F391453

General Info

Members Datasets Scaffolds Average Seq Length
293 170 277 367

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10018855|Ga0105244_100188553
Length 408
Sequence MNGSASQNRGLEVKRISYLLYTTHNWNTIMSNANRYTGLVDRYRDRLPVSKTTRAISLNEGNTPLIKLDNIPGIIGKNVEIYVKYEGLNPTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAXXXYAARAGIKAFVLIPEGKIAMGKMAQAMMYGAITMQIRGNFDDGMRLVKEVADQAPVTIVNSINPYRLQGQKTIAYEIVEASGRAPDYHCLPVGNAGNITAHWMGYTEAVANQPVEAFEQVVYDPETDKFTGPNPEGRPIMVGYQASGAAPFLRGGPVENPETVATAIRIGNPQSFNHAKAVVRDSNGWFDELTDAEILEAQRLLSMYEGVFVEPASAASIGGAIRDIKAGKIAEGSVIVCTVTGNGLKDPDTAIKQCKDAIMLSIDATMNQVKDSILSNM

Samples

Sample ID Description Type Environment
1 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
2 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
3 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
4 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
5 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
6 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
7 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
8 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
9 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
10 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
11 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
12 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
13 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
14 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
101 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
104 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
105 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
111 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
112 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
113 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
117 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
127 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
128 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
129 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
130 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
131 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
132 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
133 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
170 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.78
Metatranscriptomes 3.75
Isolates 5.46

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 0
Rhizosphere 79.86
Stem 0
Stem Tuber 0
Unclassified 19.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058692_1000067 3300003856 Bacteria 88996
2 Ga0065703_1000511 3300005272 Bacteria 20229
3 Ga0070658_10007922 3300005327 Bacteria 8555
4 Ga0070690_100040238 3300005330 Bacteria 2956
5 Ga0070666_10145586 3300005335 Bacteria 1651
6 Ga0070680_100244169 3300005336 Bacteria 1518
7 Ga0070660_100013286 3300005339 Bacteria 5902
8 Ga0070689_100038413 3300005340 Bacteria 3663
9 Ga0070689_100263404 3300005340 Bacteria 1425
10 Ga0070691_10115425 3300005341 Bacteria 1347
11 Ga0070669_100001915 3300005353 Bacteria 15024
12 Ga0070700_100083704 3300005441 Bacteria 2066
13 Ga0070694_100170082 3300005444 Bacteria 1605
14 Ga0070708_100059913 3300005445 Bacteria 3396
15 Ga0070681_10274519 3300005458 Bacteria 1597
16 Ga0068867_100061404 3300005459 Bacteria 2790
17 Ga0070699_100034705 3300005518 Bacteria 4359
18 Ga0070686_100025262 3300005544 Bacteria 3573
19 Ga0070695_100028816 3300005545 Bacteria 3448
20 Ga0070695_100159730 3300005545 Bacteria 1581
21 Ga0070695_100203298 3300005545 Bacteria 1417
22 Ga0070696_100011788 3300005546 Bacteria 5859
23 Ga0070696_100061382 3300005546 Bacteria 2630
24 Ga0070693_100070249 3300005547 Bacteria 2060
25 Ga0070665_100003315 3300005548 Bacteria 17248
26 Ga0070704_100243550 3300005549 Bacteria 1473
27 Ga0068855_100155744 3300005563 Bacteria 2596
28 Ga0070702_100015894 3300005615 Bacteria 3852
29 Ga0068866_10002287 3300005718 Bacteria 7931
30 Ga0068861_100007736 3300005719 Bacteria 7382
31 Ga0068858_100073010 3300005842 Bacteria 3184
32 Ga0081455_10014355 3300005937 Bacteria 7771
33 Ga0075362_10021922 3300006177 Bacteria 2687
34 Ga0097621_100002530 3300006237 Bacteria 12525
35 Ga0068871_100313439 3300006358 Bacteria 1379
36 Ga0075428_100000559 3300006844 Bacteria 38086
37 Ga0075430_100017282 3300006846 Bacteria 6144
38 Ga0075431_100007255 3300006847 Bacteria 11033
