F393787

General Info

Members Datasets Scaffolds Average Seq Length
297 182 594 212

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0089695|Ga0316574_0089695_474_1169
Length 231
Sequence MATIMIICCDFFRLSCHPVKEKIVPVHEIKHPLVRHKLGLMRRNDLSTKDFRELASEIARLLTYEATSDLETEKETIDGWAGKVSVDTIKGKKVTVVPILRAGLGMMDGVLDMIPNARVSVIGLYRNEKTLEPVAYYKKFTGRIEDRTAMILDPMLATGGSVIAAIDMLKESGCKNIKGLFLVAAPEGIAALQEKHPDVDIYVASIDEKLNEAGYILPGLGDAGDKIFGTK

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
110 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
111 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
114 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
115 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
116 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
117 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
122 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
126 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
129 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
130 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
131 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
132 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
135 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
136 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
137 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
138 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
139 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 2547132512 Azospira oryzae 6a3 Isolate Unclassified
182 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 0.67
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.4
Rhizosphere 90.24
Stem 0
Stem Tuber 0
Unclassified 13.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0089695 3300035398 Bacteria 1959
2 MBSR1b_contig_1136788 2162886012 Unclassified 1625
3 Ga0065707_10085419 3300005295 Bacteria 6172
4 Ga0070658_10106163 3300005327 Bacteria 2323
5 Ga0070658_10367975 3300005327 Bacteria 1232
6 Ga0070676_10146281 3300005328 Bacteria 1509
7 Ga0070683_100027742 3300005329 Bacteria 5110
8 Ga0070683_100115343 3300005329 Bacteria 2536
9 Ga0070683_100712905 3300005329 Bacteria 961
10 Ga0070680_100010263 3300005336 Bacteria 7219
11 Ga0070680_100084174 3300005336 Unclassified 2627
12 Ga0070680_100107193 3300005336 Bacteria 2324
13 Ga0070680_100174288 3300005336 Bacteria 1810
14 Ga0070680_100312636 3300005336 Bacteria 1333
15 Ga0068868_100121044 3300005338 Bacteria 2135
16 Ga0070660_100078954 3300005339 Bacteria 2581
17 Ga0070689_100014992 3300005340 Bacteria 5643
18 Ga0070689_100314690 3300005340 Unclassified 1306
19 Ga0070687_100038703 3300005343 Bacteria 2392
20 Ga0070661_100031625 3300005344 Bacteria 3828
21 Ga0070669_100106159 3300005353 Bacteria 2125
22 Ga0070675_100051387 3300005354 Bacteria 3387
23 Ga0070671_100197851 3300005355 Bacteria 1704
24 Ga0070673_100008831 3300005364 Bacteria 6730
25 Ga0070688_100128317 3300005365 Bacteria 1707
26 Ga0070659_100116403 3300005366 Bacteria 2161
27 Ga0070667_100029406 3300005367 Bacteria 4577
28 Ga0070667_100079116 3300005367 Bacteria 2810
29 Ga0070709_10003064 3300005434 Bacteria 8977
30 Ga0070714_100012161 3300005435 Bacteria 6859
31 Ga0070714_100019756 3300005435 Bacteria 5494
32 Ga0070710_10082741 3300005437 Bacteria 1877
