F390732
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 292 | 191 | 289 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100007659|Ga0070680_1000076591 |
| Length | 246 |
| Sequence | VSLSRPPQVRNIHSNLELEMNIGIIGAGHIGGTLTRRLSELGHNVFVANSRGPESLADLARETGATPVTVDEAARNRDIVIITIPEKNIPKLPRDLFKGVSDDVIVIDTGNYYPQQRDGRIDGIEEGLTESRWMSQQLGRPVVKTFNNIYADHLLRLGRPSGTPGRIALPVAGDDSEAKAKVIKLLDELGFDGVDAGTIDESWKQQPGTPVYATDLDADGVKKALSKATKERTPEWRAATAKATQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 2 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 79 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 84 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 85 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 86 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 128 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 129 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 137 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 138 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 143 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 144 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 145 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 146 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 147 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 148 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 149 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 150 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 151 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 152 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 153 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 154 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 155 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 156 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 157 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 158 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 159 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 160 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 161 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 162 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 175 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 176 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 177 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 178 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 181 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 182 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 183 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 184 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 187 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 188 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 191 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.52 |
| Metatranscriptomes | 4.45 |
| Isolates | 1.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0.34 |
| Rhizoplane | 5.14 |
| Rhizosphere | 92.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10001548 | 3300002075 | Bacteria | 6345 |
| 2 | JGI24751J29686_10000418 | 3300002459 | Bacteria | 13373 |
| 3 | rootL2_10334473 | 3300003322 | Unclassified | 1025 |
| 4 | rootH1_10147440 | 3300003323 | Bacteria | 1649 |
| 5 | Ga0065712_10165183 | 3300005290 | Bacteria | 1277 |
| 6 | Ga0065715_10132142 | 3300005293 | Bacteria | 1995 |
| 7 | Ga0065715_10142912 | 3300005293 | Bacteria | 1819 |
| 8 | Ga0065715_10232166 | 3300005293 | Bacteria | 1201 |
| 9 | Ga0065715_10236207 | 3300005293 | Bacteria | 1212 |