39 Ga0075429_100013597 3300006880 Bacteria 7060
40 Ga0068865_100005871 3300006881 Bacteria 7469
41 Ga0105251_10006108 3300009011 Bacteria 7756
42 Ga0105244_10018855 3300009036 Bacteria 3863
43 Ga0105240_10004415 3300009093 Bacteria 21452
44 Ga0111539_10001017 3300009094 Bacteria 36767
45 Ga0111539_10072584 3300009094 Bacteria 4059
46 Ga0105245_10015997 3300009098 Bacteria 6536
47 Ga0105247_10011987 3300009101 Bacteria 5206
48 Ga0105243_10000263 3300009148 Bacteria 59080
49 Ga0105243_10057861 3300009148 Bacteria 3088
50 Ga0105243_10101510 3300009148 Bacteria 2389
51 Ga0105237_10000129 3300009545 Bacteria 105354
52 Ga0105238_10018273 3300009551 Bacteria 7132
53 Ga0105249_10000815 3300009553 Bacteria 28095
54 Ga0105249_10004009 3300009553 Bacteria 12703
55 Ga0157371_10001415 3300013102 Bacteria 24935
56 Ga0157369_10403143 3300013105 Bacteria 1419
57 Ga0157378_10003568 3300013297 Bacteria 13775
58 Ga0157378_10100944 3300013297 Bacteria 2635
59 Ga0163162_10149942 3300013306 Bacteria 2449
60 Ga0157375_10054362 3300013308 Bacteria 3943
61 Ga0213876_10081639 3300021384 Bacteria 1710
62 Ga0213875_10001799 3300021388 Bacteria 13381
63 Ga0207696_1002017 3300025711 Bacteria 10273
64 Ga0207655_1000535 3300025728 Bacteria 48106
65 Ga0207655_1021376 3300025728 Bacteria 3285
66 Ga0207655_1021381 3300025728 Bacteria 3285
67 Ga0207713_1003888 3300025735 Bacteria 9950
68 Ga0207710_10000183 3300025900 Bacteria 61804
69 Ga0207707_10217672 3300025912 Bacteria 1663
70 Ga0207671_10000283 3300025914 Bacteria 75047
71 Ga0207660_10238687 3300025917 Bacteria 1431
72 Ga0207657_10024592 3300025919 Bacteria 5572
73 Ga0207681_10000497 3300025923 Bacteria 27461
74 Ga0207694_10009506 3300025924 Bacteria 7333
75 Ga0207687_10008031 3300025927 Bacteria 6907
76 Ga0207686_10290595 3300025934 Bacteria 1210
77 Ga0207709_10000158 3300025935 Bacteria 91810
78 Ga0207709_10122819 3300025935 Bacteria 1756
79 Ga0207670_10303879 3300025936 Bacteria 1250
80 Ga0207704_10001803 3300025938 Bacteria 9601
81 Ga0207689_10002776 3300025942 Bacteria 16192
82 Ga0207712_10000619 3300025961 Bacteria 28053
83 Ga0207708_10086339 3300026075 Bacteria 2415
84 Ga0207708_10094579 3300026075 Bacteria 2307
85 Ga0207675_100008406 3300026118 Bacteria 9728
86 Ga0207683_10028830 3300026121 Bacteria 4803
87 Ga0209371_1000196 3300027312 Bacteria 89093
88 Ga0209967_1001621 3300027364 Bacteria 2890
89 Ga0209974_10001997 3300027876 Bacteria 7442
90 Ga0207428_10006780 3300027907 Bacteria 10505
91 Ga0268266_10005441 3300028379 Bacteria 11871
92 Ga0268265_10355901 3300028380 Bacteria 1338
93 Ga0265334_10000856 3300028573 Bacteria 15235
94 Ga0268256_1000158 3300030500 Bacteria 89061
95 Ga0265320_10018882 3300031240 Unclassified 3784
96 Ga0265327_10012829 3300031251 Bacteria 5617
97 Ga0307408_100010011 3300031548 Bacteria 6248
98 Ga0307408_100172995 3300031548 Bacteria 1726
99 Ga0265313_10002370 3300031595 Bacteria 16401
100 Ga0316575_10001767 3300031665 Bacteria 7077
101 Ga0316575_10008292 3300031665 Bacteria 3779
102 Ga0316579_10000057 3300031691 Bacteria 26877
103 Ga0316579_10000910 3300031691 Bacteria 10252
104 Ga0316579_10001147 3300031691 Bacteria 9424
105 Ga0265342_10065167 3300031712 Bacteria 2136
106 Ga0316576_10002589 3300031727 Bacteria 10334
107 Ga0316576_10075662 3300031727 Bacteria 2491
108 Ga0316576_10187163 3300031727 Bacteria 1561
109 Ga0316578_10001514 3300031728 Bacteria 9526
110 Ga0316578_10003018 3300031728 Bacteria 7584
111 Ga0316578_10073879 3300031728 Bacteria 2021
112 Ga0316578_10074996 3300031728 Bacteria 2006
113 Ga0316578_10201784 3300031728 Bacteria 1197
114 Ga0316577_10008533 3300031733 Bacteria 5497
115 Ga0316577_10037474 3300031733 Bacteria 2711
116 Ga0316577_10130798 3300031733 Bacteria 1412
117 Ga0307406_10055950 3300031901 Bacteria 2524
118 Ga0307409_100116421 3300031995 Bacteria 2253
119 Ga0307416_100212986 3300032002 Bacteria 1845
120 Ga0307414_10207727 3300032004 Bacteria 1598
121 Ga0316583_10000184 3300032133 Bacteria 16022
122 Ga0316583_10007102 3300032133 Bacteria 4024
123 Ga0316583_10008647 3300032133 Bacteria 3673
124 Ga0316585_10000219 3300032137 Bacteria 11929
125 Ga0316585_10003654 3300032137 Bacteria 4241
126 Ga0316580_10006021 3300032139 Bacteria 3560
127 Ga0316580_10022748 3300032139 Bacteria 1934
128 Ga0316593_10000630 3300032168 Bacteria 6731
129 Ga0316593_10000899 3300032168 Bacteria 6075
130 Ga0316593_10001861 3300032168 Bacteria 4833