33 Ga0070700_100046424 3300005441 Unclassified 2683
34 Ga0070694_100153428 3300005444 Unclassified 1684
35 Ga0070708_100008635 3300005445 Bacteria 8188
36 Ga0070663_100241000 3300005455 Bacteria 1427
37 Ga0070678_100072841 3300005456 Bacteria 2576
38 Ga0070681_10075031 3300005458 Bacteria 3342
39 Ga0070681_10209870 3300005458 Bacteria 1864
40 Ga0068867_100129481 3300005459 Bacteria 1959
41 Ga0070685_10013596 3300005466 Bacteria 4297
42 Ga0070706_100000287 3300005467 Bacteria 61228
43 Ga0070707_100006618 3300005468 Bacteria 10742
44 Ga0070698_100225983 3300005471 Bacteria 1805
45 Ga0070679_100005218 3300005530 Bacteria 12024
46 Ga0070679_100066996 3300005530 Bacteria 3580
47 Ga0070679_100107636 3300005530 Bacteria 2773
48 Ga0070679_100389962 3300005530 Bacteria 1339
49 Ga0070679_100504765 3300005530 Bacteria 1153
50 Ga0070679_100891983 3300005530 Bacteria 833
51 Ga0070684_100061558 3300005535 Bacteria 3285
52 Ga0070697_100004729 3300005536 Bacteria 10433
53 Ga0070697_100511842 3300005536 Bacteria 1050
54 Ga0070672_100071606 3300005543 Bacteria 2758
55 Ga0070686_100030917 3300005544 Bacteria 3270
56 Ga0070696_100105907 3300005546 Unclassified 2021
57 Ga0070696_100170836 3300005546 Bacteria 1607
58 Ga0070696_100407667 3300005546 Bacteria 1065
59 Ga0070693_100043179 3300005547 Unclassified 2545
60 Ga0070704_100125953 3300005549 Unclassified 1976
61 Ga0068855_100203731 3300005563 Bacteria 2226
62 Ga0068855_100263037 3300005563 Bacteria 1921
63 Ga0068855_100683032 3300005563 Bacteria 1100
64 Ga0070664_100038922 3300005564 Bacteria 4004
65 Ga0068856_100559093 3300005614 Unclassified 1165
66 Ga0068852_100038204 3300005616 Bacteria 4033
67 Ga0068859_100044726 3300005617 Bacteria 4448
68 Ga0068859_100106823 3300005617 Unclassified 2858
69 Ga0068859_100122299 3300005617 Bacteria 2670
70 Ga0068863_100365714 3300005841 Bacteria 1407
71 Ga0068858_100094911 3300005842 Bacteria 2779
72 Ga0068860_100225310 3300005843 Unclassified 1821
73 Ga0068860_100242631 3300005843 Bacteria 1753
74 Ga0068862_100226913 3300005844 Bacteria 1693
75 Ga0068862_100452437 3300005844 Unclassified 1211
76 Ga0081455_10261666 3300005937 Bacteria 1259
77 Ga0068871_100096281 3300006358 Bacteria 2472
78 Ga0075428_100062883 3300006844 Bacteria 4063
79 Ga0075428_101003729 3300006844 Bacteria 883
80 Ga0075433_10615164 3300006852 Bacteria 953
81 Ga0075434_100034422 3300006871 Bacteria 5002
82 Ga0075434_100319623 3300006871 Bacteria 1573
83 Ga0075434_100459672 3300006871 Unclassified 1294
84 Ga0075434_100522485 3300006871 Bacteria 1207
85 Ga0075429_100009906 3300006880 Bacteria 8261
86 Ga0068865_100048066 3300006881 Bacteria 2935
87 Ga0075436_100510325 3300006914 Unclassified 880
88 Ga0097620_100044726 3300006931 Bacteria 4448
89 Ga0097620_100106829 3300006931 Unclassified 2858
90 Ga0097620_100122301 3300006931 Bacteria 2670
91 Ga0075435_100169736 3300007076 Bacteria 1840
92 Ga0075435_100598778 3300007076 Bacteria 956
93 Ga0105247_10074067 3300009101 Bacteria 2135
94 Ga0114129_10191911 3300009147 Bacteria 2773
95 Ga0105243_10542070 3300009148 Bacteria 1110
96 Ga0105242_10193734 3300009176 Bacteria 1801
97 Ga0105248_10091126 3300009177 Bacteria 3434
98 Ga0105249_10063964 3300009553 Bacteria 3381
99 Ga0105249_10448737 3300009553 Unclassified 1328
100 Ga0105239_10004657 3300010375 Bacteria 16311
