F390732

General Info

Members Datasets Scaffolds Average Seq Length
292 191 289 225

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100007659|Ga0070680_1000076591
Length 246
Sequence VSLSRPPQVRNIHSNLELEMNIGIIGAGHIGGTLTRRLSELGHNVFVANSRGPESLADLARETGATPVTVDEAARNRDIVIITIPEKNIPKLPRDLFKGVSDDVIVIDTGNYYPQQRDGRIDGIEEGLTESRWMSQQLGRPVVKTFNNIYADHLLRLGRPSGTPGRIALPVAGDDSEAKAKVIKLLDELGFDGVDAGTIDESWKQQPGTPVYATDLDADGVKKALSKATKERTPEWRAATAKATQP

Samples

Sample ID Description Type Environment
1 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
2 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
79 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
147 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
187 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
191 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.52
Metatranscriptomes 4.45
Isolates 1.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.34
Rhizoplane 5.14
Rhizosphere 92.47
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10001548 3300002075 Bacteria 6345
2 JGI24751J29686_10000418 3300002459 Bacteria 13373
3 rootL2_10334473 3300003322 Unclassified 1025
4 rootH1_10147440 3300003323 Bacteria 1649
5 Ga0065712_10165183 3300005290 Bacteria 1277
6 Ga0065715_10132142 3300005293 Bacteria 1995
7 Ga0065715_10142912 3300005293 Bacteria 1819
8 Ga0065715_10232166 3300005293 Bacteria 1201
9 Ga0065715_10236207 3300005293 Bacteria 1212
10 Ga0065707_10215083 3300005295 Bacteria 1243
11 Ga0070670_100000084 3300005331 Bacteria 90455
12 Ga0070680_100000417 3300005336 Bacteria 29035
13 Ga0070680_100007659 3300005336 Bacteria 8239
14 Ga0070680_100015523 3300005336 Bacteria 5974
15 Ga0070680_100022743 3300005336 Bacteria 4994
16 Ga0070660_100021772 3300005339 Bacteria 4731
17 Ga0070691_10084643 3300005341 Bacteria 1557
18 Ga0070687_100545360 3300005343 Bacteria 788
19 Ga0070661_100022559 3300005344 Bacteria 4507
20 Ga0070669_100102816 3300005353 Bacteria 2158
21 Ga0070673_100007869 3300005364 Bacteria 7063
22 Ga0070659_100700411 3300005366 Bacteria 876
23 Ga0070709_10009321 3300005434 Bacteria 5409
24 Ga0070714_100010695 3300005435 Bacteria 7261
25 Ga0070714_100107707 3300005435 Unclassified 2463
26 Ga0070701_10007169 3300005438 Bacteria 4742
27 Ga0070701_10076621 3300005438 Bacteria 1800
28 Ga0070711_100215623 3300005439 Bacteria 1489
29 Ga0070700_100037480 3300005441 Unclassified 2949
30 Ga0070663_100090589 3300005455 Unclassified 2265
31 Ga0070681_10000328 3300005458 Bacteria 38769
32 Ga0070681_10153006 3300005458 Bacteria 2232
33 Ga0070681_10528484 3300005458 Bacteria 1093
34 Ga0070707_100333356 3300005468 Bacteria 1474
35 Ga0070679_100000491 3300005530 Bacteria 33649
36 Ga0070679_100034877 3300005530 Bacteria 4990
37 Ga0070679_100038347 3300005530 Bacteria 4763
38 Ga0070684_100017970 3300005535 Bacteria 5814
39 Ga0068853_100018598 3300005539 Bacteria 5753
40 Ga0068853_100370614 3300005539 Bacteria 1336
41 Ga0068853_100822829 3300005539 Bacteria 890
42 Ga0070672_100226007 3300005543 Bacteria 1571
43 Ga0070695_100114199 3300005545 Bacteria 1838
44 Ga0070696_100024812 3300005546 Bacteria 4074
45 Ga0070696_100415129 3300005546 Bacteria 1055
46 Ga0070696_100561707 3300005546 Bacteria 916
47 Ga0070693_100007181 3300005547 Bacteria 5435
48 Ga0070693_100054502 3300005547 Bacteria 2300
49 Ga0070693_100085283 3300005547 Unclassified 1892
50 Ga0068855_100194963 3300005563 Unclassified 2282
51 Ga0070664_100516698 3300005564 Bacteria 1102
52 Ga0068857_100631232 3300005577 Bacteria 1014
53 Ga0068854_100032713 3300005578 Bacteria 3620
54 Ga0068854_100396497 3300005578 Bacteria 1141
55 Ga0068856_100005586 3300005614 Bacteria 12381
56 Ga0068852_100031768 3300005616 Bacteria 4363
57 Ga0068859_100021552 3300005617 Bacteria 6468
58 Ga0068859_100070003 3300005617 Bacteria 3544
59 Ga0068859_100170129 3300005617 Bacteria 2260
60 Ga0068859_100418384 3300005617 Bacteria 1436
61 Ga0068864_100118212 3300005618 Bacteria 2367
62 Ga0068864_100203514 3300005618 Unclassified 1820
63 Ga0068866_10429761 3300005718 Unclassified 859
64 Ga0068858_100024892 3300005842 Bacteria 5572
65 Ga0068858_100321511 3300005842 Bacteria 1479
66 Ga0068860_100045107 3300005843 Bacteria 4203
67 Ga0068860_100092124 3300005843 Bacteria 2888
68 Ga0068862_100340641 3300005844 Bacteria 1389
69 Ga0070717_10589667 3300006028 Unclassified 1008
70 Ga0070716_100051107 3300006173 Bacteria 2348
71 Ga0070712_100689909 3300006175 Bacteria 870
72 Ga0068865_100250724 3300006881 Bacteria 1397
73 Ga0075436_100013115 3300006914 Bacteria 5681
74 Ga0075436_100013356 3300006914 Bacteria 5626
75 Ga0075436_100056720 3300006914 Bacteria 2705
76 Ga0097620_100021553 3300006931 Bacteria 6468
77 Ga0097620_100070004 3300006931 Bacteria 3544
78 Ga0097620_100170139 3300006931 Bacteria 2260
79 Ga0097620_100305817 3300006931 Unclassified 1683
80 Ga0097620_100418372 3300006931 Bacteria 1436
81 Ga0105240_10034003 3300009093 Bacteria 6581
82 Ga0105240_10375498 3300009093 Unclassified 1607