131 Ga0316593_10006473 3300032168 Bacteria 3162
132 Ga0316593_10015447 3300032168 Bacteria 2298
133 Ga0316593_10021564 3300032168 Bacteria 2015
134 Ga0316593_10025631 3300032168 Bacteria 1879
135 Ga0316593_10053891 3300032168 Bacteria 1364
136 Ga0316596_1002468 3300033541 Bacteria 3949
137 Ga0316596_1031857 3300033541 Bacteria 1370
138 Ga0316596_1031876 3300033541 Bacteria 1370
139 Ga0373943_0031628 3300035170 Bacteria 2512
140 Ga0316574_0000325 3300035398 Bacteria 18288
141 Ga0316574_0006557 3300035398 Bacteria 6301
142 Ga0316574_0008976 3300035398 Bacteria 5582
143 Ga0316574_0031918 3300035398 Bacteria 3198
144 Ga0316574_0041700 3300035398 Bacteria 2830
145 Ga0316574_0071769 3300035398 Bacteria 2187
146 Ga0316582_0004033 3300036647 Bacteria 7337
147 Ga0316582_0004214 3300036647 Bacteria 7216
148 Ga0316582_0009043 3300036647 Bacteria 5384
149 Ga0316582_0022613 3300036647 Bacteria 3735
150 Ga0316582_0028779 3300036647 Bacteria 3369
151 Ga0316582_0028967 3300036647 Bacteria 3359
152 Ga0316582_0035420 3300036647 Bacteria 3082
153 Ga0316582_0037280 3300036647 Bacteria 3014
154 Ga0316582_0047110 3300036647 Bacteria 2720
155 Ga0316582_0073375 3300036647 Bacteria 2221
156 Ga0316582_0078990 3300036647 Bacteria 2145
157 Ga0316582_0105037 3300036647 Bacteria 1875
158 Ga0316582_0154583 3300036647 Bacteria 1552
159 Ga0316584_0001942 3300036712 Bacteria 12900
160 Ga0316584_0002751 3300036712 Bacteria 11250
161 Ga0316584_0004632 3300036712 Bacteria 9108
162 Ga0316584_0010538 3300036712 Bacteria 6465
163 Ga0316584_0016614 3300036712 Bacteria 5278
164 Ga0316584_0017374 3300036712 Bacteria 5169
165 Ga0316584_0024473 3300036712 Bacteria 4419
166 Ga0316584_0045849 3300036712 Bacteria 3264
167 Ga0395899_0014493 3300037312 Bacteria 6018
168 Ga0395900_0003351 3300037418 Bacteria 17308
169 Ga0395900_0034234 3300037418 Bacteria 5230
170 Ga0395900_0041421 3300037418 Bacteria 4748
171 Ga0395900_0181368 3300037418 Bacteria 2139
172 Ga0395898_0021353 3300037466 Bacteria 6566
173 Ga0395898_0093059 3300037466 Bacteria 2898
174 Ga0395905_0072858 3300037471 Bacteria 3220
175 Ga0395905_0080836 3300037471 Bacteria 3046
176 Ga0316581_0001174 3300037588 Bacteria 5743
177 Ga0316581_0002108 3300037588 Bacteria 4681
178 Ga0436364_0562688 3300037853 Bacteria 31949
179 Ga0395901_0014294 3300038443 Bacteria 8080
180 Ga0395901_0017086 3300038443 Bacteria 7396
181 Ga0400484_06228 3300038725 Bacteria 12798
182 Ga0400484_08193 3300038725 Bacteria 5087
183 Ga0400484_08491 3300038725 Bacteria 5700
184 Ga0400484_27754 3300038725 Bacteria 8302
185 Ga0400484_34430 3300038725 Unclassified 1754
186 Ga0400484_40863 3300038725 Bacteria 5525
187 Ga0400490_01380 3300038726 Bacteria 17855
188 Ga0400490_16854 3300038726 Bacteria 31241
189 Ga0400490_17851 3300038726 Bacteria 80099
190 Ga0400490_18506 3300038726 Bacteria 8490
191 Ga0400490_21081 3300038726 Bacteria 20811
192 Ga0400490_57831 3300038726 Bacteria 2893
193 Ga0400491_15001 3300038727 Unclassified 2249
194 Ga0400485_07339 3300038735 Bacteria 141809
195 Ga0400485_10117 3300038735 Bacteria 13780
196 Ga0400488_01435 3300038741 Bacteria 2657
197 Ga0400488_43949 3300038741 Bacteria 36927
198 Ga0400488_54702 3300038741 Bacteria 4071
199 Ga0400486_11987 3300038742 Bacteria 2055
200 Ga0400486_14851 3300038742 Bacteria 63108
201 Ga0400486_17707 3300038742 Bacteria 1526
202 Ga0400486_19415 3300038742 Bacteria 158382
203 Ga0400483_045075 3300039062 Bacteria 1982
204 Ga0400483_069992 3300039062 Bacteria 3921
205 Ga0400483_092704 3300039062 Bacteria 2841
206 Ga0400483_103776 3300039062 Bacteria 10786
207 Ga0400483_125572 3300039062 Bacteria 15747
208 Ga0400483_171745 3300039062 Bacteria 13349
209 Ga0400483_180116 3300039062 Bacteria 3957
210 Ga0400483_180445 3300039062 Bacteria 3540
211 Ga0400483_220289 3300039062 Bacteria 5219
212 Ga0400483_227381 3300039062 Bacteria 2675
213 Ga0400483_261934 3300039062 Bacteria 25516
214 Ga0400483_288143 3300039062 Bacteria 14000
215 Ga0400487_17923 3300039110 Bacteria 5482
216 Ga0400487_21430 3300039110 Bacteria 187786
217 Ga0400487_21833 3300039110 Bacteria 12695
218 Ga0400487_25658 3300039110 Bacteria 81592
219 Ga0400487_35136 3300039110 Bacteria 3051
220 Ga0400487_56312 3300039110 Bacteria 61240
221 Ga0400487_63993 3300039110 Bacteria 2223
222 Ga0436365_0579492 3300039437 Bacteria 1706
223 Ga0451577_0000631 3300042876 Bacteria 56417