| 10 | Ga0065707_10215083 | 3300005295 | Bacteria | 1243 |
| 11 | Ga0070670_100000084 | 3300005331 | Bacteria | 90455 |
| 12 | Ga0070680_100000417 | 3300005336 | Bacteria | 29035 |
| 13 | Ga0070680_100007659 | 3300005336 | Bacteria | 8239 |
| 14 | Ga0070680_100015523 | 3300005336 | Bacteria | 5974 |
| 15 | Ga0070680_100022743 | 3300005336 | Bacteria | 4994 |
| 16 | Ga0070660_100021772 | 3300005339 | Bacteria | 4731 |
| 17 | Ga0070691_10084643 | 3300005341 | Bacteria | 1557 |
| 18 | Ga0070687_100545360 | 3300005343 | Bacteria | 788 |
| 19 | Ga0070661_100022559 | 3300005344 | Bacteria | 4507 |
| 20 | Ga0070669_100102816 | 3300005353 | Bacteria | 2158 |
| 21 | Ga0070673_100007869 | 3300005364 | Bacteria | 7063 |
| 22 | Ga0070659_100700411 | 3300005366 | Bacteria | 876 |
| 23 | Ga0070709_10009321 | 3300005434 | Bacteria | 5409 |
| 24 | Ga0070714_100010695 | 3300005435 | Bacteria | 7261 |
| 25 | Ga0070714_100107707 | 3300005435 | Unclassified | 2463 |
| 26 | Ga0070701_10007169 | 3300005438 | Bacteria | 4742 |
| 27 | Ga0070701_10076621 | 3300005438 | Bacteria | 1800 |
| 28 | Ga0070711_100215623 | 3300005439 | Bacteria | 1489 |
| 29 | Ga0070700_100037480 | 3300005441 | Unclassified | 2949 |
| 30 | Ga0070663_100090589 | 3300005455 | Unclassified | 2265 |
| 31 | Ga0070681_10000328 | 3300005458 | Bacteria | 38769 |
| 32 | Ga0070681_10153006 | 3300005458 | Bacteria | 2232 |
| 33 | Ga0070681_10528484 | 3300005458 | Bacteria | 1093 |
| 34 | Ga0070707_100333356 | 3300005468 | Bacteria | 1474 |
| 35 | Ga0070679_100000491 | 3300005530 | Bacteria | 33649 |
| 36 | Ga0070679_100034877 | 3300005530 | Bacteria | 4990 |
| 37 | Ga0070679_100038347 | 3300005530 | Bacteria | 4763 |
| 38 | Ga0070684_100017970 | 3300005535 | Bacteria | 5814 |
| 39 | Ga0068853_100018598 | 3300005539 | Bacteria | 5753 |
| 40 | Ga0068853_100370614 | 3300005539 | Bacteria | 1336 |
| 41 | Ga0068853_100822829 | 3300005539 | Bacteria | 890 |
| 42 | Ga0070672_100226007 | 3300005543 | Bacteria | 1571 |
| 43 | Ga0070695_100114199 | 3300005545 | Bacteria | 1838 |
| 44 | Ga0070696_100024812 | 3300005546 | Bacteria | 4074 |
| 45 | Ga0070696_100415129 | 3300005546 | Bacteria | 1055 |
| 46 | Ga0070696_100561707 | 3300005546 | Bacteria | 916 |
| 47 | Ga0070693_100007181 | 3300005547 | Bacteria | 5435 |
| 48 | Ga0070693_100054502 | 3300005547 | Bacteria | 2300 |
| 49 | Ga0070693_100085283 | 3300005547 | Unclassified | 1892 |
| 50 | Ga0068855_100194963 | 3300005563 | Unclassified | 2282 |
| 51 | Ga0070664_100516698 | 3300005564 | Bacteria | 1102 |
| 52 | Ga0068857_100631232 | 3300005577 | Bacteria | 1014 |
| 53 | Ga0068854_100032713 | 3300005578 | Bacteria | 3620 |
| 54 | Ga0068854_100396497 | 3300005578 | Bacteria | 1141 |
| 55 | Ga0068856_100005586 | 3300005614 | Bacteria | 12381 |
| 56 | Ga0068852_100031768 | 3300005616 | Bacteria | 4363 |
| 57 | Ga0068859_100021552 | 3300005617 | Bacteria | 6468 |
| 58 | Ga0068859_100070003 | 3300005617 | Bacteria | 3544 |
| 59 | Ga0068859_100170129 | 3300005617 | Bacteria | 2260 |
| 60 | Ga0068859_100418384 | 3300005617 | Bacteria | 1436 |
| 61 | Ga0068864_100118212 | 3300005618 | Bacteria | 2367 |
| 62 | Ga0068864_100203514 | 3300005618 | Unclassified | 1820 |
| 63 | Ga0068866_10429761 | 3300005718 | Unclassified | 859 |
| 64 | Ga0068858_100024892 | 3300005842 | Bacteria | 5572 |
| 65 | Ga0068858_100321511 | 3300005842 | Bacteria | 1479 |
| 66 | Ga0068860_100045107 | 3300005843 | Bacteria | 4203 |
| 67 | Ga0068860_100092124 | 3300005843 | Bacteria | 2888 |