83 Ga0105245_10696965 3300009098 Bacteria 1048
84 Ga0105247_10000485 3300009101 Bacteria 33190
85 Ga0114129_10540020 3300009147 Bacteria 1517
86 Ga0105243_10010280 3300009148 Bacteria 7111
87 Ga0105241_10061181 3300009174 Bacteria 2899
88 Ga0105241_10117740 3300009174 Bacteria 2135
89 Ga0105242_10007007 3300009176 Bacteria 8701
90 Ga0105248_10020551 3300009177 Bacteria 7317
91 Ga0105248_10084795 3300009177 Bacteria 3565
92 Ga0105248_10650790 3300009177 Bacteria 1189
93 Ga0105237_10717216 3300009545 Archaea 1007
94 Ga0105237_10730721 3300009545 Bacteria 996
95 Ga0105238_10004962 3300009551 Bacteria 13157
96 Ga0105238_10057623 3300009551 Bacteria 3895
97 Ga0105249_10007883 3300009553 Bacteria 9278
98 Ga0105239_10633141 3300010375 Unclassified 1221
99 Ga0157373_10056084 3300013100 Bacteria 2798
100 Ga0157369_10038838 3300013105 Bacteria 5204
101 Ga0157369_10284841 3300013105 Bacteria 1721
102 Ga0157378_10236826 3300013297 Bacteria 1742
103 Ga0163162_10080672 3300013306 Bacteria 3322
104 Ga0163162_11194402 3300013306 Bacteria 863
105 Ga0157372_10026521 3300013307 Bacteria 6305
106 Ga0157372_10388233 3300013307 Bacteria 1627
107 Ga0157372_10841861 3300013307 Unclassified 1065
108 Ga0157375_10213372 3300013308 Bacteria 2088
109 Ga0157375_10691669 3300013308 Unclassified 1174
110 Ga0163163_10000964 3300014325 Bacteria 24463
111 Ga0182008_10010143 3300014497 Bacteria 5050
112 Ga0157379_10179439 3300014968 Bacteria 1913
113 Ga0157376_10027716 3300014969 Bacteria 4495
114 Ga0182006_1002374 3300015261 Bacteria 10313
115 Ga0182005_1004417 3300015265 Bacteria 4550
116 Ga0197907_10650211 3300020069 Bacteria 1382
117 Ga0206356_10470557 3300020070 Unclassified 803
118 Ga0206355_1134839 3300020076 Bacteria 1685
119 Ga0206351_10249439 3300020077 Bacteria 2489
120 Ga0206352_11225234 3300020078 Bacteria 1614
121 Ga0206350_10437509 3300020080 Bacteria 1716
122 Ga0206350_10738944 3300020080 Bacteria 10200
123 Ga0206350_10790397 3300020080 Unclassified 878
124 Ga0206354_11213241 3300020081 Bacteria 3620
125 Ga0213873_10000476 3300021358 Bacteria 6448
126 Ga0213876_10035881 3300021384 Bacteria 2615
127 Ga0213871_10001724 3300021441 Bacteria 3788
128 Ga0224712_10002746 3300022467 Bacteria 4426
129 Ga0224712_10022678 3300022467 Bacteria 2168
130 Ga0224712_10031980 3300022467 Bacteria 1914
131 Ga0224712_10090262 3300022467 Bacteria 1282
132 Ga0207710_10001072 3300025900 Bacteria 14113
133 Ga0207647_10113707 3300025904 Bacteria 1600
134 Ga0207699_10007881 3300025906 Bacteria 5224
135 Ga0207643_10345882 3300025908 Bacteria 933
136 Ga0207705_10001502 3300025909 Bacteria 18535
137 Ga0207707_10000330 3300025912 Bacteria 49978
138 Ga0207695_10266240 3300025913 Unclassified 1610
139 Ga0207660_10000304 3300025917 Bacteria 32299
140 Ga0207660_10014019 3300025917 Bacteria 5261
141 Ga0207660_10029810 3300025917 Bacteria 3747
142 Ga0207660_10236702 3300025917 Bacteria 1437
143 Ga0207662_10631961 3300025918 Bacteria 747
144 Ga0207657_10045108 3300025919 Bacteria 3871
145 Ga0207649_10040665 3300025920 Unclassified 2827
146 Ga0207652_10000839 3300025921 Bacteria 29313
147 Ga0207652_10079000 3300025921 Bacteria 2874
148 Ga0207652_10190769 3300025921 Unclassified 1843
149 Ga0207646_10226394 3300025922 Bacteria 1689
150 Ga0207681_10089356 3300025923 Bacteria 2196
151 Ga0207694_10002288 3300025924 Bacteria 15679
152 Ga0207694_10029655 3300025924 Bacteria 4175
153 Ga0207650_10000017 3300025925 Bacteria 354674
154 Ga0207664_10251337 3300025929 Bacteria 1543
155 Ga0207690_10145540 3300025932 Unclassified 1751
156 Ga0207706_10348784 3300025933 Bacteria 1287
157 Ga0207686_10274753 3300025934 Unclassified 1241
158 Ga0207709_10004946 3300025935 Bacteria 7627
159 Ga0207670_10061623 3300025936 Bacteria 2560
160 Ga0207665_10000676 3300025939 Bacteria 23022
161 Ga0207691_10150474 3300025940 Bacteria 2047
162 Ga0207691_10496489 3300025940 Bacteria 1037
163 Ga0207711_10169713 3300025941 Bacteria 1979
164 Ga0207661_10785858 3300025944 Archaea 876
165 Ga0207667_10096526 3300025949 Bacteria 3051
166 Ga0207712_10012283 3300025961 Bacteria 5472
167 Ga0207640_10029033 3300025981 Bacteria 3389
168 Ga0207703_10102874 3300026035 Bacteria 2424
169 Ga0207703_10296020 3300026035 Bacteria 1474
170 Ga0207639_10006574 3300026041 Bacteria 7906
171 Ga0207639_10272414 3300026041 Bacteria 1485
172 Ga0207708_10046310 3300026075 Unclassified 3312
173 Ga0207708_10209305 3300026075 Bacteria 1558
174 Ga0207708_10700389 3300026075 Bacteria 866
175 Ga0207702_10085732 3300026078 Bacteria 2745
176 Ga0207702_10124912 3300026078 Unclassified 2308
177 Ga0207676_10274145 3300026095 Unclassified 1529
178 Ga0207674_10096646 3300026116 Unclassified 2938
179 Ga0207698_10013370 3300026142 Bacteria 5414
180 Ga0268265_10295196 3300028380 Bacteria 1457
181 Ga0268264_10023013 3300028381 Bacteria 5084
182 Ga0268264_10027582 3300028381 Unclassified 4642
183 Ga0307408_100026772 3300031548 Bacteria 3966
184 Ga0307408_100048750 3300031548 Bacteria 3039
185 Ga0307405_10091818 3300031731 Bacteria 2013
