F393144

General Info

Members Datasets Scaffolds Average Seq Length
296 238 271 255

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10089822|Ga0105245_100898222
Length 281
Sequence VSCCSPARGKAQGNENRKKGWRKQMEIIQVETVDAISFITLNRQPANALSQDLLKDLSSVLKHLEDSKETRVIVIKGEGKFFCAGADIKEFTSLQQEKEYEKLAVNGQELFEYIENYPKPVIAAIHGAALGGGLELAMSCHIRLVTENAKLGLPELQLGIIPGFGGTQRLPRYVGVHKACEMMLTSDPISGSEAVELGLANAAFEESQLINETFLLARKIAKKSPISVKATLQLLQHVKTDAYYSGIKKEAQFFGSVFKSRDAQEGVAAFIEKRQPKFLGK

Samples

Sample ID Description Type Environment
1 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
2 2643221731 Bacillus sp. Root147 Isolate Unclassified
3 2643221732 Bacillus sp. Root239 Isolate Unclassified
4 2738543010 Bacillus sp. YR335 Isolate Unclassified
5 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
6 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
7 2842882022 Bacillus sp. R-71893 Isolate Unclassified
8 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
9 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
10 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
11 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
12 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
13 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
14 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
15 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
16 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
17 2919720352 Priestia megaterium 4340 Isolate Unclassified
18 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
19 2929004312 Priestia megaterium 1104 Isolate Unclassified
20 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
21 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
22 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
23 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
30 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
101 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
102 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
103 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
233 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
237 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
238 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.2
Metatranscriptomes 1.35
Isolates 8.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.7
Nodule 0
Rhizoplane 7.09
Rhizosphere 79.73
Stem 0
Stem Tuber 0
Unclassified 10.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10002312 3300003316 Bacteria 19781
2 rootL2_10173911 3300003322 Bacteria 9102
3 rootL2_10287079 3300003322 Bacteria 2380
4 rootH1_10133569 3300003323 Bacteria 8938
5 Ga0006562J51391_1000717 3300003578 Bacteria 10003
6 Ga0055528_1000773 3300003790 Bacteria 22293
7 Ga0058863_11811431 3300004799 Bacteria 1094
8 Ga0058861_10071263 3300004800 Bacteria 2479
9 Ga0070658_10046095 3300005327 Bacteria 3528
10 Ga0070670_100083382 3300005331 Bacteria 2746
11 Ga0070675_100045286 3300005354 Bacteria 3600
12 Ga0070671_100004859 3300005355 Bacteria 10688
13 Ga0070659_100096998 3300005366 Bacteria 2369
14 Ga0070703_10136095 3300005406 Bacteria 908
15 Ga0070711_100078300 3300005439 Bacteria 2348
16 Ga0070700_100415436 3300005441 Bacteria 1015
17 Ga0070694_100014166 3300005444 Bacteria 4989
18 Ga0070708_100415235 3300005445 Bacteria 1269
19 Ga0070706_100016048 3300005467 Bacteria 6916
20 Ga0070707_100032658 3300005468 Bacteria 4959
21 Ga0070698_100041865 3300005471 Bacteria 4702
22 Ga0070698_100806113 3300005471 Bacteria 883
23 Ga0070697_100180206 3300005536 Bacteria 1791
24 Ga0070672_100070207 3300005543 Bacteria 2783
25 Ga0070686_100047038 3300005544 Unclassified 2726
26 Ga0070695_100027571 3300005545 Bacteria 3519
27 Ga0070695_100367547 3300005545 Bacteria 1082
28 Ga0070704_100119981 3300005549 Bacteria 2018
29 Ga0068852_100007079 3300005616 Bacteria 8170
30 Ga0068851_10004020 3300005834 Bacteria 6600
31 Ga0070716_100089080 3300006173 Bacteria 1863
32 Ga0075428_100013938 3300006844 Bacteria 8950
33 Ga0075428_100214037 3300006844 Bacteria 2082
34 Ga0075431_100006783 3300006847 Bacteria 11370
35 Ga0075434_100073297 3300006871 Bacteria 3417
36 Ga0075429_100034340 3300006880 Bacteria 4406
37 Ga0075436_100139895 3300006914 Bacteria 1701
38 Ga0105240_10082232 3300009093 Bacteria 3955
39 Ga0105245_10089822 3300009098 Bacteria 2825
40 Ga0105247_10018045 3300009101 Bacteria 4232
41 Ga0114129_10000875 3300009147 Bacteria 39178