| 68 | Ga0068862_100340641 | 3300005844 | Bacteria | 1389 |
| 69 | Ga0070717_10589667 | 3300006028 | Unclassified | 1008 |
| 70 | Ga0070716_100051107 | 3300006173 | Bacteria | 2348 |
| 71 | Ga0070712_100689909 | 3300006175 | Bacteria | 870 |
| 72 | Ga0068865_100250724 | 3300006881 | Bacteria | 1397 |
| 73 | Ga0075436_100013115 | 3300006914 | Bacteria | 5681 |
| 74 | Ga0075436_100013356 | 3300006914 | Bacteria | 5626 |
| 75 | Ga0075436_100056720 | 3300006914 | Bacteria | 2705 |
| 76 | Ga0097620_100021553 | 3300006931 | Bacteria | 6468 |
| 77 | Ga0097620_100070004 | 3300006931 | Bacteria | 3544 |
| 78 | Ga0097620_100170139 | 3300006931 | Bacteria | 2260 |
| 79 | Ga0097620_100305817 | 3300006931 | Unclassified | 1683 |
| 80 | Ga0097620_100418372 | 3300006931 | Bacteria | 1436 |
| 81 | Ga0105240_10034003 | 3300009093 | Bacteria | 6581 |
| 82 | Ga0105240_10375498 | 3300009093 | Unclassified | 1607 |
| 83 | Ga0105245_10696965 | 3300009098 | Bacteria | 1048 |
| 84 | Ga0105247_10000485 | 3300009101 | Bacteria | 33190 |
| 85 | Ga0114129_10540020 | 3300009147 | Bacteria | 1517 |
| 86 | Ga0105243_10010280 | 3300009148 | Bacteria | 7111 |
| 87 | Ga0105241_10061181 | 3300009174 | Bacteria | 2899 |
| 88 | Ga0105241_10117740 | 3300009174 | Bacteria | 2135 |
| 89 | Ga0105242_10007007 | 3300009176 | Bacteria | 8701 |
| 90 | Ga0105248_10020551 | 3300009177 | Bacteria | 7317 |
| 91 | Ga0105248_10084795 | 3300009177 | Bacteria | 3565 |
| 92 | Ga0105248_10650790 | 3300009177 | Bacteria | 1189 |
| 93 | Ga0105237_10717216 | 3300009545 | Archaea | 1007 |
| 94 | Ga0105237_10730721 | 3300009545 | Bacteria | 996 |
| 95 | Ga0105238_10004962 | 3300009551 | Bacteria | 13157 |
| 96 | Ga0105238_10057623 | 3300009551 | Bacteria | 3895 |
| 97 | Ga0105249_10007883 | 3300009553 | Bacteria | 9278 |
| 98 | Ga0105239_10633141 | 3300010375 | Unclassified | 1221 |
| 99 | Ga0157373_10056084 | 3300013100 | Bacteria | 2798 |
| 100 | Ga0157369_10038838 | 3300013105 | Bacteria | 5204 |
| 101 | Ga0157369_10284841 | 3300013105 | Bacteria | 1721 |
| 102 | Ga0157378_10236826 | 3300013297 | Bacteria | 1742 |
| 103 | Ga0163162_10080672 | 3300013306 | Bacteria | 3322 |
| 104 | Ga0163162_11194402 | 3300013306 | Bacteria | 863 |
| 105 | Ga0157372_10026521 | 3300013307 | Bacteria | 6305 |
| 106 | Ga0157372_10388233 | 3300013307 | Bacteria | 1627 |
| 107 | Ga0157372_10841861 | 3300013307 | Unclassified | 1065 |
| 108 | Ga0157375_10213372 | 3300013308 | Bacteria | 2088 |
| 109 | Ga0157375_10691669 | 3300013308 | Unclassified | 1174 |
| 110 | Ga0163163_10000964 | 3300014325 | Bacteria | 24463 |
| 111 | Ga0182008_10010143 | 3300014497 | Bacteria | 5050 |
| 112 | Ga0157379_10179439 | 3300014968 | Bacteria | 1913 |
| 113 | Ga0157376_10027716 | 3300014969 | Bacteria | 4495 |
| 114 | Ga0182006_1002374 | 3300015261 | Bacteria | 10313 |
| 115 | Ga0182005_1004417 | 3300015265 | Bacteria | 4550 |
| 116 | Ga0197907_10650211 | 3300020069 | Bacteria | 1382 |
| 117 | Ga0206356_10470557 | 3300020070 | Unclassified | 803 |
| 118 | Ga0206355_1134839 | 3300020076 | Bacteria | 1685 |
| 119 | Ga0206351_10249439 | 3300020077 | Bacteria | 2489 |
| 120 | Ga0206352_11225234 | 3300020078 | Bacteria | 1614 |
| 121 | Ga0206350_10437509 | 3300020080 | Bacteria | 1716 |
| 122 | Ga0206350_10738944 | 3300020080 | Bacteria | 10200 |
| 123 | Ga0206350_10790397 | 3300020080 | Unclassified | 878 |
| 124 | Ga0206354_11213241 | 3300020081 | Bacteria | 3620 |
| 125 | Ga0213873_10000476 | 3300021358 | Bacteria | 6448 |
| 126 | Ga0213876_10035881 | 3300021384 | Bacteria | 2615 |