186 Ga0307405_10173060 3300031731 Bacteria 1542
187 Ga0307405_10794050 3300031731 Bacteria 792
188 Ga0307413_10540069 3300031824 Bacteria 944
189 Ga0307410_10001136 3300031852 Bacteria 11682
190 Ga0307410_10067995 3300031852 Bacteria 2459
191 Ga0307410_10189962 3300031852 Bacteria 1561
192 Ga0307410_10605282 3300031852 Bacteria 914
193 Ga0307410_10837560 3300031852 Bacteria 784
194 Ga0307406_10095126 3300031901 Bacteria 2015
195 Ga0307407_10018059 3300031903 Bacteria 3557
196 Ga0307407_10029814 3300031903 Bacteria 2936
197 Ga0307412_10004644 3300031911 Bacteria 7652
198 Ga0307412_10100324 3300031911 Bacteria 2046
199 Ga0307412_10177289 3300031911 Bacteria 1599
200 Ga0307409_100003510 3300031995 Bacteria 8542
201 Ga0307409_100175204 3300031995 Bacteria 1892
202 Ga0307409_100957419 3300031995 Bacteria 872
203 Ga0307416_100003047 3300032002 Bacteria 9803
204 Ga0307416_100014624 3300032002 Bacteria 5388
205 Ga0307416_100201288 3300032002 Bacteria 1890
206 Ga0307416_100657936 3300032002 Bacteria 1133
207 Ga0307414_10052396 3300032004 Bacteria 2840
208 Ga0307414_10326443 3300032004 Unclassified 1308
209 Ga0307411_10011368 3300032005 Bacteria 4802
210 Ga0307411_10180272 3300032005 Bacteria 1602
211 Ga0307415_100003638 3300032126 Bacteria 7883
212 Ga0307415_100010261 3300032126 Bacteria 5296
213 Ga0307415_100106462 3300032126 Bacteria 2070
214 Ga0373951_0001997 3300035091 Bacteria 5222
215 Ga0373941_0066939 3300035115 Bacteria 1183
216 Ga0395900_0876538 3300037418 Bacteria 822
217 Ga0395905_0429427 3300037471 Bacteria 1218
218 Ga0395901_0556608 3300038443 Bacteria 1162
219 Ga0242420_027031 3300038996 Bacteria 1050
220 Ga0242420_032705 3300038996 Unclassified 970
221 Ga0436365_0243521 3300039437 Bacteria 4826
222 Ga0436361_0682191 3300039447 Bacteria 1398
223 Ga0436362_0551347 3300039453 Bacteria 47047
224 Ga0439436_0000020 3300041404 Bacteria 66117
225 Ga0439458_0025770 3300042157 Bacteria 1380
226 Ga0451577_0266257 3300042876 Bacteria 1552
227 Ga0466969_0175704 3300044656 Bacteria 981
228 Ga0466965_0084827 3300044683 Bacteria 1605
229 Ga0466965_0199581 3300044683 Bacteria 1061
230 Ga0466966_0003390 3300044684 Bacteria 10511
231 Ga0466966_0336916 3300044684 Bacteria 906
232 Ga0466963_0000704 3300044694 Bacteria 16320
233 Ga0466963_0007934 3300044694 Bacteria 6355
234 Ga0466963_0046953 3300044694 Bacteria 2849
235 Ga0466963_0378987 3300044694 Bacteria 997
236 Ga0466964_0027824 3300044706 Bacteria 2222
237 Ga0466971_0001806 3300044719 Bacteria 9086
238 Ga0466968_0001538 3300044735 Bacteria 8294
239 Ga0466970_0021291 3300044765 Bacteria 3376
240 Ga0466970_0175785 3300044765 Bacteria 1187
241 Ga0466957_0005856 3300044842 Bacteria 6922
242 Ga0466957_0009466 3300044842 Bacteria 5562
243 Ga0466959_0161882 3300045049 Bacteria 1573
244 Ga0466959_0229769 3300045049 Bacteria 1284
245 Ga0466959_0325241 3300045049 Bacteria 1051
246 Ga0451576_0418701 3300045051 Unclassified 1405
247 Ga0451576_1321803 3300045051 Bacteria 751
248 Ga0466958_0008338 3300045836 Bacteria 5743
249 Ga0466958_0041654 3300045836 Bacteria 2763
250 Ga0466958_0091811 3300045836 Bacteria 1880
251 Ga0466958_0142794 3300045836 Bacteria 1508
252 Ga0466967_0240833 3300045976 Unclassified 1726
253 Ga0466967_0269521 3300045976 Bacteria 1631
254 Ga0495651_0007028 3300046462 Bacteria 8612
255 Ga0495606_0153424 3300046507 Bacteria 1350
256 Ga0495608_0155634 3300046511 Bacteria 1455
257 Ga0495610_0014620 3300046512 Bacteria 4602
258 Ga0495667_0025808 3300046559 Bacteria 3958
259 Ga0495670_0005126 3300046691 Bacteria 6442
260 Ga0495649_0027009 3300046694 Bacteria 3187
261 Ga0495687_009359 3300047443 Bacteria 5484
262 Ga0495675_0101903 3300047444 Bacteria 1796
263 Ga0495684_0059149 3300047471 Bacteria 2919
264 Ga0495602_0005263 3300048088 Bacteria 13571
265 Ga0496101_0076781 3300048904 Bacteria 2461
266 Ga0496103_0166155 3300048906 Bacteria 1416
267 Ga0496104_0557659 3300048907 Bacteria 1056
268 Ga0496106_0076672 3300048909 Bacteria 2563
269 Ga0496106_0326329 3300048909 Unclassified 1232
270 Ga0496106_0613693 3300048909 Bacteria 871
271 Ga0496107_0476176 3300048910 Unclassified 927
272 Ga0496108_0032570 3300048911 Bacteria 4330
273 Ga0496108_0139461 3300048911 Unclassified 2089
274 Ga0496108_1176945 3300048911 Bacteria 649
275 Ga0496109_1198420 3300048912 Unclassified 696
276 Ga0496112_0199496 3300048915 Bacteria 1961
277 Ga0496112_1005546 3300048915 Bacteria 754
278 Ga0496113_0289254 3300048916 Bacteria 1311
279 Ga0496115_0275529 3300048918 Bacteria 1382
280 Ga0496119_0026351 3300048922 Bacteria 4032
281 Ga0501068_0214526 3300049584 Bacteria 1223
282 Ga0501069_0094688 3300049585 Bacteria 1690
283 Ga0501249_012942 3300049679 Bacteria 1769
284 Ga0501272_013308 3300049769 Unclassified 942
285 nmdc:mga05p37_456825_c1 3300050507 Bacteria 1477
286 nmdc:mga08x19_2605_c1 3300050514 Bacteria 10945
287 nmdc:mga08x19_36583_c1 3300050514 Bacteria 3110
288 nmdc:mga08x19_49750_c1 3300050514 Bacteria 2689
289 Ga0466962_0000550 3300061719 Bacteria 16549