42 Ga0114129_10024872 3300009147 Bacteria 8490
43 Ga0105243_10013306 3300009148 Bacteria 6221
44 Ga0105242_10000303 3300009176 Bacteria 39278
45 Ga0105248_10684013 3300009177 Bacteria 1157
46 Ga0105237_10036896 3300009545 Bacteria 4943
47 Ga0105237_10813849 3300009545 Bacteria 941
48 Ga0105249_10495669 3300009553 Bacteria 1266
49 Ga0105246_10000808 3300011119 Bacteria 17803
50 Ga0157370_10076342 3300013104 Bacteria 3156
51 Ga0157369_10029933 3300013105 Bacteria 6011
52 Ga0157369_10372076 3300013105 Bacteria 1483
53 Ga0157374_10104906 3300013296 Bacteria 2714
54 Ga0157374_10274984 3300013296 Bacteria 1661
55 Ga0157374_10302652 3300013296 Bacteria 1582
56 Ga0157378_10002271 3300013297 Bacteria 17072
57 Ga0157378_10047922 3300013297 Bacteria 3799
58 Ga0157372_10153922 3300013307 Bacteria 2655
59 Ga0157375_10268524 3300013308 Unclassified 1868
60 Ga0157377_10000828 3300014745 Bacteria 12806
61 Ga0213872_10000961 3300021361 Bacteria 20167
62 Ga0213872_10005563 3300021361 Bacteria 6449
63 Ga0213872_10014300 3300021361 Bacteria 3704
64 Ga0213872_10140306 3300021361 Bacteria 1061
65 Ga0209147_100189 3300025229 Bacteria 72095
66 Ga0209673_1002337 3300025273 Bacteria 13416
67 Ga0209025_1003812 3300025294 Bacteria 13774
68 Ga0209025_1004251 3300025294 Bacteria 12602
69 Ga0207426_1026568 3300025302 Bacteria 1937
70 Ga0207655_1012571 3300025728 Bacteria 4936
71 Ga0207713_1000242 3300025735 Bacteria 72255
72 Ga0207653_10033790 3300025885 Bacteria 1659
73 Ga0207710_10113739 3300025900 Bacteria 1287
74 Ga0207705_10039082 3300025909 Bacteria 3400
75 Ga0207684_10035911 3300025910 Bacteria 4206
76 Ga0207695_10049219 3300025913 Bacteria 4445
77 Ga0207646_10041860 3300025922 Bacteria 4116
78 Ga0207646_10125800 3300025922 Bacteria 2305
79 Ga0207650_10130301 3300025925 Bacteria 1967
80 Ga0207687_10089624 3300025927 Bacteria 2240
81 Ga0207686_10005162 3300025934 Bacteria 7020
82 Ga0207665_10153993 3300025939 Bacteria 1648
83 Ga0207691_10107908 3300025940 Bacteria 2478
84 Ga0207661_10189270 3300025944 Bacteria 1803
85 Ga0207677_10043288 3300026023 Unclassified 2992
86 Ga0207639_10101330 3300026041 Unclassified 2328
87 Ga0207708_10164813 3300026075 Bacteria 1752
88 Ga0207698_10126340 3300026142 Unclassified 2176
89 Ga0268266_10706144 3300028379 Bacteria 972
90 Ga0265316_10092048 3300031344 Bacteria 2312
91 Ga0307408_100007506 3300031548 Bacteria 7211
92 Ga0307408_100084143 3300031548 Bacteria 2385
93 Ga0316575_10015744 3300031665 Bacteria 2853
94 Ga0316579_10000932 3300031691 Bacteria 10169
95 Ga0316576_10214862 3300031727 Bacteria 1447
96 Ga0316578_10002018 3300031728 Bacteria 8641
97 Ga0307406_10109450 3300031901 Bacteria 1899
98 Ga0307412_10010836 3300031911 Bacteria 5263
99 Ga0307409_100528968 3300031995 Bacteria 1153
100 Ga0307416_100003515 3300032002 Bacteria 9223
101 Ga0307416_100047007 3300032002 Bacteria 3412
102 Ga0316583_10003229 3300032133 Bacteria 5737
103 Ga0373955_0002321 3300035172 Bacteria 8279
104 Ga0373924_0003584 3300035410 Bacteria 5353
105 Ga0373935_0399368 3300035692 Bacteria 987
106 Ga0373933_0406057 3300035724 Bacteria 889
107 Ga0373937_0422565 3300036401 Bacteria 1265
108 Ga0316582_0001123 3300036647 Bacteria 11363
109 Ga0395905_0046100 3300037471 Bacteria 4088
110 Ga0395901_0017014 3300038443 Bacteria 7411
111 Ga0400488_21528 3300038741 Bacteria 42855
112 Ga0436361_0058100 3300039447 Bacteria 1797
113 Ga0436361_0089111 3300039447 Bacteria 27279
114 Ga0436361_1220187 3300039447 Bacteria 6079
115 Ga0439441_000497 3300042001 Bacteria 4289
116 Ga0451577_0032985 3300042876 Bacteria 4667
117 Ga0451577_0052381 3300042876 Bacteria 3644
118 Ga0466966_0015433 3300044684 Bacteria 5049
119 Ga0466961_0076900 3300044693 Bacteria 2114
120 Ga0466963_0013955 3300044694 Bacteria 4947
121 Ga0466964_0000521 3300044706 Bacteria 12008
122 Ga0453684_0018471 3300044712 Bacteria 10699
123 Ga0453684_0112608 3300044712 Bacteria 3302
124 Ga0453684_0739189 3300044712 Bacteria 1066
125 Ga0466970_0001263 3300044765 Bacteria 12239
126 Ga0466960_0049685 3300044901 Bacteria 2020
127 Ga0466959_0002081 3300045049 Bacteria 12665
128 Ga0495603_0004918 3300046455 Bacteria 7994
129 Ga0495629_0002633 3300046459 Bacteria 13754
130 Ga0495653_0002839 3300046463 Bacteria 13828
131 Ga0495580_0000648 3300046472 Bacteria 29526
132 Ga0495582_0000509 3300046473 Bacteria 21357
133 Ga0495662_0030991 3300046476 Bacteria 2582