224 Ga0466963_0015822 3300044694 Bacteria 4681
225 Ga0453684_0000642 3300044712 Bacteria 126116
226 Ga0453684_0026136 3300044712 Bacteria 8448
227 Ga0453684_0121800 3300044712 Bacteria 3148
228 Ga0453684_0159379 3300044712 Bacteria 2671
229 Ga0451576_0000174 3300045051 Bacteria 162062
230 Ga0451576_0049189 3300045051 Bacteria 4425
231 Ga0495625_0042618 3300046660 Bacteria 3297
232 Ga0495613_0051829 3300046689 Bacteria 3024
233 Ga0496119_0094522 3300048922 Bacteria 1691
234 Ga0501032_0119195 3300049569 Bacteria 1745
235 Ga0501033_0167997 3300049570 Bacteria 1576
236 Ga0501034_0004961 3300049571 Bacteria 14650
237 Ga0501034_0017168 3300049571 Bacteria 7426
238 Ga0501036_0089242 3300049572 Bacteria 2605
239 Ga0501037_0011447 3300049573 Bacteria 6530
240 Ga0501037_0021691 3300049573 Bacteria 4750
241 Ga0501037_0094909 3300049573 Bacteria 2156
242 Ga0501038_0035724 3300049574 Bacteria 4362
243 Ga0501038_0334241 3300049574 Bacteria 1183
244 Ga0501039_0012905 3300049575 Bacteria 6389
245 Ga0501039_0042406 3300049575 Bacteria 3516
246 Ga0501040_0000004 3300049576 Bacteria 101867
247 Ga0501040_0090047 3300049576 Bacteria 2132
248 Ga0501042_0002638 3300049578 Bacteria 11025
249 Ga0501043_0064249 3300049579 Bacteria 2882
250 Ga0501043_0146682 3300049579 Bacteria 1847
251 Ga0501046_0001861 3300049580 Bacteria 20092
252 Ga0501047_0001131 3300049581 Bacteria 26475
253 Ga0501047_0047445 3300049581 Bacteria 4150
254 Ga0501047_0093116 3300049581 Bacteria 2892
255 Ga0501068_0001496 3300049584 Bacteria 12438
256 Ga0501070_0010248 3300049586 Bacteria 7930
257 Ga0501070_0011331 3300049586 Bacteria 7534
258 Ga0501070_0011734 3300049586 Bacteria 7401
259 Ga0501070_0208993 3300049586 Bacteria 1602
260 Ga0501072_0007941 3300049588 Bacteria 8056
261 Ga0501072_0092112 3300049588 Bacteria 2407
262 Ga0501073_0010945 3300049589 Bacteria 6636
263 Ga0501074_0017972 3300049590 Bacteria 5137
264 Ga0501076_0061068 3300049592 Bacteria 2999
265 Ga0501079_0010873 3300049741 Bacteria 6931
266 Ga0501080_0005922 3300049742 Bacteria 10952
267 Ga0501080_0013315 3300049742 Bacteria 7559
268 Ga0501080_0040892 3300049742 Bacteria 4323
269 Ga0501080_0157599 3300049742 Bacteria 2097
270 Ga0501081_0007511 3300049743 Bacteria 7069
271 Ga0501083_0021320 3300049744 Bacteria 4502
272 Ga0501035_0065256 3300049822 Bacteria 3234
273 Ga0501035_0261013 3300049822 Bacteria 1468
274 Ga0501044_0091929 3300049823 Bacteria 3060
275 nmdc:mga09592_15855_c1 3300050508 Bacteria 6158
276 nmdc:mga08y16_3748_c1 3300050511 Bacteria 15830
277 Ga0501082_0363811 3300060353 Bacteria 1262

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0181368 Ga0395900_0181368_1146_2057 303
2 3300038726 Ga0400490_01380 Ga0400490_01380_1780_2928 324
3 3300038727 Ga0400491_15001 Ga0400491_15001_195_1343 324
4 3300037418 Ga0395900_0034234 Ga0395900_0034234_2039_3097 328
5 3300039062 Ga0400483_180116 Ga0400483_180116_22_1023 329
6 iso_pu_bacteria 2639762793 2640736489 329
7 3300037312 Ga0395899_0014493 Ga0395899_0014493_3031_4035 333
8 3300049586 Ga0501070_0011331 Ga0501070_0011331_5071_6177 336
9 3300049742 Ga0501080_0040892 Ga0501080_0040892_1999_3105 336
10 3300049588 Ga0501072_0092112 Ga0501072_0092112_73_1098 338
11 3300031240 Ga0265320_10018882 Ga0265320_100188824 339
12 3300031727 Ga0316576_10002589 Ga0316576_100025894 340
13 3300031728 Ga0316578_10003018 Ga0316578_100030184 340
14 3300032139 Ga0316580_10006021 Ga0316580_100060212 340
15 3300035398 Ga0316574_0006557 Ga0316574_0006557_2527_3549 340
16 3300036712 Ga0316584_0045849 Ga0316584_0045849_2042_3064 340
17 3300048922 Ga0496119_0094522 Ga0496119_0094522_152_1201 342
18 3300025935 Ga0207709_10122819 Ga0207709_101228192 343
19 3300035170 Ga0373943_0031628 Ga0373943_0031628_882_1997 344
20 3300049570 Ga0501033_0167997 Ga0501033_0167997_486_1553 346
21 3300049573 Ga0501037_0094909 Ga0501037_0094909_55_1122 346
22 3300049579 Ga0501043_0146682 Ga0501043_0146682_491_1558 346
23 3300049581 Ga0501047_0093116 Ga0501047_0093116_65_1132 346
24 3300049822 Ga0501035_0261013 Ga0501035_0261013_358_1425 346
25 3300060353 Ga0501082_0363811 Ga0501082_0363811_130_1197 346
26 3300037466 Ga0395898_0021353 Ga0395898_0021353_932_1978 347
27 3300005445 Ga0070708_100059913 Ga0070708_1000599133 349
28 3300005339 Ga0070660_100013286 Ga0070660_1000132865 350
29 3300005518 Ga0070699_100034705 Ga0070699_1000347052 350