101 Ga0157371_10097917 3300013102 Bacteria 2079
102 Ga0157372_10640783 3300013307 Bacteria 1238
103 Ga0157375_10004907 3300013308 Bacteria 11629
104 Ga0157375_10051625 3300013308 Bacteria 4039
105 Ga0157376_10701823 3300014969 Bacteria 1017
106 Ga0163161_10093509 3300017792 Bacteria 2228
107 Ga0213876_10022743 3300021384 Bacteria 3313
108 Ga0207680_10192975 3300025903 Bacteria 1384
109 Ga0207699_10003519 3300025906 Bacteria 7471
110 Ga0207645_10121072 3300025907 Bacteria 1698
111 Ga0207705_10182327 3300025909 Bacteria 1585
112 Ga0207684_10098765 3300025910 Bacteria 2493
113 Ga0207707_10104480 3300025912 Bacteria 2475
114 Ga0207707_10110807 3300025912 Bacteria 2399
115 Ga0207707_10453430 3300025912 Bacteria 1097
116 Ga0207660_10013447 3300025917 Bacteria 5364
117 Ga0207660_10148738 3300025917 Bacteria 1798
118 Ga0207660_10224629 3300025917 Unclassified 1475
119 Ga0207662_10019044 3300025918 Bacteria 3901
120 Ga0207657_10050334 3300025919 Bacteria 3626
121 Ga0207652_10004136 3300025921 Bacteria 11841
122 Ga0207652_10029728 3300025921 Bacteria 4571
123 Ga0207652_10077935 3300025921 Bacteria 2893
124 Ga0207652_10142204 3300025921 Bacteria 2146
125 Ga0207652_10497970 3300025921 Bacteria 1097
126 Ga0207646_10040416 3300025922 Bacteria 4193
127 Ga0207681_10068776 3300025923 Bacteria 2461
128 Ga0207687_10082331 3300025927 Bacteria 2328
129 Ga0207664_10005873 3300025929 Bacteria 8395
130 Ga0207686_10037768 3300025934 Bacteria 2917
131 Ga0207670_10073695 3300025936 Unclassified 2368
132 Ga0207704_10053278 3300025938 Bacteria 2458
133 Ga0207691_10033793 3300025940 Bacteria 4761
134 Ga0207661_10078404 3300025944 Bacteria 2719
135 Ga0207679_10013732 3300025945 Bacteria 5311
136 Ga0207667_10217630 3300025949 Bacteria 1957
137 Ga0207667_11061221 3300025949 Bacteria 795
138 Ga0207712_10071570 3300025961 Bacteria 2494
139 Ga0207668_10266729 3300025972 Bacteria 1398
140 Ga0207658_10046806 3300025986 Bacteria 3161
141 Ga0207658_10108204 3300025986 Bacteria 2192
142 Ga0207677_10127409 3300026023 Bacteria 1926
143 Ga0207678_10278088 3300026067 Bacteria 1436
144 Ga0207678_10324432 3300026067 Bacteria 1325
145 Ga0207702_10432672 3300026078 Unclassified 1274
146 Ga0207641_10280157 3300026088 Bacteria 1568
147 Ga0207648_10046565 3300026089 Bacteria 3803
148 Ga0207675_100607942 3300026118 Bacteria 1097
149 Ga0207683_10068078 3300026121 Bacteria 3142
150 Ga0207698_10284863 3300026142 Bacteria 1530
151 Ga0207698_10548256 3300026142 Bacteria 1133
152 Ga0268266_10200769 3300028379 Bacteria 1825
153 Ga0268265_10050092 3300028380 Bacteria 3145
154 Ga0268265_10063346 3300028380 Bacteria 2844
155 Ga0268264_10046122 3300028381 Bacteria 3620
156 Ga0265323_10020673 3300028653 Bacteria 2533
157 Ga0316182_1420004 3300030745 Bacteria 3335
158 Ga0265332_10000021 3300031238 Bacteria 217090
159 Ga0307408_101053081 3300031548 Bacteria 752
160 Ga0316575_10062684 3300031665 Unclassified 1487
161 Ga0316579_10006060 3300031691 Bacteria 4914
162 Ga0316576_10037010 3300031727 Bacteria 3491
163 Ga0316576_10106988 3300031727 Bacteria 2095
164 Ga0316576_10478208 3300031727 Unclassified 918
165 Ga0316576_10550527 3300031727 Unclassified 845
166 Ga0316578_10018365 3300031728 Bacteria 3831
167 Ga0316578_10023736 3300031728 Bacteria 3434
168 Ga0316578_10122430 3300031728 Bacteria 1564