134 Ga0495664_0001148 3300046477 Bacteria 13751
135 Ga0495584_0057922 3300046491 Bacteria 1949
136 Ga0495585_0002087 3300046492 Bacteria 14622
137 Ga0495585_0046015 3300046492 Bacteria 2434
138 Ga0495594_0010291 3300046499 Bacteria 4849
139 Ga0495618_0000667 3300046514 Bacteria 24149
140 Ga0495628_0001421 3300046516 Bacteria 21980
141 Ga0495630_0000792 3300046517 Bacteria 22264
142 Ga0495648_0000850 3300046524 Bacteria 32199
143 Ga0495666_0000245 3300046526 Bacteria 23436
144 Ga0495665_0014360 3300046531 Bacteria 4271
145 Ga0495640_0002005 3300046533 Bacteria 16243
146 Ga0495586_0005474 3300046535 Bacteria 6790
147 Ga0495587_0006000 3300046536 Bacteria 7919
148 Ga0495645_0000515 3300046543 Bacteria 26684
149 Ga0495634_0000894 3300046642 Bacteria 28619
150 Ga0495611_0048431 3300046648 Bacteria 1910
151 Ga0495635_0004191 3300046663 Bacteria 10003
152 Ga0495661_0001567 3300046665 Bacteria 18833
153 Ga0495588_0018832 3300046674 Bacteria 3373
154 Ga0495599_0004542 3300046678 Bacteria 8231
155 Ga0495623_0018574 3300046679 Bacteria 4490
156 Ga0495646_0004046 3300046680 Bacteria 9195
157 Ga0495613_0007934 3300046689 Bacteria 7900
158 Ga0495624_0004814 3300046690 Bacteria 9816
159 Ga0495600_0045250 3300046809 Bacteria 2872
160 Ga0495581_0000695 3300047315 Bacteria 17665
161 Ga0495604_0009928 3300047317 Bacteria 7537
162 Ga0495636_0017276 3300047318 Bacteria 2887
163 Ga0495674_0006229 3300047319 Bacteria 11445
164 Ga0495674_0475022 3300047319 Bacteria 1002
165 Ga0495676_0003184 3300047321 Bacteria 14835
166 Ga0495680_0003784 3300047322 Bacteria 14714
167 Ga0495683_0010434 3300047323 Bacteria 4911
168 Ga0495675_0162074 3300047444 Unclassified 1377
169 Ga0495679_000230 3300047446 Bacteria 47184
170 Ga0495681_0021612 3300047470 Bacteria 3463
171 Ga0495593_0002567 3300047673 Bacteria 10909
172 Ga0495602_0009105 3300048088 Bacteria 10336
173 Ga0495614_0002782 3300048089 Bacteria 7776
174 Ga0496100_0000867 3300048903 Bacteria 14426
175 Ga0496100_0472593 3300048903 Bacteria 963
176 Ga0496101_0000840 3300048904 Bacteria 18056
177 Ga0496101_0266619 3300048904 Bacteria 1336
178 Ga0496102_0003532 3300048905 Bacteria 13248
179 Ga0496102_0048823 3300048905 Bacteria 3849
180 Ga0496103_0023315 3300048906 Bacteria 3731
181 Ga0496103_0062545 3300048906 Bacteria 2317
182 Ga0496104_0011089 3300048907 Bacteria 8065
183 Ga0496105_0003960 3300048908 Bacteria 11084
184 Ga0496106_0000703 3300048909 Bacteria 24074
185 Ga0496107_0000255 3300048910 Bacteria 28225
186 Ga0496107_0375602 3300048910 Bacteria 1057
187 Ga0496108_0000342 3300048911 Bacteria 39326
188 Ga0496109_0004896 3300048912 Bacteria 11178
189 Ga0496110_0005860 3300048913 Bacteria 9661
190 Ga0496111_0025109 3300048914 Bacteria 4202
191 Ga0496112_0065027 3300048915 Bacteria 3599
192 Ga0496112_0531036 3300048915 Bacteria 1111
193 Ga0496113_0002436 3300048916 Bacteria 10817
194 Ga0496115_0101532 3300048918 Bacteria 2359
195 Ga0496116_0020714 3300048919 Bacteria 4984
196 Ga0496116_0035285 3300048919 Bacteria 3514
197 Ga0496117_0001900 3300048920 Bacteria 28049
198 Ga0496117_0071527 3300048920 Bacteria 2324
199 Ga0496118_0000016 3300048921 Bacteria 549586
200 Ga0496119_0007627 3300048922 Bacteria 9704
201 Ga0496121_0093620 3300048924 Bacteria 2339
202 Ga0496124_0001963 3300048927 Bacteria 28114
203 Ga0496124_0099655 3300048927 Bacteria 2356
204 Ga0496125_0004862 3300048928 Bacteria 15253
205 Ga0496126_0002301 3300048929 Bacteria 26269
206 Ga0496126_0029676 3300048929 Bacteria 5192
207 Ga0501305_023245 3300049161 Bacteria 927
208 Ga0501031_0075240 3300049568 Bacteria 2199
209 Ga0501031_0165884 3300049568 Bacteria 1444
210 Ga0501032_0003757 3300049569 Bacteria 11517
211 Ga0501033_0002017 3300049570 Bacteria 17661
212 Ga0501034_0004316 3300049571 Bacteria 15852
213 Ga0501036_0024927 3300049572 Bacteria 5045
214 Ga0501036_0108819 3300049572 Bacteria 2343
215 Ga0501037_0030356 3300049573 Bacteria 3995
216 Ga0501037_0059667 3300049573 Bacteria 2782
217 Ga0501037_0169289 3300049573 Bacteria 1554
218 Ga0501038_0008582 3300049574 Bacteria 9378
219 Ga0501038_0015809 3300049574 Bacteria 6857
220 Ga0501038_0158240 3300049574 Bacteria 1843
221 Ga0501039_0021622 3300049575 Bacteria 4935
222 Ga0501039_0022117 3300049575 Bacteria 4880
223 Ga0501039_0084632 3300049575 Bacteria 2470
224 Ga0501041_0019660 3300049577 Unclassified 4034
225 Ga0501041_0070077 3300049577 Bacteria 2152