30 3300005563 Ga0068855_100155744 Ga0068855_1001557442 350
31 3300009545 Ga0105237_10000129 Ga0105237_1000012940 350
32 3300009551 Ga0105238_10018273 Ga0105238_100182736 350
33 3300025914 Ga0207671_10000283 Ga0207671_1000028344 350
34 3300025919 Ga0207657_10024592 Ga0207657_100245925 350
35 3300025924 Ga0207694_10009506 Ga0207694_100095064 350
36 3300037418 Ga0395900_0003351 Ga0395900_0003351_11767_12822 350
37 3300037418 Ga0395900_0041421 Ga0395900_0041421_574_1629 350
38 3300037466 Ga0395898_0093059 Ga0395898_0093059_502_1557 350
39 3300037471 Ga0395905_0072858 Ga0395905_0072858_637_1692 350
40 3300037471 Ga0395905_0080836 Ga0395905_0080836_63_1118 350
41 3300038443 Ga0395901_0014294 Ga0395901_0014294_4519_5574 350
42 3300038443 Ga0395901_0017086 Ga0395901_0017086_821_1876 350
43 3300044694 Ga0466963_0015822 Ga0466963_0015822_279_1331 350
44 3300005937 Ga0081455_10014355 Ga0081455_100143553 351
45 3300009148 Ga0105243_10057861 Ga0105243_100578612 351
46 3300009553 Ga0105249_10004009 Ga0105249_100040096 351
47 3300013306 Ga0163162_10149942 Ga0163162_101499422 351
48 3300005340 Ga0070689_100263404 Ga0070689_1002634042 352
49 3300005458 Ga0070681_10274519 Ga0070681_102745192 352
50 3300013105 Ga0157369_10403143 Ga0157369_104031432 352
51 3300021388 Ga0213875_10001799 Ga0213875_100017994 352
52 3300025912 Ga0207707_10217672 Ga0207707_102176721 352
53 3300031548 Ga0307408_100010011 Ga0307408_1000100112 352
54 3300031548 Ga0307408_100172995 Ga0307408_1001729952 352
55 3300031712 Ga0265342_10065167 Ga0265342_100651672 352
56 3300032002 Ga0307416_100212986 Ga0307416_1002129862 352
57 3300037853 Ga0436364_0562688 Ga0436364_0562688_14836_15900 352
58 3300046689 Ga0495613_0051829 Ga0495613_0051829_18_1100 352
59 3300049586 Ga0501070_0011734 Ga0501070_0011734_4183_5253 354
60 3300005327 Ga0070658_10007922 Ga0070658_100079228 355
61 3300031595 Ga0265313_10002370 Ga0265313_100023708 355
62 3300031727 Ga0316576_10075662 Ga0316576_100756622 355
63 3300035398 Ga0316574_0008976 Ga0316574_0008976_914_1987 355
64 3300031665 Ga0316575_10001767 Ga0316575_100017673 358
65 3300031665 Ga0316575_10008292 Ga0316575_100082921 358
66 3300031691 Ga0316579_10000910 Ga0316579_100009107 358
67 3300031691 Ga0316579_10001147 Ga0316579_100011472 358
68 3300031728 Ga0316578_10001514 Ga0316578_100015147 358
69 3300031728 Ga0316578_10074996 Ga0316578_100749961 358
70 3300031728 Ga0316578_10201784 Ga0316578_102017841 358
71 3300031733 Ga0316577_10008533 Ga0316577_100085332 358
72 3300031733 Ga0316577_10037474 Ga0316577_100374741 358
73 3300032133 Ga0316583_10000184 Ga0316583_100001845 358
74 3300032133 Ga0316583_10007102 Ga0316583_100071022 358
75 3300032137 Ga0316585_10000219 Ga0316585_100002195 358
76 3300032168 Ga0316593_10001861 Ga0316593_100018613 358
77 3300032168 Ga0316593_10006473 Ga0316593_100064733 358
78 3300032168 Ga0316593_10015447 Ga0316593_100154472 358
79 3300032168 Ga0316593_10025631 Ga0316593_100256312 358
80 3300032168 Ga0316593_10053891 Ga0316593_100538911 358
81 3300033541 Ga0316596_1002468 Ga0316596_10024683 358
82 3300033541 Ga0316596_1031876 Ga0316596_10318762 358
83 3300035398 Ga0316574_0041700 Ga0316574_0041700_1670_2749 358
84 3300036647 Ga0316582_0004033 Ga0316582_0004033_3083_4162 358
85 3300036647 Ga0316582_0004214 Ga0316582_0004214_5952_7028 358
86 3300036647 Ga0316582_0028779 Ga0316582_0028779_820_1899 358
87 3300036647 Ga0316582_0037280 Ga0316582_0037280_1745_2824 358
88 3300036647 Ga0316582_0047110 Ga0316582_0047110_546_1625 358
89 3300036647 Ga0316582_0105037 Ga0316582_0105037_315_1397 358
90 3300036647 Ga0316582_0154583 Ga0316582_0154583_29_1108 358
91 3300036712 Ga0316584_0002751 Ga0316584_0002751_4204_5283 358
92 3300036712 Ga0316584_0004632 Ga0316584_0004632_7492_8571 358
93 3300036712 Ga0316584_0010538 Ga0316584_0010538_4327_5406 358
94 3300036712 Ga0316584_0016614 Ga0316584_0016614_4032_5111 358
95 3300036712 Ga0316584_0017374 Ga0316584_0017374_4063_5142 358
96 3300036712 Ga0316584_0024473 Ga0316584_0024473_556_1632 358
97 3300039110 Ga0400487_17923 Ga0400487_17923_231_1313 358
98 3300044712 Ga0453684_0026136 Ga0453684_0026136_4776_5852 358
99 3300049569 Ga0501032_0119195 Ga0501032_0119195_373_1455 358
100 3300049573 Ga0501037_0011447 Ga0501037_0011447_666_1748 358
101 3300049573 Ga0501037_0021691 Ga0501037_0021691_2717_3799 358
102 3300049574 Ga0501038_0035724 Ga0501038_0035724_1412_2494 358