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0682191 Ga0436361_0682191_795_1376 193
2 3300044694 Ga0466963_0000704 Ga0466963_0000704_6305_6892 195
3 3300044842 Ga0466957_0009466 Ga0466957_0009466_1146_1733 195
4 3300048912 Ga0496109_1198420 Ga0496109_1198420_50_664 204
5 3300044694 Ga0466963_0378987 Ga0466963_0378987_48_710 205
6 3300045836 Ga0466958_0091811 Ga0466958_0091811_1149_1811 205
7 3300037418 Ga0395900_0876538 Ga0395900_0876538_191_811 206
8 3300045049 Ga0466959_0325241 Ga0466959_0325241_277_936 206
9 3300045051 Ga0451576_1321803 Ga0451576_1321803_13_633 206
10 3300048910 Ga0496107_0476176 Ga0496107_0476176_46_666 206
11 3300048911 Ga0496108_1176945 Ga0496108_1176945_18_638 206
12 3300009098 Ga0105245_10696965 Ga0105245_106969651 207
13 3300044735 Ga0466968_0001538 Ga0466968_0001538_6446_7138 213
14 3300048911 Ga0496108_0139461 Ga0496108_0139461_305_988 215
15 3300003323 rootH1_10147440 rootH1_101474401 217
16 3300005336 Ga0070680_100000417 Ga0070680_1000004175 218
17 3300025917 Ga0207660_10000304 Ga0207660_1000030418 218
18 3300038996 Ga0242420_027031 Ga0242420_027031_164_820 218
19 3300045836 Ga0466958_0142794 Ga0466958_0142794_442_1098 218
20 3300005336 Ga0070680_100022743 Ga0070680_1000227435 219
21 3300005339 Ga0070660_100021772 Ga0070660_1000217723 219
22 3300005344 Ga0070661_100022559 Ga0070661_1000225593 219
23 3300005366 Ga0070659_100700411 Ga0070659_1007004111 219
24 3300005435 Ga0070714_100107707 Ga0070714_1001077071 219
25 3300005455 Ga0070663_100090589 Ga0070663_1000905891 219
26 3300005458 Ga0070681_10153006 Ga0070681_101530062 219
27 3300005530 Ga0070679_100038347 Ga0070679_1000383473 219
28 3300005539 Ga0068853_100018598 Ga0068853_1000185983 219
29 3300005547 Ga0070693_100085283 Ga0070693_1000852832 219
30 3300005563 Ga0068855_100194963 Ga0068855_1001949632 219
31 3300005578 Ga0068854_100032713 Ga0068854_1000327132 219
32 3300005616 Ga0068852_100031768 Ga0068852_1000317684 219
33 3300009093 Ga0105240_10034003 Ga0105240_100340033 219
34 3300009551 Ga0105238_10057623 Ga0105238_100576234 219
35 3300013100 Ga0157373_10056084 Ga0157373_100560842 219
36 3300013105 Ga0157369_10284841 Ga0157369_102848412 219
37 3300013307 Ga0157372_10026521 Ga0157372_100265213 219
38 3300020069 Ga0197907_10650211 Ga0197907_106502111 219
39 3300020076 Ga0206355_1134839 Ga0206355_11348392 219
40 3300020077 Ga0206351_10249439 Ga0206351_102494393 219
41 3300020080 Ga0206350_10738944 Ga0206350_107389447 219
42 3300022467 Ga0224712_10022678 Ga0224712_100226782 219
43 3300025909 Ga0207705_10001502 Ga0207705_1000150215 219
44 3300025917 Ga0207660_10014019 Ga0207660_100140192 219
45 3300025919 Ga0207657_10045108 Ga0207657_100451082 219
46 3300025920 Ga0207649_10040665 Ga0207649_100406653 219
47 3300025921 Ga0207652_10190769 Ga0207652_101907691 219
48 3300025924 Ga0207694_10029655 Ga0207694_100296554 219
49 3300025932 Ga0207690_10145540 Ga0207690_101455402 219
50 3300025949 Ga0207667_10096526 Ga0207667_100965263 219
51 3300025981 Ga0207640_10029033 Ga0207640_100290332 219
52 3300026041 Ga0207639_10006574 Ga0207639_100065742 219
53 3300026078 Ga0207702_10124912 Ga0207702_101249122 219
54 3300026142 Ga0207698_10013370 Ga0207698_100133704 219
55 3300005343 Ga0070687_100545360 Ga0070687_1005453601 220
56 3300025918 Ga0207662_10631961 Ga0207662_106319611 220
57 3300042876 Ga0451577_0266257 Ga0451577_0266257_439_1101 220
58 3300044683 Ga0466965_0199581 Ga0466965_0199581_109_771 220
59 3300044694 Ga0466963_0046953 Ga0466963_0046953_179_841 220
60 3300044765 Ga0466970_0175785 Ga0466970_0175785_19_681 220
61 3300045051 Ga0451576_0418701 Ga0451576_0418701_370_1032 220
62 iso_pu_bacteria 8055301274 8055307072 220
63 3300005434 Ga0070709_10009321 Ga0070709_100093215 221
64 3300005439 Ga0070711_100215623 Ga0070711_1002156232 221
65 3300006028 Ga0070717_10589667 Ga0070717_105896671 221
66 3300006173 Ga0070716_100051107 Ga0070716_1000511074 221
67 3300006914 Ga0075436_100013356 Ga0075436_1000133561 221
68 3300025906 Ga0207699_10007881 Ga0207699_100078813 221
69 3300025939 Ga0207665_10000676 Ga0207665_100006763 221
70 3300035115 Ga0373941_0066939 Ga0373941_0066939_133_798 221
71 3300050514 nmdc:mga08x19_36583_c1 nmdc:mga08x19_36583_c1_1465_2130 221
72 3300009177 Ga0105248_10084795 Ga0105248_100847954 222
73 3300013307 Ga0157372_10841861 Ga0157372_108418611 222
74 3300005364 Ga0070673_100007869 Ga0070673_1000078695 224