226 Ga0501042_0530383 3300049578 Bacteria 855
227 Ga0501043_0002366 3300049579 Bacteria 15973
228 Ga0501046_0000165 3300049580 Bacteria 68944
229 Ga0501046_0035213 3300049580 Bacteria 4035
230 Ga0501047_0017146 3300049581 Bacteria 6929
231 Ga0501047_0602427 3300049581 Bacteria 920
232 Ga0501071_0039255 3300049587 Bacteria 3387
233 Ga0501072_0019846 3300049588 Bacteria 5201
234 Ga0501072_0326471 3300049588 Bacteria 1219
235 Ga0501073_0017323 3300049589 Bacteria 5218
236 Ga0501075_0006940 3300049591 Bacteria 7825
237 Ga0501075_0016683 3300049591 Bacteria 5296
238 Ga0501076_0001638 3300049592 Bacteria 15094
239 Ga0501076_0013478 3300049592 Bacteria 6133
240 Ga0501076_0048943 3300049592 Bacteria 3341
241 Ga0501077_0004849 3300049593 Bacteria 8172
242 Ga0501077_0006389 3300049593 Bacteria 7229
243 Ga0501077_0007082 3300049593 Bacteria 6914
244 Ga0501077_0189040 3300049593 Bacteria 1308
245 Ga0501217_019153 3300049661 Bacteria 1596
246 Ga0501079_0039809 3300049741 Bacteria 3626
247 Ga0501079_0043541 3300049741 Bacteria 3465
248 Ga0501079_0107880 3300049741 Bacteria 2161
249 Ga0501080_0024864 3300049742 Bacteria 5554
250 Ga0501081_0049287 3300049743 Bacteria 2900
251 Ga0501035_0010581 3300049822 Bacteria 8546
252 Ga0501035_0012469 3300049822 Bacteria 7854
253 Ga0501044_0006777 3300049823 Bacteria 12627
254 Ga0501044_0497664 3300049823 Bacteria 1120
255 Ga0501045_0067000 3300049824 Bacteria 2636
256 Ga0501045_0210767 3300049824 Bacteria 1447
257 nmdc:mga05p37_72052_c1 3300050507 Bacteria 4251
258 nmdc:mga09592_22827_c1 3300050508 Bacteria 5162
259 nmdc:mga06r32_56007_c1 3300050510 Bacteria 3783
260 nmdc:mga08y16_109487_c1 3300050511 Bacteria 2876
261 nmdc:mga0rr50_317160_c1 3300050513 Bacteria 1306
262 nmdc:mga08x19_125519_c1 3300050514 Bacteria 1723
263 nmdc:mga0a205_16288_c1 3300050515 Bacteria 6961
264 Ga0495601_0068530 3300053077 Bacteria 2262
265 Ga0495619_0010221 3300053085 Bacteria 5911
266 Ga0500643_000033 3300053087 Bacteria 189987
267 Ga0500604_0008080 3300053151 Bacteria 2792
268 Ga0501084_0054290 3300054114 Bacteria 3352
269 Ga0501084_0145213 3300054114 Bacteria 1998
270 Ga0501082_0126051 3300060353 Bacteria 2220
271 Ga0466962_0020998 3300061719 Bacteria 3137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035410 Ga0373924_0003584 Ga0373924_0003584_3688_4320 200
2 3300049578 Ga0501042_0530383 Ga0501042_0530383_98_841 223
3 3300054114 Ga0501084_0145213 Ga0501084_0145213_304_1080 224
4 3300047319 Ga0495674_0475022 Ga0495674_0475022_292_987 225
5 3300048915 Ga0496112_0531036 Ga0496112_0531036_178_981 228
6 3300025944 Ga0207661_10189270 Ga0207661_101892702 229
7 3300031344 Ga0265316_10092048 Ga0265316_100920483 230
8 3300048918 Ga0496115_0101532 Ga0496115_0101532_1080_1862 230
9 3300053077 Ga0495601_0068530 Ga0495601_0068530_1533_2228 230
10 3300048903 Ga0496100_0472593 Ga0496100_0472593_244_942 231
11 3300042001 Ga0439441_000497 Ga0439441_000497_198_965 232
12 3300048910 Ga0496107_0375602 Ga0496107_0375602_345_1046 232
13 3300049661 Ga0501217_019153 Ga0501217_019153_880_1581 233
14 3300021361 Ga0213872_10000961 Ga0213872_1000096119 234
15 3300035724 Ga0373933_0406057 Ga0373933_0406057_133_843 234
16 3300039447 Ga0436361_0089111 Ga0436361_0089111_8459_9169 234
17 3300049568 Ga0501031_0165884 Ga0501031_0165884_15_827 234
18 3300049572 Ga0501036_0024927 Ga0501036_0024927_1793_2605 234
19 3300049575 Ga0501039_0084632 Ga0501039_0084632_1343_2155 234
20 3300049577 Ga0501041_0070077 Ga0501041_0070077_198_980 234
21 3300049587 Ga0501071_0039255 Ga0501071_0039255_2232_3044 234
22 3300049588 Ga0501072_0326471 Ga0501072_0326471_157_939 234
23 3300049592 Ga0501076_0013478 Ga0501076_0013478_5055_5837 234
24 3300049593 Ga0501077_0189040 Ga0501077_0189040_231_1043 234
25 3300049741 Ga0501079_0043541 Ga0501079_0043541_2050_2862 234
26 3300049743 Ga0501081_0049287 Ga0501081_0049287_108_920 234
27 3300049824 Ga0501045_0210767 Ga0501045_0210767_102_914 234
28 3300042876 Ga0451577_0052381 Ga0451577_0052381_510_1289 235
29 3300044712 Ga0453684_0112608 Ga0453684_0112608_1830_2609 235
30 3300013296 Ga0157374_10302652 Ga0157374_103026522 236
31 3300028379 Ga0268266_10706144 Ga0268266_107061441 236
32 3300053087 Ga0500643_000033 Ga0500643_000033_21186_21953 236
33 3300009177 Ga0105248_10684013 Ga0105248_106840131 238
34 3300005327 Ga0070658_10046095 Ga0070658_100460952 239