103 3300049575 Ga0501039_0042406 Ga0501039_0042406_1893_2975 358
104 3300049580 Ga0501046_0001861 Ga0501046_0001861_18398_19480 358
105 3300049586 Ga0501070_0010248 Ga0501070_0010248_15_1097 358
106 3300049590 Ga0501074_0017972 Ga0501074_0017972_3356_4438 358
107 3300049742 Ga0501080_0013315 Ga0501080_0013315_4996_6078 358
108 3300031251 Ga0265327_10012829 Ga0265327_100128294 359
109 3300036647 Ga0316582_0078990 Ga0316582_0078990_307_1392 359
110 iso_pu_bacteria 2894510363 2894511920 360
111 iso_pu_bacteria 2989392574 2989394589 360
112 iso_pu_bacteria 8001522603 8001522901 360
113 3300038742 Ga0400486_11987 Ga0400486_11987_903_1994 361
114 3300045051 Ga0451576_0000174 Ga0451576_0000174_24685_25770 361
115 3300036647 Ga0316582_0073375 Ga0316582_0073375_946_2088 364
116 3300042876 Ga0451577_0000631 Ga0451577_0000631_18424_19518 364
117 3300044712 Ga0453684_0000642 Ga0453684_0000642_108976_110070 364
118 3300044712 Ga0453684_0159379 Ga0453684_0159379_646_1740 364
119 3300005330 Ga0070690_100040238 Ga0070690_1000402383 366
120 3300005336 Ga0070680_100244169 Ga0070680_1002441692 366
121 3300005340 Ga0070689_100038413 Ga0070689_1000384131 366
122 3300005441 Ga0070700_100083704 Ga0070700_1000837041 366
123 3300005444 Ga0070694_100170082 Ga0070694_1001700822 366
124 3300005459 Ga0068867_100061404 Ga0068867_1000614042 366
125 3300005544 Ga0070686_100025262 Ga0070686_1000252624 366
126 3300005545 Ga0070695_100203298 Ga0070695_1002032981 366
127 3300005546 Ga0070696_100011788 Ga0070696_1000117882 366
128 3300005549 Ga0070704_100243550 Ga0070704_1002435502 366
129 3300005615 Ga0070702_100015894 Ga0070702_1000158944 366
130 3300005718 Ga0068866_10002287 Ga0068866_100022872 366
131 3300005719 Ga0068861_100007736 Ga0068861_1000077366 366
132 3300005842 Ga0068858_100073010 Ga0068858_1000730102 366
133 3300006237 Ga0097621_100002530 Ga0097621_10000253010 366
134 3300006358 Ga0068871_100313439 Ga0068871_1003134391 366
135 3300006881 Ga0068865_100005871 Ga0068865_1000058717 366
136 3300009098 Ga0105245_10015997 Ga0105245_100159976 366
137 3300009148 Ga0105243_10101510 Ga0105243_101015102 366
138 3300013297 Ga0157378_10003568 Ga0157378_100035682 366
139 3300013308 Ga0157375_10054362 Ga0157375_100543624 366
140 3300021384 Ga0213876_10081639 Ga0213876_100816392 366
141 3300025917 Ga0207660_10238687 Ga0207660_102386872 366
142 3300025927 Ga0207687_10008031 Ga0207687_100080312 366
143 3300025934 Ga0207686_10290595 Ga0207686_102905951 366
144 3300025936 Ga0207670_10303879 Ga0207670_103038791 366
145 3300025938 Ga0207704_10001803 Ga0207704_1000180310 366
146 3300025942 Ga0207689_10002776 Ga0207689_100027764 366
147 3300026075 Ga0207708_10094579 Ga0207708_100945792 366
148 3300026118 Ga0207675_100008406 Ga0207675_1000084062 366
149 3300026121 Ga0207683_10028830 Ga0207683_100288304 366
150 3300028380 Ga0268265_10355901 Ga0268265_103559011 366
151 3300039437 Ga0436365_0579492 Ga0436365_0579492_393_1493 366
152 3300006844 Ga0075428_100000559 Ga0075428_10000055920 368
153 3300006880 Ga0075429_100013597 Ga0075429_1000135975 368
154 3300009094 Ga0111539_10001017 Ga0111539_100010179 368
155 3300027907 Ga0207428_10006780 Ga0207428_100067802 368
156 3300049574 Ga0501038_0334241 Ga0501038_0334241_14_1129 368
157 3300049584 Ga0501068_0001496 Ga0501068_0001496_8899_10014 368
158 3300049589 Ga0501073_0010945 Ga0501073_0010945_4395_5510 368
159 3300049742 Ga0501080_0005922 Ga0501080_0005922_6186_7301 368
160 3300049744 Ga0501083_0021320 Ga0501083_0021320_1077_2192 368
161 3300050508 nmdc:mga09592_15855_c1 nmdc:mga09592_15855_c1_1890_3008 368
162 3300050511 nmdc:mga08y16_3748_c1 nmdc:mga08y16_3748_c1_9586_10704 368
163 3300038735 Ga0400485_07339 Ga0400485_07339_96867_97982 369
164 3300038742 Ga0400486_19415 Ga0400486_19415_57199_58314 369
165 3300039062 Ga0400483_103776 Ga0400483_103776_4390_5505 369
166 3300039062 Ga0400483_227381 Ga0400483_227381_80_1195 369
167 3300039062 Ga0400483_288143 Ga0400483_288143_1423_2538 369
168 3300039110 Ga0400487_21430 Ga0400487_21430_89873_90988 369
169 3300039110 Ga0400487_56312 Ga0400487_56312_13601_14716 369
170 3300049571 Ga0501034_0004961 Ga0501034_0004961_4564_5682 369
171 3300049571 Ga0501034_0017168 Ga0501034_0017168_866_1984 369
172 3300049588 Ga0501072_0007941 Ga0501072_0007941_4174_5292 369
173 3300005341 Ga0070691_10115425 Ga0070691_101154251 370
174 3300005545 Ga0070695_100159730 Ga0070695_1001597302 370