169 Ga0316578_10134966 3300031728 Bacteria 1486
170 Ga0316577_10018540 3300031733 Bacteria 3849
171 Ga0316577_10086624 3300031733 Unclassified 1753
172 Ga0316577_10147706 3300031733 Bacteria 1325
173 Ga0316577_10149584 3300031733 Bacteria 1316
174 Ga0316577_10287236 3300031733 Unclassified 931
175 Ga0307410_10032400 3300031852 Bacteria 3363
176 Ga0307412_10133024 3300031911 Bacteria 1810
177 Ga0307414_10049011 3300032004 Bacteria 2918
178 Ga0307414_10211713 3300032004 Bacteria 1585
179 Ga0316580_10090572 3300032139 Unclassified 936
180 Ga0316593_10073408 3300032168 Bacteria 1186
181 Ga0373940_0019403 3300035088 Bacteria 1718
182 Ga0316574_0179138 3300035398 Bacteria 1364
183 Ga0373933_0474429 3300035724 Bacteria 819
184 Ga0316582_0000448 3300036647 Bacteria 15185
185 Ga0316582_0025818 3300036647 Bacteria 3531
186 Ga0316582_0169407 3300036647 Bacteria 1482
187 Ga0316582_0221135 3300036647 Unclassified 1295
188 Ga0316582_0390918 3300036647 Unclassified 958
189 Ga0316584_0032981 3300036712 Bacteria 3833
190 Ga0316584_0051546 3300036712 Bacteria 3077
191 Ga0316584_0055254 3300036712 Bacteria 2973
192 Ga0316584_0109991 3300036712 Unclassified 2062
193 Ga0316584_0250358 3300036712 Bacteria 1294
194 Ga0316584_0425075 3300036712 Bacteria 943
195 Ga0316584_0427538 3300036712 Bacteria 940
196 Ga0316584_0474617 3300036712 Bacteria 882
197 Ga0395900_0284352 3300037418 Bacteria 1645
198 Ga0316581_0020523 3300037588 Bacteria 1935
199 Ga0316581_0095782 3300037588 Bacteria 914
200 Ga0400490_02026 3300038726 Bacteria 7080
201 Ga0400490_50260 3300038726 Bacteria 3073
202 Ga0400488_32152 3300038741 Bacteria 8527
203 Ga0400483_101302 3300039062 Bacteria 1258
204 Ga0400483_130467 3300039062 Unclassified 2286
205 Ga0400489_10334 3300039093 Bacteria 3107
206 Ga0436365_0664906 3300039437 Bacteria 3876
207 Ga0439439_0048524 3300041406 Bacteria 1110
208 Ga0439448_0053577 3300042005 Bacteria 1324
209 Ga0439455_0055079 3300042012 Bacteria 1045
210 Ga0439446_0047401 3300042156 Bacteria 1278
211 Ga0439458_0062041 3300042157 Bacteria 934
212 Ga0439434_0109410 3300042435 Bacteria 894
213 Ga0451577_0001399 3300042876 Bacteria 32342
214 Ga0451577_0033123 3300042876 Unclassified 4657
215 Ga0451577_0385155 3300042876 Bacteria 1273
216 Ga0453683_0000425 3300044673 Bacteria 48453
217 Ga0453683_0048473 3300044673 Bacteria 2664
218 Ga0453683_0076169 3300044673 Bacteria 2100
219 Ga0453683_0102003 3300044673 Bacteria 1802
220 Ga0466966_0002137 3300044684 Bacteria 12813
221 Ga0466966_0014456 3300044684 Bacteria 5225
222 Ga0466961_0020451 3300044693 Bacteria 4259
223 Ga0466961_0238064 3300044693 Bacteria 1119
224 Ga0453684_0006877 3300044712 Bacteria 21353
225 Ga0453684_0007290 3300044712 Bacteria 20464
226 Ga0453684_0011598 3300044712 Bacteria 14729
227 Ga0453684_0022716 3300044712 Bacteria 9291
228 Ga0453684_0029110 3300044712 Bacteria 7856
229 Ga0453684_0046982 3300044712 Bacteria 5732
230 Ga0453684_0059366 3300044712 Bacteria 4932
231 Ga0453684_0066633 3300044712 Bacteria 4584
232 Ga0453684_0073925 3300044712 Bacteria 4295
233 Ga0453684_0136683 3300044712 Bacteria 2933
234 Ga0453684_0189877 3300044712 Bacteria 2404
235 Ga0453684_0208076 3300044712 Bacteria 2276
236 Ga0453684_0242908 3300044712 Bacteria 2072
237 Ga0453684_0302683 3300044712 Bacteria 1817