75 3300047443 Ga0495687_009359 Ga0495687_009359_4157_4846 224
76 3300031731 Ga0307405_10794050 Ga0307405_107940501 225
77 3300031824 Ga0307413_10540069 Ga0307413_105400691 225
78 3300031852 Ga0307410_10189962 Ga0307410_101899622 225
79 3300031995 Ga0307409_100957419 Ga0307409_1009574191 225
80 3300005336 Ga0070680_100015523 Ga0070680_1000155234 226
81 3300005341 Ga0070691_10084643 Ga0070691_100846432 226
82 3300005435 Ga0070714_100010695 Ga0070714_1000106959 226
83 3300005530 Ga0070679_100034877 Ga0070679_1000348775 226
84 3300005543 Ga0070672_100226007 Ga0070672_1002260073 226
85 3300005546 Ga0070696_100024812 Ga0070696_1000248124 226
86 3300005547 Ga0070693_100007181 Ga0070693_1000071813 226
87 3300005618 Ga0068864_100203514 Ga0068864_1002035142 226
88 3300006914 Ga0075436_100013115 Ga0075436_1000131156 226
89 3300009177 Ga0105248_10650790 Ga0105248_106507902 226
90 3300013308 Ga0157375_10213372 Ga0157375_102133723 226
91 3300013308 Ga0157375_10691669 Ga0157375_106916691 226
92 3300025917 Ga0207660_10236702 Ga0207660_102367021 226
93 3300025921 Ga0207652_10079000 Ga0207652_100790003 226
94 3300025929 Ga0207664_10251337 Ga0207664_102513372 226
95 3300025933 Ga0207706_10348784 Ga0207706_103487841 226
96 3300025940 Ga0207691_10496489 Ga0207691_104964892 226
97 3300026075 Ga0207708_10700389 Ga0207708_107003891 226
98 3300028381 Ga0268264_10027582 Ga0268264_100275823 226
99 3300044656 Ga0466969_0175704 Ga0466969_0175704_138_818 226
100 3300044684 Ga0466966_0336916 Ga0466966_0336916_121_801 226
101 3300045049 Ga0466959_0161882 Ga0466959_0161882_46_726 226
102 3300045836 Ga0466958_0041654 Ga0466958_0041654_2057_2737 226
103 3300045976 Ga0466967_0240833 Ga0466967_0240833_326_1006 226
104 3300050514 nmdc:mga08x19_2605_c1 nmdc:mga08x19_2605_c1_2111_2791 226
105 3300002459 JGI24751J29686_10000418 JGI24751J29686_100004185 227
106 3300003322 rootL2_10334473 rootL2_103344732 227
107 3300005290 Ga0065712_10165183 Ga0065712_101651832 227
108 3300005293 Ga0065715_10132142 Ga0065715_101321421 227
109 3300005293 Ga0065715_10142912 Ga0065715_101429122 227
110 3300005293 Ga0065715_10232166 Ga0065715_102321661 227
111 3300005293 Ga0065715_10236207 Ga0065715_102362071 227
112 3300005295 Ga0065707_10215083 Ga0065707_102150832 227
113 3300005331 Ga0070670_100000084 Ga0070670_10000008419 227
114 3300005336 Ga0070680_100007659 Ga0070680_1000076591 227
115 3300005353 Ga0070669_100102816 Ga0070669_1001028162 227
116 3300005438 Ga0070701_10007169 Ga0070701_100071695 227
117 3300005438 Ga0070701_10076621 Ga0070701_100766211 227
118 3300005441 Ga0070700_100037480 Ga0070700_1000374801 227
119 3300005458 Ga0070681_10000328 Ga0070681_1000032810 227
120 3300005458 Ga0070681_10528484 Ga0070681_105284841 227
121 3300005468 Ga0070707_100333356 Ga0070707_1003333561 227
122 3300005530 Ga0070679_100000491 Ga0070679_1000004918 227
123 3300005539 Ga0068853_100370614 Ga0068853_1003706142 227
124 3300005539 Ga0068853_100822829 Ga0068853_1008228291 227
125 3300005545 Ga0070695_100114199 Ga0070695_1001141992 227
126 3300005546 Ga0070696_100415129 Ga0070696_1004151291 227
127 3300005546 Ga0070696_100561707 Ga0070696_1005617071 227
128 3300005547 Ga0070693_100054502 Ga0070693_1000545022 227
129 3300005564 Ga0070664_100516698 Ga0070664_1005166982 227
130 3300005614 Ga0068856_100005586 Ga0068856_1000055862 227
131 3300005617 Ga0068859_100021552 Ga0068859_1000215522 227
132 3300005617 Ga0068859_100070003 Ga0068859_1000700032 227
133 3300005617 Ga0068859_100170129 Ga0068859_1001701293 227
134 3300005617 Ga0068859_100418384 Ga0068859_1004183842 227
135 3300005618 Ga0068864_100118212 Ga0068864_1001182122 227
136 3300005718 Ga0068866_10429761 Ga0068866_104297611 227
137 3300005842 Ga0068858_100024892 Ga0068858_1000248923 227
138 3300005842 Ga0068858_100321511 Ga0068858_1003215112 227
139 3300005843 Ga0068860_100045107 Ga0068860_1000451076 227
140 3300005843 Ga0068860_100092124 Ga0068860_1000921242 227
141 3300005844 Ga0068862_100340641 Ga0068862_1003406411 227
142 3300006881 Ga0068865_100250724 Ga0068865_1002507243 227
143 3300006914 Ga0075436_100056720 Ga0075436_1000567202 227
144 3300006931 Ga0097620_100021553 Ga0097620_1000215533 227
145 3300006931 Ga0097620_100070004 Ga0097620_1000700042 227
146 3300006931 Ga0097620_100170139 Ga0097620_1001701393 227
147 3300006931 Ga0097620_100305817 Ga0097620_1003058171 227
148 3300006931 Ga0097620_100418372 Ga0097620_1004183722 227