175 3300006846 Ga0075430_100017282 Ga0075430_1000172823 370
176 3300006847 Ga0075431_100007255 Ga0075431_1000072552 370
177 3300009094 Ga0111539_10072584 Ga0111539_100725842 370
178 3300031901 Ga0307406_10055950 Ga0307406_100559502 370
179 3300031995 Ga0307409_100116421 Ga0307409_1001164212 370
180 3300032004 Ga0307414_10207727 Ga0307414_102077272 370
181 3300045051 Ga0451576_0049189 Ga0451576_0049189_2499_3620 370
182 3300049572 Ga0501036_0089242 Ga0501036_0089242_392_1513 370
183 3300049575 Ga0501039_0012905 Ga0501039_0012905_483_1604 370
184 3300049576 Ga0501040_0090047 Ga0501040_0090047_66_1187 370
185 3300049579 Ga0501043_0064249 Ga0501043_0064249_65_1186 370
186 3300049592 Ga0501076_0061068 Ga0501076_0061068_1113_2234 370
187 3300049741 Ga0501079_0010873 Ga0501079_0010873_3284_4405 370
188 3300049742 Ga0501080_0157599 Ga0501080_0157599_933_2054 370
189 3300049743 Ga0501081_0007511 Ga0501081_0007511_5053_6174 370
190 3300005545 Ga0070695_100028816 Ga0070695_1000288162 371
191 3300005546 Ga0070696_100061382 Ga0070696_1000613822 371
192 3300005547 Ga0070693_100070249 Ga0070693_1000702492 371
193 3300013297 Ga0157378_10100944 Ga0157378_101009442 371
194 3300026075 Ga0207708_10086339 Ga0207708_100863392 371
195 3300028573 Ga0265334_10000856 Ga0265334_1000085611 371
196 3300038726 Ga0400490_17851 Ga0400490_17851_52150_53292 371
197 3300049581 Ga0501047_0047445 Ga0501047_0047445_1749_2873 371
198 3300049586 Ga0501070_0208993 Ga0501070_0208993_307_1431 371
199 3300027364 Ga0209967_1001621 Ga0209967_10016213 373
200 3300027876 Ga0209974_10001997 Ga0209974_100019974 373
201 3300039110 Ga0400487_21833 Ga0400487_21833_11326_12471 373
202 3300049581 Ga0501047_0001131 Ga0501047_0001131_9314_10489 374
203 3300049822 Ga0501035_0065256 Ga0501035_0065256_166_1341 374
204 3300049823 Ga0501044_0091929 Ga0501044_0091929_1741_2916 374
205 iso_pu_bacteria 2551306352 2552746466 375
206 iso_pu_bacteria 2643221665 2644364270 375
207 iso_pu_bacteria 2675903507 2678229709 375
208 iso_pu_bacteria 2744054655 2745160411 375
209 iso_pu_bacteria 2773857761 2774391403 375
210 iso_pu_bacteria 2773857770 2774436138 375
211 iso_pu_bacteria 2916699645 2916700399 375
212 iso_pu_bacteria 2919182534 2919185192 375
213 iso_pu_bacteria 2919506607 2919509186 375
214 iso_pu_bacteria 2928515477 2928516666 375
215 iso_pu_bacteria 2984568884 2984571157 375
216 iso_pu_bacteria 8033232454 8033233321 375
217 3300031691 Ga0316579_10000057 Ga0316579_1000005726 378
218 3300031727 Ga0316576_10187163 Ga0316576_101871632 378
219 3300031728 Ga0316578_10073879 Ga0316578_100738792 378
220 3300031733 Ga0316577_10130798 Ga0316577_101307982 378
221 3300032133 Ga0316583_10008647 Ga0316583_100086473 378
222 3300032137 Ga0316585_10003654 Ga0316585_100036541 378
223 3300032139 Ga0316580_10022748 Ga0316580_100227481 378
224 3300032168 Ga0316593_10000630 Ga0316593_100006303 378
225 3300032168 Ga0316593_10000899 Ga0316593_100008993 378
226 3300032168 Ga0316593_10021564 Ga0316593_100215642 378
227 3300033541 Ga0316596_1031857 Ga0316596_10318571 378
228 3300035398 Ga0316574_0000325 Ga0316574_0000325_13462_14601 378
229 3300035398 Ga0316574_0031918 Ga0316574_0031918_29_1174 378
230 3300035398 Ga0316574_0071769 Ga0316574_0071769_924_2066 378
231 3300036647 Ga0316582_0009043 Ga0316582_0009043_871_2016 378
232 3300036647 Ga0316582_0022613 Ga0316582_0022613_2231_3373 378
233 3300036647 Ga0316582_0028967 Ga0316582_0028967_243_1388 378
234 3300036647 Ga0316582_0035420 Ga0316582_0035420_1408_2550 378
235 3300036712 Ga0316584_0001942 Ga0316584_0001942_5871_7013 378
236 3300037588 Ga0316581_0001174 Ga0316581_0001174_2739_3881 378
237 3300037588 Ga0316581_0002108 Ga0316581_0002108_1185_2327 378
238 3300038725 Ga0400484_06228 Ga0400484_06228_2034_3182 378
239 3300038725 Ga0400484_08193 Ga0400484_08193_3658_4812 378
240 3300038725 Ga0400484_08491 Ga0400484_08491_254_1396 378
241 3300038725 Ga0400484_27754 Ga0400484_27754_156_1304 378
242 3300038725 Ga0400484_34430 Ga0400484_34430_341_1489 378
243 3300038725 Ga0400484_40863 Ga0400484_40863_1353_2501 378
244 3300038726 Ga0400490_16854 Ga0400490_16854_16280_17422 378
245 3300038726 Ga0400490_18506 Ga0400490_18506_3025_4170 378
246 3300038726 Ga0400490_21081 Ga0400490_21081_4562_5704 378
247 3300038726 Ga0400490_57831 Ga0400490_57831_273_1418 378
248 3300038735 Ga0400485_10117 Ga0400485_10117_9023_10165 378