238 Ga0453684_0305144 3300044712 Bacteria 1808
239 Ga0453684_0563175 3300044712 Bacteria 1254
240 Ga0453684_0584158 3300044712 Bacteria 1226
241 Ga0453684_1493909 3300044712 Bacteria 697
242 Ga0466959_0017143 3300045049 Bacteria 5305
243 Ga0466959_0083006 3300045049 Bacteria 2308
244 Ga0466959_0373471 3300045049 Bacteria 971
245 Ga0451576_0002123 3300045051 Bacteria 30811
246 Ga0451576_0038590 3300045051 Bacteria 5054
247 Ga0451576_0708210 3300045051 Bacteria 1058
248 Ga0451576_1030610 3300045051 Bacteria 862
249 Ga0466958_0102752 3300045836 Bacteria 1779
250 Ga0466967_0088488 3300045976 Unclassified 2810
251 Ga0495580_0066850 3300046472 Bacteria 2516
252 Ga0495594_0065736 3300046499 Bacteria 2011
253 Ga0496101_0053246 3300048904 Unclassified 2919
254 Ga0496102_0005217 3300048905 Bacteria 11033
255 Ga0496103_0005482 3300048906 Bacteria 7588
256 Ga0496104_0027173 3300048907 Bacteria 5294
257 Ga0496104_0190032 3300048907 Bacteria 1965
258 Ga0496105_0079231 3300048908 Unclassified 2713
259 Ga0496106_0192433 3300048909 Unclassified 1622
260 Ga0496107_0103294 3300048910 Unclassified 2091
261 Ga0496108_0010800 3300048911 Bacteria 7413
262 Ga0496108_0042256 3300048911 Bacteria 3805
263 Ga0496109_0327729 3300048912 Unclassified 1445
264 Ga0496109_0748026 3300048912 Bacteria 915
265 Ga0496110_0002609 3300048913 Bacteria 13561
266 Ga0496110_0017708 3300048913 Bacteria 5960
267 Ga0496111_0107779 3300048914 Bacteria 2051
268 Ga0496112_0034938 3300048915 Bacteria 4892
269 Ga0496113_0001277 3300048916 Bacteria 13883
270 Ga0496114_0376924 3300048917 Bacteria 1256
271 Ga0496115_0221012 3300048918 Unclassified 1563
272 Ga0501033_0014927 3300049570 Bacteria 5897
273 Ga0501067_0063901 3300049583 Bacteria 2038
274 Ga0501067_0085082 3300049583 Bacteria 1755
275 Ga0501069_0130082 3300049585 Bacteria 1441
276 Ga0501070_0269377 3300049586 Bacteria 1391
277 Ga0501071_0907939 3300049587 Bacteria 680
278 Ga0501073_0435088 3300049589 Bacteria 907
279 Ga0501263_005380 3300049760 Bacteria 1444
280 nmdc:mga05p37_45337_c1 3300050507 Bacteria 5409
281 nmdc:mga05p37_898260_c1 3300050507 Bacteria 955
282 nmdc:mga09592_10371_c1 3300050508 Bacteria 7581
283 nmdc:mga08y16_1047615_c1 3300050511 Bacteria 793
284 nmdc:mga0n895_109738_c1 3300050512 Bacteria 2774
285 nmdc:mga0n895_138083_c1 3300050512 Unclassified 2465
286 nmdc:mga0n895_386487_c1 3300050512 Unclassified 1416
287 nmdc:mga0n895_48811_c1 3300050512 Bacteria 4145
288 nmdc:mga0rr50_367158_c1 3300050513 Unclassified 1212
289 nmdc:mga0rr50_385491_c1 3300050513 Bacteria 1182
290 nmdc:mga08x19_139888_c1 3300050514 Unclassified 1634
291 nmdc:mga08x19_21310_c1 3300050514 Bacteria 3999
292 nmdc:mga08x19_87509_c2 3300050514 Bacteria 1687
293 nmdc:mga0a205_347785_c1 3300050515 Archaea 1350
294 nmdc:mga0a205_612211_c1 3300050515 Bacteria 942
295 Ga0587070_047403 3300059491 Bacteria 845
296 2548847926 2547132512 Bacteria 3416496
297 8007374236 8007371054 Bacteria 4849201
298 Ga0316574_0089695
299 MBSR1b_contig_1136788
300 Ga0065707_10085419
301 Ga0070658_10106163
302 Ga0070658_10367975
303 Ga0070676_10146281
304 Ga0070683_100027742
305 Ga0070683_100115343
306 Ga0070683_100712905
307 Ga0070680_100010263
308 Ga0070680_100084174
309 Ga0070680_100107193
310 Ga0070680_100174288
311 Ga0070680_100312636
312 Ga0068868_100121044