149 3300009101 Ga0105247_10000485 Ga0105247_1000048512 227
150 3300009148 Ga0105243_10010280 Ga0105243_100102808 227
151 3300009174 Ga0105241_10061181 Ga0105241_100611812 227
152 3300009174 Ga0105241_10117740 Ga0105241_101177402 227
153 3300009176 Ga0105242_10007007 Ga0105242_100070073 227
154 3300009177 Ga0105248_10020551 Ga0105248_100205513 227
155 3300009545 Ga0105237_10730721 Ga0105237_107307211 227
156 3300009551 Ga0105238_10004962 Ga0105238_100049628 227
157 3300009553 Ga0105249_10007883 Ga0105249_100078833 227
158 3300010375 Ga0105239_10633141 Ga0105239_106331412 227
159 3300013297 Ga0157378_10236826 Ga0157378_102368262 227
160 3300013306 Ga0163162_10080672 Ga0163162_100806722 227
161 3300013306 Ga0163162_11194402 Ga0163162_111944021 227
162 3300013307 Ga0157372_10388233 Ga0157372_103882331 227
163 3300014325 Ga0163163_10000964 Ga0163163_100009645 227
164 3300014968 Ga0157379_10179439 Ga0157379_101794393 227
165 3300025900 Ga0207710_10001072 Ga0207710_1000107212 227
166 3300025904 Ga0207647_10113707 Ga0207647_101137072 227
167 3300025908 Ga0207643_10345882 Ga0207643_103458821 227
168 3300025912 Ga0207707_10000330 Ga0207707_1000033020 227
169 3300025917 Ga0207660_10029810 Ga0207660_100298104 227
170 3300025921 Ga0207652_10000839 Ga0207652_100008393 227
171 3300025922 Ga0207646_10226394 Ga0207646_102263941 227
172 3300025923 Ga0207681_10089356 Ga0207681_100893563 227
173 3300025924 Ga0207694_10002288 Ga0207694_100022886 227
174 3300025925 Ga0207650_10000017 Ga0207650_10000017119 227
175 3300025934 Ga0207686_10274753 Ga0207686_102747532 227
176 3300025935 Ga0207709_10004946 Ga0207709_100049462 227
177 3300025936 Ga0207670_10061623 Ga0207670_100616233 227
178 3300025940 Ga0207691_10150474 Ga0207691_101504741 227
179 3300025941 Ga0207711_10169713 Ga0207711_101697133 227
180 3300025961 Ga0207712_10012283 Ga0207712_100122835 227
181 3300026035 Ga0207703_10102874 Ga0207703_101028743 227
182 3300026035 Ga0207703_10296020 Ga0207703_102960202 227
183 3300026041 Ga0207639_10272414 Ga0207639_102724143 227
184 3300026075 Ga0207708_10046310 Ga0207708_100463102 227
185 3300026075 Ga0207708_10209305 Ga0207708_102093052 227
186 3300026078 Ga0207702_10085732 Ga0207702_100857322 227
187 3300026095 Ga0207676_10274145 Ga0207676_102741452 227
188 3300026116 Ga0207674_10096646 Ga0207674_100966464 227
189 3300028380 Ga0268265_10295196 Ga0268265_102951961 227
190 3300028381 Ga0268264_10023013 Ga0268264_100230135 227
191 3300032002 Ga0307416_100657936 Ga0307416_1006579362 227
192 3300035091 Ga0373951_0001997 Ga0373951_0001997_2280_2963 227
193 3300038996 Ga0242420_032705 Ga0242420_032705_172_855 227
194 3300048906 Ga0496103_0166155 Ga0496103_0166155_451_1134 227
195 3300048907 Ga0496104_0557659 Ga0496104_0557659_215_898 227
196 3300048909 Ga0496106_0076672 Ga0496106_0076672_130_813 227
197 3300048909 Ga0496106_0326329 Ga0496106_0326329_392_1075 227
198 3300048909 Ga0496106_0613693 Ga0496106_0613693_39_722 227
199 3300048911 Ga0496108_0032570 Ga0496108_0032570_1982_2665 227
200 3300048915 Ga0496112_0199496 Ga0496112_0199496_1257_1940 227
201 3300048915 Ga0496112_1005546 Ga0496112_1005546_19_702 227
202 3300048916 Ga0496113_0289254 Ga0496113_0289254_88_771 227
203 3300049585 Ga0501069_0094688 Ga0501069_0094688_932_1615 227
204 3300050514 nmdc:mga08x19_49750_c1 nmdc:mga08x19_49750_c1_1059_1742 227
205 iso_pu_bacteria 2842918807 2842921897 227
206 iso_pu_bacteria 2953994433 2953997885 227
207 3300005577 Ga0068857_100631232 Ga0068857_1006312321 228
208 3300009147 Ga0114129_10540020 Ga0114129_105400201 228
209 3300031548 Ga0307408_100026772 Ga0307408_1000267726 228
210 3300031548 Ga0307408_100048750 Ga0307408_1000487502 228
211 3300031731 Ga0307405_10091818 Ga0307405_100918181 228
212 3300031731 Ga0307405_10173060 Ga0307405_101730601 228
213 3300031852 Ga0307410_10001136 Ga0307410_1000113613 228
214 3300031852 Ga0307410_10067995 Ga0307410_100679953 228
215 3300031852 Ga0307410_10605282 Ga0307410_106052821 228
216 3300031852 Ga0307410_10837560 Ga0307410_108375601 228
217 3300031901 Ga0307406_10095126 Ga0307406_100951262 228
218 3300031903 Ga0307407_10018059 Ga0307407_100180592 228
219 3300031903 Ga0307407_10029814 Ga0307407_100298142 228
220 3300031911 Ga0307412_10100324 Ga0307412_101003242 228
221 3300031911 Ga0307412_10177289 Ga0307412_101772891 228
222 3300031995 Ga0307409_100003510 Ga0307409_1000035102 228