| 127 | Ga0213871_10001724 | 3300021441 | Bacteria | 3788 |
| 128 | Ga0224712_10002746 | 3300022467 | Bacteria | 4426 |
| 129 | Ga0224712_10022678 | 3300022467 | Bacteria | 2168 |
| 130 | Ga0224712_10031980 | 3300022467 | Bacteria | 1914 |
| 131 | Ga0224712_10090262 | 3300022467 | Bacteria | 1282 |
| 132 | Ga0207710_10001072 | 3300025900 | Bacteria | 14113 |
| 133 | Ga0207647_10113707 | 3300025904 | Bacteria | 1600 |
| 134 | Ga0207699_10007881 | 3300025906 | Bacteria | 5224 |
| 135 | Ga0207643_10345882 | 3300025908 | Bacteria | 933 |
| 136 | Ga0207705_10001502 | 3300025909 | Bacteria | 18535 |
| 137 | Ga0207707_10000330 | 3300025912 | Bacteria | 49978 |
| 138 | Ga0207695_10266240 | 3300025913 | Unclassified | 1610 |
| 139 | Ga0207660_10000304 | 3300025917 | Bacteria | 32299 |
| 140 | Ga0207660_10014019 | 3300025917 | Bacteria | 5261 |
| 141 | Ga0207660_10029810 | 3300025917 | Bacteria | 3747 |
| 142 | Ga0207660_10236702 | 3300025917 | Bacteria | 1437 |
| 143 | Ga0207662_10631961 | 3300025918 | Bacteria | 747 |
| 144 | Ga0207657_10045108 | 3300025919 | Bacteria | 3871 |
| 145 | Ga0207649_10040665 | 3300025920 | Unclassified | 2827 |
| 146 | Ga0207652_10000839 | 3300025921 | Bacteria | 29313 |
| 147 | Ga0207652_10079000 | 3300025921 | Bacteria | 2874 |
| 148 | Ga0207652_10190769 | 3300025921 | Unclassified | 1843 |
| 149 | Ga0207646_10226394 | 3300025922 | Bacteria | 1689 |
| 150 | Ga0207681_10089356 | 3300025923 | Bacteria | 2196 |
| 151 | Ga0207694_10002288 | 3300025924 | Bacteria | 15679 |
| 152 | Ga0207694_10029655 | 3300025924 | Bacteria | 4175 |
| 153 | Ga0207650_10000017 | 3300025925 | Bacteria | 354674 |
| 154 | Ga0207664_10251337 | 3300025929 | Bacteria | 1543 |
| 155 | Ga0207690_10145540 | 3300025932 | Unclassified | 1751 |
| 156 | Ga0207706_10348784 | 3300025933 | Bacteria | 1287 |
| 157 | Ga0207686_10274753 | 3300025934 | Unclassified | 1241 |
| 158 | Ga0207709_10004946 | 3300025935 | Bacteria | 7627 |
| 159 | Ga0207670_10061623 | 3300025936 | Bacteria | 2560 |
| 160 | Ga0207665_10000676 | 3300025939 | Bacteria | 23022 |
| 161 | Ga0207691_10150474 | 3300025940 | Bacteria | 2047 |
| 162 | Ga0207691_10496489 | 3300025940 | Bacteria | 1037 |
| 163 | Ga0207711_10169713 | 3300025941 | Bacteria | 1979 |
| 164 | Ga0207661_10785858 | 3300025944 | Archaea | 876 |
| 165 | Ga0207667_10096526 | 3300025949 | Bacteria | 3051 |
| 166 | Ga0207712_10012283 | 3300025961 | Bacteria | 5472 |
| 167 | Ga0207640_10029033 | 3300025981 | Bacteria | 3389 |
| 168 | Ga0207703_10102874 | 3300026035 | Bacteria | 2424 |
| 169 | Ga0207703_10296020 | 3300026035 | Bacteria | 1474 |
| 170 | Ga0207639_10006574 | 3300026041 | Bacteria | 7906 |
| 171 | Ga0207639_10272414 | 3300026041 | Bacteria | 1485 |
| 172 | Ga0207708_10046310 | 3300026075 | Unclassified | 3312 |
| 173 | Ga0207708_10209305 | 3300026075 | Bacteria | 1558 |
| 174 | Ga0207708_10700389 | 3300026075 | Bacteria | 866 |
| 175 | Ga0207702_10085732 | 3300026078 | Bacteria | 2745 |
| 176 | Ga0207702_10124912 | 3300026078 | Unclassified | 2308 |
| 177 | Ga0207676_10274145 | 3300026095 | Unclassified | 1529 |
| 178 | Ga0207674_10096646 | 3300026116 | Unclassified | 2938 |
| 179 | Ga0207698_10013370 | 3300026142 | Bacteria | 5414 |
| 180 | Ga0268265_10295196 | 3300028380 | Bacteria | 1457 |
| 181 | Ga0268264_10023013 | 3300028381 | Bacteria | 5084 |
| 182 | Ga0268264_10027582 | 3300028381 | Unclassified | 4642 |
| 183 | Ga0307408_100026772 | 3300031548 | Bacteria | 3966 |