313 Ga0070660_100078954
314 Ga0070689_100014992
315 Ga0070689_100314690
316 Ga0070687_100038703
317 Ga0070661_100031625
318 Ga0070669_100106159
319 Ga0070675_100051387
320 Ga0070671_100197851
321 Ga0070673_100008831
322 Ga0070688_100128317
323 Ga0070659_100116403
324 Ga0070667_100029406
325 Ga0070667_100079116
326 Ga0070709_10003064
327 Ga0070714_100012161
328 Ga0070714_100019756
329 Ga0070710_10082741
330 Ga0070700_100046424
331 Ga0070694_100153428
332 Ga0070708_100008635
333 Ga0070663_100241000
334 Ga0070678_100072841
335 Ga0070681_10075031
336 Ga0070681_10209870
337 Ga0068867_100129481
338 Ga0070685_10013596
339 Ga0070706_100000287
340 Ga0070707_100006618
341 Ga0070698_100225983
342 Ga0070679_100005218
343 Ga0070679_100066996
344 Ga0070679_100107636
345 Ga0070679_100389962
346 Ga0070679_100504765
347 Ga0070679_100891983
348 Ga0070684_100061558
349 Ga0070697_100004729
350 Ga0070697_100511842
351 Ga0070672_100071606
352 Ga0070686_100030917
353 Ga0070696_100105907
354 Ga0070696_100170836
355 Ga0070696_100407667
356 Ga0070693_100043179
357 Ga0070704_100125953
358 Ga0068855_100203731
359 Ga0068855_100263037
360 Ga0068855_100683032
361 Ga0070664_100038922
362 Ga0068856_100559093
363 Ga0068852_100038204
364 Ga0068859_100044726
365 Ga0068859_100106823
366 Ga0068859_100122299
367 Ga0068863_100365714
368 Ga0068858_100094911
369 Ga0068860_100225310
370 Ga0068860_100242631
371 Ga0068862_100226913
372 Ga0068862_100452437
373 Ga0081455_10261666
374 Ga0068871_100096281
375 Ga0075428_100062883
376 Ga0075428_101003729
377 Ga0075433_10615164
378 Ga0075434_100034422
379 Ga0075434_100319623
380 Ga0075434_100459672
381 Ga0075434_100522485
382 Ga0075429_100009906
383 Ga0068865_100048066
384 Ga0075436_100510325
385 Ga0097620_100044726
386 Ga0097620_100106829
387 Ga0097620_100122301
388 Ga0075435_100169736
389 Ga0075435_100598778
390 Ga0105247_10074067
391 Ga0114129_10191911
392 Ga0105243_10542070
393 Ga0105242_10193734
394 Ga0105248_10091126
395 Ga0105249_10063964
396 Ga0105249_10448737
397 Ga0105239_10004657
398 Ga0157371_10097917
399 Ga0157372_10640783
400 Ga0157375_10004907
401 Ga0157375_10051625
402 Ga0157376_10701823
403 Ga0163161_10093509
404 Ga0213876_10022743
405 Ga0207680_10192975
406 Ga0207699_10003519
407 Ga0207645_10121072
408 Ga0207705_10182327
409 Ga0207684_10098765
410 Ga0207707_10104480
411 Ga0207707_10110807
412 Ga0207707_10453430
413 Ga0207660_10013447
414 Ga0207660_10148738
415 Ga0207660_10224629
416 Ga0207662_10019044
417 Ga0207657_10050334
418 Ga0207652_10004136
419 Ga0207652_10029728
420 Ga0207652_10077935
421 Ga0207652_10142204
422 Ga0207652_10497970
423 Ga0207646_10040416
424 Ga0207681_10068776
425 Ga0207687_10082331
426 Ga0207664_10005873
427 Ga0207686_10037768
428 Ga0207670_10073695
429 Ga0207704_10053278
430 Ga0207691_10033793
431 Ga0207661_10078404
432 Ga0207679_10013732
433 Ga0207667_10217630
434 Ga0207667_11061221
435 Ga0207712_10071570
436 Ga0207668_10266729
437 Ga0207658_10046806
438 Ga0207658_10108204
439 Ga0207677_10127409
440 Ga0207678_10278088
441 Ga0207678_10324432
442 Ga0207702_10432672
443 Ga0207641_10280157
444 Ga0207648_10046565
445 Ga0207675_100607942
446 Ga0207683_10068078
447 Ga0207698_10284863
448 Ga0207698_10548256
449 Ga0268266_10200769
450 Ga0268265_10050092
451 Ga0268265_10063346