223 3300031995 Ga0307409_100175204 Ga0307409_1001752042 228
224 3300032002 Ga0307416_100003047 Ga0307416_10000304710 228
225 3300032002 Ga0307416_100014624 Ga0307416_1000146243 228
226 3300032002 Ga0307416_100201288 Ga0307416_1002012882 228
227 3300032004 Ga0307414_10052396 Ga0307414_100523962 228
228 3300032004 Ga0307414_10326443 Ga0307414_103264431 228
229 3300032005 Ga0307411_10011368 Ga0307411_100113684 228
230 3300032005 Ga0307411_10180272 Ga0307411_101802722 228
231 3300032126 Ga0307415_100003638 Ga0307415_1000036382 228
232 3300032126 Ga0307415_100010261 Ga0307415_1000102616 228
233 3300032126 Ga0307415_100106462 Ga0307415_1001064623 228
234 3300037471 Ga0395905_0429427 Ga0395905_0429427_389_1081 228
235 3300038443 Ga0395901_0556608 Ga0395901_0556608_402_1094 228
236 3300049584 Ga0501068_0214526 Ga0501068_0214526_87_773 228
237 3300049679 Ga0501249_012942 Ga0501249_012942_899_1585 228
238 3300049769 Ga0501272_013308 Ga0501272_013308_199_885 228
239 3300050507 nmdc:mga05p37_456825_c1 nmdc:mga05p37_456825_c1_748_1434 228
240 3300005578 Ga0068854_100396497 Ga0068854_1003964972 229
241 3300044683 Ga0466965_0084827 Ga0466965_0084827_161_850 229
242 3300044684 Ga0466966_0003390 Ga0466966_0003390_2282_2971 229
243 3300044694 Ga0466963_0007934 Ga0466963_0007934_2579_3268 229
244 3300044706 Ga0466964_0027824 Ga0466964_0027824_1153_1842 229
245 3300044719 Ga0466971_0001806 Ga0466971_0001806_2581_3270 229
246 3300044842 Ga0466957_0005856 Ga0466957_0005856_3666_4355 229
247 3300045049 Ga0466959_0229769 Ga0466959_0229769_330_1019 229
248 3300045836 Ga0466958_0008338 Ga0466958_0008338_2459_3148 229
249 3300045976 Ga0466967_0269521 Ga0466967_0269521_604_1293 229
250 3300061719 Ga0466962_0000550 Ga0466962_0000550_4677_5366 229
251 3300021358 Ga0213873_10000476 Ga0213873_100004765 230
252 3300021384 Ga0213876_10035881 Ga0213876_100358811 230
253 3300022467 Ga0224712_10090262 Ga0224712_100902621 230
254 3300039437 Ga0436365_0243521 Ga0436365_0243521_1520_2212 230
255 3300039453 Ga0436362_0551347 Ga0436362_0551347_4134_4826 230
256 3300044765 Ga0466970_0021291 Ga0466970_0021291_1849_2541 230
257 3300002075 JGI24738J21930_10001548 JGI24738J21930_100015487 231
258 3300005535 Ga0070684_100017970 Ga0070684_1000179704 231
259 3300006175 Ga0070712_100689909 Ga0070712_1006899091 231
260 3300009093 Ga0105240_10375498 Ga0105240_103754983 231
261 3300009545 Ga0105237_10717216 Ga0105237_107172162 231
262 3300013105 Ga0157369_10038838 Ga0157369_100388385 231
263 3300014497 Ga0182008_10010143 Ga0182008_100101434 231
264 3300014969 Ga0157376_10027716 Ga0157376_100277164 231
265 3300015261 Ga0182006_1002374 Ga0182006_100237411 231
266 3300015265 Ga0182005_1004417 Ga0182005_10044171 231
267 3300020070 Ga0206356_10470557 Ga0206356_104705571 231
268 3300020078 Ga0206352_11225234 Ga0206352_112252341 231
269 3300020080 Ga0206350_10437509 Ga0206350_104375092 231
270 3300020080 Ga0206350_10790397 Ga0206350_107903971 231
271 3300020081 Ga0206354_11213241 Ga0206354_112132412 231
272 3300021441 Ga0213871_10001724 Ga0213871_100017244 231
273 3300022467 Ga0224712_10002746 Ga0224712_100027463 231
274 3300022467 Ga0224712_10031980 Ga0224712_100319801 231
275 3300025913 Ga0207695_10266240 Ga0207695_102662403 231
276 3300025944 Ga0207661_10785858 Ga0207661_107858581 231
277 3300031911 Ga0307412_10004644 Ga0307412_100046447 231
278 3300041404 Ga0439436_0000020 Ga0439436_0000020_20988_21683 231
279 3300042157 Ga0439458_0025770 Ga0439458_0025770_253_948 231
280 3300046462 Ga0495651_0007028 Ga0495651_0007028_6647_7342 231
281 3300046507 Ga0495606_0153424 Ga0495606_0153424_235_930 231
282 3300046511 Ga0495608_0155634 Ga0495608_0155634_689_1384 231
283 3300046512 Ga0495610_0014620 Ga0495610_0014620_430_1125 231
284 3300046559 Ga0495667_0025808 Ga0495667_0025808_2502_3197 231
285 3300046691 Ga0495670_0005126 Ga0495670_0005126_319_1041 231
286 3300046694 Ga0495649_0027009 Ga0495649_0027009_2281_2976 231
287 3300047444 Ga0495675_0101903 Ga0495675_0101903_446_1141 231
288 3300047471 Ga0495684_0059149 Ga0495684_0059149_1950_2645 231
289 3300048088 Ga0495602_0005263 Ga0495602_0005263_1249_1944 231
290 3300048904 Ga0496101_0076781 Ga0496101_0076781_1024_1719 231
291 3300048918 Ga0496115_0275529 Ga0496115_0275529_482_1177 231
292 3300048922 Ga0496119_0026351 Ga0496119_0026351_340_1035 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