249 3300038741 Ga0400488_01435 Ga0400488_01435_688_1830 378
250 3300038741 Ga0400488_43949 Ga0400488_43949_24893_26047 378
251 3300038741 Ga0400488_54702 Ga0400488_54702_2811_3962 378
252 3300038742 Ga0400486_14851 Ga0400486_14851_49736_50878 378
253 3300038742 Ga0400486_17707 Ga0400486_17707_21_1166 378
254 3300039062 Ga0400483_045075 Ga0400483_045075_609_1751 378
255 3300039062 Ga0400483_069992 Ga0400483_069992_1373_2521 378
256 3300039062 Ga0400483_092704 Ga0400483_092704_167_1309 378
257 3300039062 Ga0400483_125572 Ga0400483_125572_5522_6712 378
258 3300039062 Ga0400483_171745 Ga0400483_171745_12143_13294 378
259 3300039062 Ga0400483_180445 Ga0400483_180445_655_1797 378
260 3300039062 Ga0400483_220289 Ga0400483_220289_3300_4448 378
261 3300039062 Ga0400483_261934 Ga0400483_261934_18437_19582 378
262 3300039110 Ga0400487_25658 Ga0400487_25658_19308_20456 378
263 3300039110 Ga0400487_35136 Ga0400487_35136_1240_2382 378
264 3300039110 Ga0400487_63993 Ga0400487_63993_532_1674 378
265 3300044712 Ga0453684_0121800 Ga0453684_0121800_745_1890 378
266 3300049576 Ga0501040_0000004 Ga0501040_0000004_44475_45614 378
267 3300049578 Ga0501042_0002638 Ga0501042_0002638_1284_2423 378
268 3300003856 Ga0058692_1000067 Ga0058692_100006739 379
269 3300005272 Ga0065703_1000511 Ga0065703_100051119 379
270 3300005335 Ga0070666_10145586 Ga0070666_101455861 379
271 3300005353 Ga0070669_100001915 Ga0070669_1000019157 379
272 3300005548 Ga0070665_100003315 Ga0070665_10000331512 379
273 3300006177 Ga0075362_10021922 Ga0075362_100219222 379
274 3300009011 Ga0105251_10006108 Ga0105251_100061086 379
275 3300009036 Ga0105244_10018855 Ga0105244_100188553 379
276 3300009093 Ga0105240_10004415 Ga0105240_1000441517 379
277 3300009101 Ga0105247_10011987 Ga0105247_100119873 379
278 3300009148 Ga0105243_10000263 Ga0105243_1000026356 379
279 3300009553 Ga0105249_10000815 Ga0105249_100008158 379
280 3300013102 Ga0157371_10001415 Ga0157371_1000141511 379
281 3300025711 Ga0207696_1002017 Ga0207696_10020172 379
282 3300025728 Ga0207655_1000535 Ga0207655_10005353 379
283 3300025728 Ga0207655_1021376 Ga0207655_10213762 379
284 3300025728 Ga0207655_1021381 Ga0207655_10213812 379
285 3300025735 Ga0207713_1003888 Ga0207713_10038885 379
286 3300025900 Ga0207710_10000183 Ga0207710_1000018341 379
287 3300025923 Ga0207681_10000497 Ga0207681_100004977 379
288 3300025935 Ga0207709_10000158 Ga0207709_1000015840 379
289 3300025961 Ga0207712_10000619 Ga0207712_1000061919 379
290 3300027312 Ga0209371_1000196 Ga0209371_100019640 379
291 3300028379 Ga0268266_10005441 Ga0268266_100054418 379
292 3300030500 Ga0268256_1000158 Ga0268256_100015853 379
293 3300046660 Ga0495625_0042618 Ga0495625_0042618_523_1662 379

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

56

372

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cgq-assembly1.cif.gz_A threonine synthase from bacillus subtilis atcc 6633 with plp and plp-ala 0.9318 9 373
2d1f-assembly1.cif.gz_B structure of mycobacterium tuberculosis threonine synthase 0.9284 6 372
6cgq-assembly1.cif.gz_A threonine synthase from bacillus subtilis atcc 6633 with plp and plp-ala 0.9264 9 373
2d1f-assembly1.cif.gz_B structure of mycobacterium tuberculosis threonine synthase 0.9207 6 372
3aey-assembly1.cif.gz_B apo form of threonine synthase from thermus thermophilus hb8 0.9177 9 372
ID Description Score Start End Superfamily
2d1fB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9268 6 372 3.40.50.1100
2d1fB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9162 6 372 3.40.50.1100
2d1fA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8953 65 158 3.40.50.1100
af_Q86AP7_760_862_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8936 65 154 3.40.50.1100
af_Q2G0V4_40_140_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.873 67 158 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A7J6Z2V0-F1-model_v4 deleted 0.9788 11 372
AF-A0A3R9S0X4-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9674 126 326
AF-A0A418J0E8-F1-model_v4 deleted 0.965 55 198
AF-A0A6N7M372-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9636 6 158 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
GO:0030170
AF-A0A3R9S0X4-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9628 126 326

Feature Viewer

pLDDT pTM Quality
88.93 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map