452 Ga0268264_10046122
453 Ga0265323_10020673
454 Ga0316182_1420004
455 Ga0265332_10000021
456 Ga0307408_101053081
457 Ga0316575_10062684
458 Ga0316579_10006060
459 Ga0316576_10037010
460 Ga0316576_10106988
461 Ga0316576_10478208
462 Ga0316576_10550527
463 Ga0316578_10018365
464 Ga0316578_10023736
465 Ga0316578_10122430
466 Ga0316578_10134966
467 Ga0316577_10018540
468 Ga0316577_10086624
469 Ga0316577_10147706
470 Ga0316577_10149584
471 Ga0316577_10287236
472 Ga0307410_10032400
473 Ga0307412_10133024
474 Ga0307414_10049011
475 Ga0307414_10211713
476 Ga0316580_10090572
477 Ga0316593_10073408
478 Ga0373940_0019403
479 Ga0316574_0179138
480 Ga0373933_0474429
481 Ga0316582_0000448
482 Ga0316582_0025818
483 Ga0316582_0169407
484 Ga0316582_0221135
485 Ga0316582_0390918
486 Ga0316584_0032981
487 Ga0316584_0051546
488 Ga0316584_0055254
489 Ga0316584_0109991
490 Ga0316584_0250358
491 Ga0316584_0425075
492 Ga0316584_0427538
493 Ga0316584_0474617
494 Ga0395900_0284352
495 Ga0316581_0020523
496 Ga0316581_0095782
497 Ga0400490_02026
498 Ga0400490_50260
499 Ga0400488_32152
500 Ga0400483_101302
501 Ga0400483_130467
502 Ga0400489_10334
503 Ga0436365_0664906
504 Ga0439439_0048524
505 Ga0439448_0053577
506 Ga0439455_0055079
507 Ga0439446_0047401
508 Ga0439458_0062041
509 Ga0439434_0109410
510 Ga0451577_0001399
511 Ga0451577_0033123
512 Ga0451577_0385155
513 Ga0453683_0000425
514 Ga0453683_0048473
515 Ga0453683_0076169
516 Ga0453683_0102003
517 Ga0466966_0002137
518 Ga0466966_0014456
519 Ga0466961_0020451
520 Ga0466961_0238064
521 Ga0453684_0006877
522 Ga0453684_0007290
523 Ga0453684_0011598
524 Ga0453684_0022716
525 Ga0453684_0029110
526 Ga0453684_0046982
527 Ga0453684_0059366
528 Ga0453684_0066633
529 Ga0453684_0073925
530 Ga0453684_0136683
531 Ga0453684_0189877
532 Ga0453684_0208076
533 Ga0453684_0242908
534 Ga0453684_0302683
535 Ga0453684_0305144
536 Ga0453684_0563175
537 Ga0453684_0584158
538 Ga0453684_1493909
539 Ga0466959_0017143
540 Ga0466959_0083006
541 Ga0466959_0373471
542 Ga0451576_0002123
543 Ga0451576_0038590
544 Ga0451576_0708210
545 Ga0451576_1030610
546 Ga0466958_0102752
547 Ga0466967_0088488
548 Ga0495580_0066850
549 Ga0495594_0065736
550 Ga0496101_0053246
551 Ga0496102_0005217
552 Ga0496103_0005482
553 Ga0496104_0027173
554 Ga0496104_0190032
555 Ga0496105_0079231
556 Ga0496106_0192433
557 Ga0496107_0103294
558 Ga0496108_0010800
559 Ga0496108_0042256
560 Ga0496109_0327729
561 Ga0496109_0748026
562 Ga0496110_0002609
563 Ga0496110_0017708
564 Ga0496111_0107779
565 Ga0496112_0034938
566 Ga0496113_0001277
567 Ga0496114_0376924
568 Ga0496115_0221012
569 Ga0501033_0014927
570 Ga0501067_0063901
571 Ga0501067_0085082
572 Ga0501069_0130082
573 Ga0501070_0269377
574 Ga0501071_0907939
575 Ga0501073_0435088
576 Ga0501263_005380
577 nmdc:mga05p37_45337_c1
578 nmdc:mga05p37_898260_c1
579 nmdc:mga09592_10371_c1
580 nmdc:mga08y16_1047615_c1
581 nmdc:mga0n895_109738_c1
582 nmdc:mga0n895_138083_c1
583 nmdc:mga0n895_386487_c1
584 nmdc:mga0n895_48811_c1
585 nmdc:mga0rr50_367158_c1
586 nmdc:mga0rr50_385491_c1
587 nmdc:mga08x19_139888_c1
588 nmdc:mga08x19_21310_c1
589 nmdc:mga08x19_87509_c2
590 nmdc:mga0a205_347785_c1
591 nmdc:mga0a205_612211_c1
592 Ga0587070_047403
593 2548847926
594 8007374236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14681