35 3300005616 Ga0068852_100007079 Ga0068852_1000070796 239
36 3300005834 Ga0068851_10004020 Ga0068851_100040202 239
37 3300009093 Ga0105240_10082232 Ga0105240_100822323 239
38 3300009545 Ga0105237_10036896 Ga0105237_100368963 239
39 3300013105 Ga0157369_10029933 Ga0157369_100299331 239
40 3300013296 Ga0157374_10274984 Ga0157374_102749841 239
41 3300013308 Ga0157375_10268524 Ga0157375_102685243 239
42 3300025909 Ga0207705_10039082 Ga0207705_100390823 239
43 3300025913 Ga0207695_10049219 Ga0207695_100492191 239
44 3300026023 Ga0207677_10043288 Ga0207677_100432882 239
45 3300026041 Ga0207639_10101330 Ga0207639_101013302 239
46 3300026142 Ga0207698_10126340 Ga0207698_101263402 239
47 3300006844 Ga0075428_100214037 Ga0075428_1002140374 243
48 3300049741 Ga0501079_0107880 Ga0501079_0107880_1032_1805 243
49 3300049568 Ga0501031_0075240 Ga0501031_0075240_455_1228 244
50 3300049574 Ga0501038_0158240 Ga0501038_0158240_164_937 244
51 3300049575 Ga0501039_0022117 Ga0501039_0022117_2050_2823 244
52 3300049591 Ga0501075_0016683 Ga0501075_0016683_132_905 244
53 3300049592 Ga0501076_0001638 Ga0501076_0001638_5002_5775 244
54 3300049593 Ga0501077_0007082 Ga0501077_0007082_920_1693 244
55 3300049824 Ga0501045_0067000 Ga0501045_0067000_1802_2575 244
56 3300060353 Ga0501082_0126051 Ga0501082_0126051_347_1120 244
57 iso_pu_bacteria 2585428095 2587866418 248
58 3300021361 Ga0213872_10014300 Ga0213872_100143002 249
59 3300039447 Ga0436361_0058100 Ga0436361_0058100_614_1399 249
60 3300047318 Ga0495636_0017276 Ga0495636_0017276_1270_2028 249
61 3300013104 Ga0157370_10076342 Ga0157370_100763424 250
62 3300046492 Ga0495585_0002087 Ga0495585_0002087_4069_4851 250
63 3300037471 Ga0395905_0046100 Ga0395905_0046100_1802_2566 252
64 3300038443 Ga0395901_0017014 Ga0395901_0017014_3904_4668 252
65 3300048904 Ga0496101_0266619 Ga0496101_0266619_501_1313 252
66 3300050511 nmdc:mga08y16_109487_c1 nmdc:mga08y16_109487_c1_26_862 252
67 iso_pu_bacteria 2916971899 2916974993 252
68 3300003322 rootL2_10287079 rootL2_102870793 253
69 3300003323 rootH1_10133569 rootH1_101335693 253
70 3300005545 Ga0070695_100367547 Ga0070695_1003675471 253
71 3300031665 Ga0316575_10015744 Ga0316575_100157442 253
72 3300031691 Ga0316579_10000932 Ga0316579_100009327 253
73 3300031728 Ga0316578_10002018 Ga0316578_100020182 253
74 3300032133 Ga0316583_10003229 Ga0316583_100032294 253
75 3300036401 Ga0373937_0422565 Ga0373937_0422565_353_1120 253
76 3300036647 Ga0316582_0001123 Ga0316582_0001123_8797_9564 253
77 3300044684 Ga0466966_0015433 Ga0466966_0015433_2350_3117 253
78 3300044693 Ga0466961_0076900 Ga0466961_0076900_766_1533 253
79 3300044706 Ga0466964_0000521 Ga0466964_0000521_9082_9849 253
80 3300044765 Ga0466970_0001263 Ga0466970_0001263_4511_5278 253
81 3300044901 Ga0466960_0049685 Ga0466960_0049685_95_862 253
82 3300045049 Ga0466959_0002081 Ga0466959_0002081_1277_2044 253
83 3300053085 Ga0495619_0010221 Ga0495619_0010221_3928_4695 253
84 3300053151 Ga0500604_0008080 Ga0500604_0008080_1070_1837 253
85 3300061719 Ga0466962_0020998 Ga0466962_0020998_59_826 253
86 iso_pu_bacteria 2643221731 2644715585 253
87 iso_pu_bacteria 2643221732 2644726889 253
88 iso_pu_bacteria 2738543010 2739229940 253
89 iso_pu_bacteria 2739367655 2739610460 253
90 iso_pu_bacteria 2818991465 2819709053 253
91 iso_pu_bacteria 2842882022 2842884705 253
92 iso_pu_bacteria 2857460504 2857462519 253
93 iso_pu_bacteria 2881927736 2881929176 253
94 iso_pu_bacteria 2887375801 2887375925 253
95 iso_pu_bacteria 2904524088 2904524265 253
96 iso_pu_bacteria 2919143609 2919147158 253
97 iso_pu_bacteria 2919517244 2919519062 253
98 iso_pu_bacteria 2919720352 2919723431 253
99 iso_pu_bacteria 2928093941 2928096043 253
100 iso_pu_bacteria 2929004312 2929006586 253
101 iso_pu_bacteria 2960319331 2960319662 253
102 iso_pu_bacteria 2960375949 2960381127 253
103 iso_pu_bacteria 3006978542 3006982084 253
104 iso_pu_bacteria 3006984091 3006984314 253
105 iso_pu_bacteria 8022893055 8022898409 253
106 iso_pu_bacteria 8022914991 8022917559 253
107 3300005366 Ga0070659_100096998 Ga0070659_1000969982 254
108 3300046455 Ga0495603_0004918 Ga0495603_0004918_5646_6416 254
109 3300046459 Ga0495629_0002633 Ga0495629_0002633_9200_9970 254
110 3300046463 Ga0495653_0002839 Ga0495653_0002839_11672_12442 254
111 3300046472 Ga0495580_0000648 Ga0495580_0000648_24964_25734 254
112 3300046473 Ga0495582_0000509 Ga0495582_0000509_3793_4563 254