21

112

0.97

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

9

112

0.91

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

21

130

0.91

PF07991

IlvN

Acetohydroxy acid isomeroreductase, NADPH-binding domain

18

102

0.91

PF10727

Rossmann-like

Rossmann-like domain

5

113

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6foz-assembly1.cif.gz_A the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 13 1.006 2 29
5x6p-assembly2.cif.gz_B crystal structure of pseudomonas fluorescens kmo 1.002 2 29
5mzk-assembly1.cif.gz_A pseudomonas fluorescens kynurenine 3-monooxygenase (kmo) in complex with 3-[5-chloro-6-(cyclobutylmethoxy)-2-oxo-2,3-dihydro-1,3-benzoxazol-3-yl]propanoic acid 1.002 2 29
5nak-assembly1.cif.gz_B pseudomonas fluorescens kynurenine 3-monooxygenase (kmo) in complex with the enzyme substrate l-kynurenine 0.9998 2 29
3alm-assembly2.cif.gz_B crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, mutant c294a 0.9994 2 29
ID Description Score Start End Superfamily
5nahA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.001 2 29 3.50.50.60
af_P37906_24_389_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9899 2 29 3.50.50.60
af_Q54RE8_8_392_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9892 3 30 3.50.50.60
af_P49086_94_556_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9771 2 31 3.50.50.60
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9728 2 31 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A522N821-F1-model_v4 NADP oxidoreductase 0.9892 1 231
AF-A0A7K1XA95-F1-model_v4 deleted 0.9881 138 210
AF-A0A4Q3XNB6-F1-model_v4 deleted 0.9879 1 128
AF-A0A1F3BLC8-F1-model_v4 NADP oxidoreductase 0.9873 1 210
AF-A0A522N821-F1-model_v4 NADP oxidoreductase 0.9849 1 231

Feature Viewer

pLDDT pTM Quality
95.91 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map