UPRTase

Uracil phosphoribosyltransferase

28

230

0.99

PF00156

Pribosyltran

Phosphoribosyl transferase domain

64

213

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dmp-assembly2.cif.gz_C 2.6 a crystal structure of uracil phosphoribosyltransferase from burkholderia pseudomallei 0.9629 1 211
2ehj-assembly1.cif.gz_A structure of uracil phosphoribosyl transferase 0.9547 9 214
5e38-assembly1.cif.gz_C structural basis of mapping the spontaneous mutations with 5-flourouracil in uracil phosphoribosyltransferase from mycobacterium tuberculosis 0.9533 9 211
1v9s-assembly1.cif.gz_C crystal structure of tt0130 protein from thermus thermophilus hb8 0.9492 9 214
3dmp-assembly2.cif.gz_C 2.6 a crystal structure of uracil phosphoribosyltransferase from burkholderia pseudomallei 0.9452 1 211
ID Description Score Start End Superfamily
af_O74449_1_266_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9628 17 49 1.25.40.10
af_Q4E2I2_4_139_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9534 17 48 1.25.40.10
5e38C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9533 9 211 3.40.50.2020
2e55D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9418 9 211 3.40.50.2020
af_Q2FWE6_1_209_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.938 9 214 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A645IBZ4-F1-model_v4 Uracil phosphoribosyltransferase (EC 2.4.2.9) 1.002 138 214 GO:0004845
AF-A0A062G075-F1-model_v4 Phosphoribosyl transferase domain protein 1.001 136 214 GO:0016740
AF-A0A379AD87-F1-model_v4 Uracil phosphoribosyltransferase (EC 2.4.2.9) 1.001 138 214 GO:0004845
AF-A0A2G6CG86-F1-model_v4 Uracil phosphoribosyltransferase 0.9991 130 214 GO:0016757
AF-A0A662F2M2-F1-model_v4 uracil phosphoribosyltransferase (EC 2.4.2.9) 0.9981 122 213 GO:0004845
GO:0005525
GO:0016020

Map