1
538 nmdc:mga0n895_4605_c1
539 nmdc:mga0rr50_54709_c1
540 nmdc:mga08x19_17863_c1
541 nmdc:mga0a205_2972_c1
542 nmdc:mga0a205_303435_c1
543 nmdc:mga0a205_80159_c1
544 nmdc:mga0sz30_70504_c1
545 Ga0495601_0190913
546 Ga0495595_0076816
547 Ga0495619_0031216
548 Ga0500643_004762
549 Ga0500646_0012922
550 Ga0500646_0014415
551 Ga0500647_0019678
552 Ga0500583_0065753
553 Ga0500566_0005931
554 Ga0500566_0151336
555 Ga0500641_0007564
556 Ga0500641_0070500
557 Ga0500650_0067433
558 Ga0500557_000019
559 Ga0500572_003735
560 Ga0500594_0024548
561 Ga0500595_002052
562 Ga0500595_002500
563 Ga0500618_000400
564 Ga0500618_004902
565 Ga0500618_054066
566 Ga0500642_0000087
567 Ga0500658_0019432
568 Ga0500658_0019758
569 Ga0500559_0002363
570 Ga0500559_0004560
571 Ga0500568_0035184
572 Ga0500577_0000122
573 Ga0500585_064438
574 Ga0500588_0030341
575 Ga0500589_099135
576 Ga0500622_0042204
577 Ga0500627_0109013
578 Ga0500627_0111399
579 Ga0500634_0014619
580 Ga0500636_0000168
581 Ga0500599_001334
582 Ga0500601_001059
583 Ga0500661_009579
584 2511395057
585 2513590282
586 2739791725
587 2842737451
588 2855731369
589 2855768075
590 2874629292
591 2904547774
592 2929166985
593 2935964025
594 3005711552
595 8016587006
596 8018150574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

66

183

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z7a-assembly1.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9347 13 300
3s6o-assembly1.cif.gz_D crystal structure of a polysaccharide deacetylase family protein from burkholderia pseudomallei 0.9302 9 301
3cl6-assembly1.cif.gz_A crystal structure of puue allantoinase 0.9281 11 300
1z7a-assembly1.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8958 13 300
3s6o-assembly1.cif.gz_D crystal structure of a polysaccharide deacetylase family protein from burkholderia pseudomallei 0.8921 9 301
ID Description Score Start End Superfamily
af_O13842_2_320_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9237 11 303 3.20.20.370
1z7aC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.9144 13 300 3.20.20.370
1z7aC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8932 13 300 3.20.20.370
af_O13842_2_320_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8778 11 303 3.20.20.370
3rxzD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8397 23 300 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A292YRL2-F1-model_v4 Urate oxidase (EC 1.7.3.3) 0.9705 75 305 GO:0004846
GO:0005975
GO:0016810
AF-A0A349SGB1-F1-model_v4 Allantoinase 0.9682 108 300 GO:0005975
GO:0016810
AF-A0A7V8HGY1-F1-model_v4 deleted 0.9666 123 301
AF-A0A258CVS7-F1-model_v4 Chitooligosaccharide deacetylase (Nodulation protein B) 0.9652 12 300 GO:0005886
GO:0005975
GO:0016810
GO:0055085
AF-A0A7V5DA36-F1-model_v4 Polysaccharide deacetylase family protein 0.9612 86 168 GO:0005975
GO:0016810

Map