113 3300046476 Ga0495662_0030991 Ga0495662_0030991_341_1111 254
114 3300046477 Ga0495664_0001148 Ga0495664_0001148_9200_9970 254
115 3300046499 Ga0495594_0010291 Ga0495594_0010291_1757_2527 254
116 3300046514 Ga0495618_0000667 Ga0495618_0000667_3426_4196 254
117 3300046516 Ga0495628_0001421 Ga0495628_0001421_19236_20006 254
118 3300046517 Ga0495630_0000792 Ga0495630_0000792_3793_4563 254
119 3300046524 Ga0495648_0000850 Ga0495648_0000850_3794_4564 254
120 3300046526 Ga0495666_0000245 Ga0495666_0000245_18593_19363 254
121 3300046531 Ga0495665_0014360 Ga0495665_0014360_1140_1910 254
122 3300046533 Ga0495640_0002005 Ga0495640_0002005_12015_12785 254
123 3300046535 Ga0495586_0005474 Ga0495586_0005474_4788_5558 254
124 3300046536 Ga0495587_0006000 Ga0495587_0006000_4788_5558 254
125 3300046543 Ga0495645_0000515 Ga0495645_0000515_24530_25300 254
126 3300046642 Ga0495634_0000894 Ga0495634_0000894_24446_25216 254
127 3300046648 Ga0495611_0048431 Ga0495611_0048431_268_1038 254
128 3300046663 Ga0495635_0004191 Ga0495635_0004191_3840_4610 254
129 3300046665 Ga0495661_0001567 Ga0495661_0001567_14099_14869 254
130 3300046674 Ga0495588_0018832 Ga0495588_0018832_2428_3198 254
131 3300046678 Ga0495599_0004542 Ga0495599_0004542_3766_4536 254
132 3300046679 Ga0495623_0018574 Ga0495623_0018574_3668_4438 254
133 3300046680 Ga0495646_0004046 Ga0495646_0004046_4660_5430 254
134 3300046689 Ga0495613_0007934 Ga0495613_0007934_1233_2003 254
135 3300046690 Ga0495624_0004814 Ga0495624_0004814_3273_4043 254
136 3300046809 Ga0495600_0045250 Ga0495600_0045250_368_1138 254
137 3300047315 Ga0495581_0000695 Ga0495581_0000695_15618_16388 254
138 3300047317 Ga0495604_0009928 Ga0495604_0009928_5382_6152 254
139 3300047319 Ga0495674_0006229 Ga0495674_0006229_1476_2246 254
140 3300047321 Ga0495676_0003184 Ga0495676_0003184_3794_4564 254
141 3300047322 Ga0495680_0003784 Ga0495680_0003784_10096_10866 254
142 3300047444 Ga0495675_0162074 Ga0495675_0162074_239_1009 254
143 3300047446 Ga0495679_000230 Ga0495679_000230_30728_31498 254
144 3300047470 Ga0495681_0021612 Ga0495681_0021612_1766_2536 254
145 3300047673 Ga0495593_0002567 Ga0495593_0002567_8165_8935 254
146 3300048088 Ga0495602_0009105 Ga0495602_0009105_3793_4563 254
147 3300048089 Ga0495614_0002782 Ga0495614_0002782_1233_2003 254
148 3300049588 Ga0501072_0019846 Ga0501072_0019846_647_1477 254
149 iso_pu_bacteria 2898907183 2898909332 254
150 3300049581 Ga0501047_0602427 Ga0501047_0602427_44_820 255
151 3300004800 Ga0058861_10071263 Ga0058861_100712632 256
152 3300005439 Ga0070711_100078300 Ga0070711_1000783002 256
153 3300005441 Ga0070700_100415436 Ga0070700_1004154362 256
154 3300005445 Ga0070708_100415235 Ga0070708_1004152352 256
155 3300006844 Ga0075428_100013938 Ga0075428_1000139385 256
156 3300006847 Ga0075431_100006783 Ga0075431_10000678311 256
157 3300006880 Ga0075429_100034340 Ga0075429_1000343405 256
158 3300009147 Ga0114129_10000875 Ga0114129_1000087520 256
159 3300009147 Ga0114129_10024872 Ga0114129_100248728 256
160 3300009545 Ga0105237_10813849 Ga0105237_108138491 256
161 3300013105 Ga0157369_10372076 Ga0157369_103720762 256
162 3300013297 Ga0157378_10047922 Ga0157378_100479222 256
163 3300021361 Ga0213872_10005563 Ga0213872_100055634 256
164 3300021361 Ga0213872_10140306 Ga0213872_101403061 256
165 3300026075 Ga0207708_10164813 Ga0207708_101648133 256
166 3300031548 Ga0307408_100084143 Ga0307408_1000841433 256
167 3300031727 Ga0316576_10214862 Ga0316576_102148622 256
168 3300031901 Ga0307406_10109450 Ga0307406_101094501 256
169 3300031911 Ga0307412_10010836 Ga0307412_100108365 256
170 3300031995 Ga0307409_100528968 Ga0307409_1005289682 256
171 3300032002 Ga0307416_100003515 Ga0307416_1000035157 256
172 3300035172 Ga0373955_0002321 Ga0373955_0002321_6626_7408 256
173 3300035692 Ga0373935_0399368 Ga0373935_0399368_122_913 256
174 3300039447 Ga0436361_1220187 Ga0436361_1220187_3828_4631 256
175 3300042876 Ga0451577_0032985 Ga0451577_0032985_1181_1963 256
176 3300044694 Ga0466963_0013955 Ga0466963_0013955_2014_2835 256
177 3300044712 Ga0453684_0018471 Ga0453684_0018471_6129_6911 256
178 3300044712 Ga0453684_0739189 Ga0453684_0739189_188_970 256
179 3300048905 Ga0496102_0048823 Ga0496102_0048823_2770_3555 256
180 3300048906 Ga0496103_0062545 Ga0496103_0062545_585_1370 256
181 3300048919 Ga0496116_0020714 Ga0496116_0020714_2423_3208 256
182 3300048920 Ga0496117_0001900 Ga0496117_0001900_10332_11117 256
183 3300048921 Ga0496118_0000016 Ga0496118_0000016_424404_425189 256
184 3300048927 Ga0496124_0001963 Ga0496124_0001963_18849_19634 256
185 3300048929 Ga0496126_0002301 Ga0496126_0002301_8471_9256 256
186 3300049569 Ga0501032_0003757 Ga0501032_0003757_4564_5358 256
187 3300049570 Ga0501033_0002017 Ga0501033_0002017_10708_11502 256
188 3300049571 Ga0501034_0004316 Ga0501034_0004316_4335_5129 256
189 3300049573 Ga0501037_0030356 Ga0501037_0030356_140_919 256
190 3300049573 Ga0501037_0059667 Ga0501037_0059667_1488_2282 256
191 3300049573 Ga0501037_0169289 Ga0501037_0169289_707_1501 256
192 3300049574 Ga0501038_0008582 Ga0501038_0008582_4398_5192 256
193 3300049579 Ga0501043_0002366 Ga0501043_0002366_4472_5266 256
194 3300049580 Ga0501046_0000165 Ga0501046_0000165_29541_30335 256
195 3300049581 Ga0501047_0017146 Ga0501047_0017146_5999_6793 256
196 3300049589 Ga0501073_0017323 Ga0501073_0017323_2297_3091 256
197 3300049593 Ga0501077_0006389 Ga0501077_0006389_1901_2680 256
198 3300049742 Ga0501080_0024864 Ga0501080_0024864_3916_4710 256
199 3300049822 Ga0501035_0010581 Ga0501035_0010581_1821_2615 256
200 3300049823 Ga0501044_0006777 Ga0501044_0006777_5636_6430 256
201 3300049823 Ga0501044_0497664 Ga0501044_0497664_141_935 256
202 3300050507 nmdc:mga05p37_72052_c1 nmdc:mga05p37_72052_c1_2231_3013 256
203 3300050508 nmdc:mga09592_22827_c1 nmdc:mga09592_22827_c1_2287_3069 256
204 3300050510 nmdc:mga06r32_56007_c1 nmdc:mga06r32_56007_c1_1171_1953 256
205 iso_pu_bacteria 2884215851 2884219618 256
206 3300003316 rootH1_10002312 rootH1_100023123 257
207 3300003322 rootL2_10173911 rootL2_101739116 257
208 3300003578 Ga0006562J51391_1000717 Ga0006562J51391_10007173 257
209 3300003790 Ga0055528_1000773 Ga0055528_100077315 257
210 3300004799 Ga0058863_11811431 Ga0058863_118114312 257
211 3300005331 Ga0070670_100083382 Ga0070670_1000833823 257
212 3300005354 Ga0070675_100045286 Ga0070675_1000452863 257
213 3300005355 Ga0070671_100004859 Ga0070671_1000048597 257
214 3300005406 Ga0070703_10136095 Ga0070703_101360951 257
215 3300005444 Ga0070694_100014166 Ga0070694_1000141664 257
216 3300005467 Ga0070706_100016048 Ga0070706_1000160484 257
217 3300005468 Ga0070707_100032658 Ga0070707_1000326582 257
218 3300005471 Ga0070698_100041865 Ga0070698_1000418653 257
219 3300005471 Ga0070698_100806113 Ga0070698_1008061131 257
220 3300005536 Ga0070697_100180206 Ga0070697_1001802062 257
221 3300005543 Ga0070672_100070207 Ga0070672_1000702073 257
222 3300005544 Ga0070686_100047038 Ga0070686_1000470381 257
223 3300005545 Ga0070695_100027571 Ga0070695_1000275712 257
224 3300005549 Ga0070704_100119981 Ga0070704_1001199812 257
225 3300006173 Ga0070716_100089080 Ga0070716_1000890802 257
226 3300006871 Ga0075434_100073297 Ga0075434_1000732973 257
227 3300006914 Ga0075436_100139895 Ga0075436_1001398952 257
228 3300009098 Ga0105245_10089822 Ga0105245_100898222 257
229 3300009101 Ga0105247_10018045 Ga0105247_100180453 257
230 3300009148 Ga0105243_10013306 Ga0105243_100133063 257
231 3300009176 Ga0105242_10000303 Ga0105242_100003035 257
232 3300009553 Ga0105249_10495669 Ga0105249_104956692 257
233 3300011119 Ga0105246_10000808 Ga0105246_100008083 257
234 3300013296 Ga0157374_10104906 Ga0157374_101049062 257
235 3300013297 Ga0157378_10002271 Ga0157378_1000227110 257
236 3300013307 Ga0157372_10153922 Ga0157372_101539223 257
237 3300014745 Ga0157377_10000828 Ga0157377_100008282 257
238 3300025229 Ga0209147_100189 Ga0209147_10018948 257
239 3300025273 Ga0209673_1002337 Ga0209673_100233711 257
240 3300025294 Ga0209025_1003812 Ga0209025_10038125 257
241 3300025294 Ga0209025_1004251 Ga0209025_10042516 257
242 3300025302 Ga0207426_1026568 Ga0207426_10265682 257
243 3300025728 Ga0207655_1012571 Ga0207655_10125713 257
244 3300025735 Ga0207713_1000242 Ga0207713_100024238 257
245 3300025885 Ga0207653_10033790 Ga0207653_100337901 257
246 3300025900 Ga0207710_10113739 Ga0207710_101137392 257
247 3300025910 Ga0207684_10035911 Ga0207684_100359112 257
248 3300025922 Ga0207646_10041860 Ga0207646_100418604 257
249 3300025922 Ga0207646_10125800 Ga0207646_101258003 257
250 3300025925 Ga0207650_10130301 Ga0207650_101303012 257
251 3300025927 Ga0207687_10089624 Ga0207687_100896242 257
252 3300025934 Ga0207686_10005162 Ga0207686_100051624 257
253 3300025939 Ga0207665_10153993 Ga0207665_101539932 257
254 3300025940 Ga0207691_10107908 Ga0207691_101079083 257
255 3300031548 Ga0307408_100007506 Ga0307408_1000075063 257
256 3300032002 Ga0307416_100047007 Ga0307416_1000470073 257
257 3300038741 Ga0400488_21528 Ga0400488_21528_3270_4055 257
258 3300046491 Ga0495584_0057922 Ga0495584_0057922_391_1164 257
259 3300046492 Ga0495585_0046015 Ga0495585_0046015_1233_2006 257
260 3300047323 Ga0495683_0010434 Ga0495683_0010434_1958_2731 257
261 3300048903 Ga0496100_0000867 Ga0496100_0000867_880_1653 257
262 3300048904 Ga0496101_0000840 Ga0496101_0000840_12069_12842 257
263 3300048905 Ga0496102_0003532 Ga0496102_0003532_10544_11317 257
264 3300048906 Ga0496103_0023315 Ga0496103_0023315_2038_2811 257
265 3300048907 Ga0496104_0011089 Ga0496104_0011089_5344_6117 257
266 3300048908 Ga0496105_0003960 Ga0496105_0003960_7624_8397 257
267 3300048909 Ga0496106_0000703 Ga0496106_0000703_12838_13611 257
268 3300048910 Ga0496107_0000255 Ga0496107_0000255_14633_15406 257
269 3300048911 Ga0496108_0000342 Ga0496108_0000342_34109_34882 257
270 3300048912 Ga0496109_0004896 Ga0496109_0004896_2388_3161 257
271 3300048913 Ga0496110_0005860 Ga0496110_0005860_7624_8397 257
272 3300048914 Ga0496111_0025109 Ga0496111_0025109_2037_2810 257
273 3300048915 Ga0496112_0065027 Ga0496112_0065027_2190_2963 257
274 3300048916 Ga0496113_0002436 Ga0496113_0002436_3369_4142 257
275 3300048919 Ga0496116_0035285 Ga0496116_0035285_464_1237 257
276 3300048920 Ga0496117_0071527 Ga0496117_0071527_346_1119 257
277 3300048922 Ga0496119_0007627 Ga0496119_0007627_8053_8826 257
278 3300048924 Ga0496121_0093620 Ga0496121_0093620_381_1154 257
279 3300048927 Ga0496124_0099655 Ga0496124_0099655_1525_2298 257
280 3300048928 Ga0496125_0004862 Ga0496125_0004862_10266_11039 257
281 3300048929 Ga0496126_0029676 Ga0496126_0029676_3967_4740 257
282 3300049161 Ga0501305_023245 Ga0501305_023245_128_901 257
283 3300049572 Ga0501036_0108819 Ga0501036_0108819_932_1705 257
284 3300049574 Ga0501038_0015809 Ga0501038_0015809_1494_2267 257
285 3300049575 Ga0501039_0021622 Ga0501039_0021622_1332_2105 257
286 3300049577 Ga0501041_0019660 Ga0501041_0019660_3246_4019 257
287 3300049580 Ga0501046_0035213 Ga0501046_0035213_1608_2381 257
288 3300049591 Ga0501075_0006940 Ga0501075_0006940_1014_1793 257
289 3300049592 Ga0501076_0048943 Ga0501076_0048943_862_1641 257
290 3300049593 Ga0501077_0004849 Ga0501077_0004849_1519_2298 257
291 3300049741 Ga0501079_0039809 Ga0501079_0039809_2205_2984 257
292 3300049822 Ga0501035_0012469 Ga0501035_0012469_5439_6212 257
293 3300050513 nmdc:mga0rr50_317160_c1 nmdc:mga0rr50_317160_c1_126_905 257
294 3300050514 nmdc:mga08x19_125519_c1 nmdc:mga08x19_125519_c1_554_1333 257
295 3300050515 nmdc:mga0a205_16288_c1 nmdc:mga0a205_16288_c1_4828_5607 257
296 3300054114 Ga0501084_0054290 Ga0501084_0054290_2382_3161 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

31

281

0.98

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

36

215

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pea-assembly2.cif.gz_F crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor' 0.9882 2 256
3pea-assembly2.cif.gz_D crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor' 0.9842 1 256
3pea-assembly2.cif.gz_F crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor' 0.9767 2 256
3p5m-assembly1.cif.gz_F crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium 0.9463 1 257
3p5m-assembly1.cif.gz_D crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium avium 0.9457 1 257
ID Description Score Start End Superfamily
3peaF00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9843 1 256 3.90.226.10
3peaF00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9804 1 256 3.90.226.10
5z7rC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9656 1 199 3.90.226.10
af_B7F9R1_37_234_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.965 11 198 3.90.226.10
3rsiB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1; 0.9606 95 198 3.90.226.20
ID Description Score Start End GO Terms
AF-A0A0B0HPD3-F1-model_v4 deleted 0.996 4 174
AF-A0A658JGL9-F1-model_v4 deleted 0.9954 67 257
AF-A0A0Q3QRE6-F1-model_v4 Enoyl-CoA hydratase 0.9953 1 257 GO:0006635
GO:0016836
AF-A0A2A9R9R4-F1-model_v4 deleted 0.9948 1 205
AF-A0A2A9R9R4-F1-model_v4 deleted 0.9852 1 205

Feature Viewer

pLDDT pTM Quality
95.95 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map