| 184 | Ga0307408_100048750 | 3300031548 | Bacteria | 3039 |
| 185 | Ga0307405_10091818 | 3300031731 | Bacteria | 2013 |
| 186 | Ga0307405_10173060 | 3300031731 | Bacteria | 1542 |
| 187 | Ga0307405_10794050 | 3300031731 | Bacteria | 792 |
| 188 | Ga0307413_10540069 | 3300031824 | Bacteria | 944 |
| 189 | Ga0307410_10001136 | 3300031852 | Bacteria | 11682 |
| 190 | Ga0307410_10067995 | 3300031852 | Bacteria | 2459 |
| 191 | Ga0307410_10189962 | 3300031852 | Bacteria | 1561 |
| 192 | Ga0307410_10605282 | 3300031852 | Bacteria | 914 |
| 193 | Ga0307410_10837560 | 3300031852 | Bacteria | 784 |
| 194 | Ga0307406_10095126 | 3300031901 | Bacteria | 2015 |
| 195 | Ga0307407_10018059 | 3300031903 | Bacteria | 3557 |
| 196 | Ga0307407_10029814 | 3300031903 | Bacteria | 2936 |
| 197 | Ga0307412_10004644 | 3300031911 | Bacteria | 7652 |
| 198 | Ga0307412_10100324 | 3300031911 | Bacteria | 2046 |
| 199 | Ga0307412_10177289 | 3300031911 | Bacteria | 1599 |
| 200 | Ga0307409_100003510 | 3300031995 | Bacteria | 8542 |
| 201 | Ga0307409_100175204 | 3300031995 | Bacteria | 1892 |
| 202 | Ga0307409_100957419 | 3300031995 | Bacteria | 872 |
| 203 | Ga0307416_100003047 | 3300032002 | Bacteria | 9803 |
| 204 | Ga0307416_100014624 | 3300032002 | Bacteria | 5388 |
| 205 | Ga0307416_100201288 | 3300032002 | Bacteria | 1890 |
| 206 | Ga0307416_100657936 | 3300032002 | Bacteria | 1133 |
| 207 | Ga0307414_10052396 | 3300032004 | Bacteria | 2840 |
| 208 | Ga0307414_10326443 | 3300032004 | Unclassified | 1308 |
| 209 | Ga0307411_10011368 | 3300032005 | Bacteria | 4802 |
| 210 | Ga0307411_10180272 | 3300032005 | Bacteria | 1602 |
| 211 | Ga0307415_100003638 | 3300032126 | Bacteria | 7883 |
| 212 | Ga0307415_100010261 | 3300032126 | Bacteria | 5296 |
| 213 | Ga0307415_100106462 | 3300032126 | Bacteria | 2070 |
| 214 | Ga0373951_0001997 | 3300035091 | Bacteria | 5222 |
| 215 | Ga0373941_0066939 | 3300035115 | Bacteria | 1183 |
| 216 | Ga0395900_0876538 | 3300037418 | Bacteria | 822 |
| 217 | Ga0395905_0429427 | 3300037471 | Bacteria | 1218 |
| 218 | Ga0395901_0556608 | 3300038443 | Bacteria | 1162 |
| 219 | Ga0242420_027031 | 3300038996 | Bacteria | 1050 |
| 220 | Ga0242420_032705 | 3300038996 | Unclassified | 970 |
| 221 | Ga0436365_0243521 | 3300039437 | Bacteria | 4826 |
| 222 | Ga0436361_0682191 | 3300039447 | Bacteria | 1398 |
| 223 | Ga0436362_0551347 | 3300039453 | Bacteria | 47047 |
| 224 | Ga0439436_0000020 | 3300041404 | Bacteria | 66117 |
| 225 | Ga0439458_0025770 | 3300042157 | Bacteria | 1380 |
| 226 | Ga0451577_0266257 | 3300042876 | Bacteria | 1552 |
| 227 | Ga0466969_0175704 | 3300044656 | Bacteria | 981 |
| 228 | Ga0466965_0084827 | 3300044683 | Bacteria | 1605 |
| 229 | Ga0466965_0199581 | 3300044683 | Bacteria | 1061 |
| 230 | Ga0466966_0003390 | 3300044684 | Bacteria | 10511 |
| 231 | Ga0466966_0336916 | 3300044684 | Bacteria | 906 |
| 232 | Ga0466963_0000704 | 3300044694 | Bacteria | 16320 |
| 233 | Ga0466963_0007934 | 3300044694 | Bacteria | 6355 |
| 234 | Ga0466963_0046953 | 3300044694 | Bacteria | 2849 |
| 235 | Ga0466963_0378987 | 3300044694 | Bacteria | 997 |
| 236 | Ga0466964_0027824 | 3300044706 | Bacteria | 2222 |
| 237 | Ga0466971_0001806 | 3300044719 | Bacteria | 9086 |
| 238 | Ga0466968_0001538 | 3300044735 | Bacteria | 8294 |
| 239 | Ga0466970_0021291 | 3300044765 | Bacteria | 3376 |
| 240 | Ga0466970_0175785 | 3300044765 | Bacteria | 1187 |
| 241 | Ga0466957_0005856 | 3300044842 | Bacteria | 6922 |
| 242 | Ga0466957_0009466 | 3300044842 | Bacteria | 5562 |
| 243 | Ga0466959_0161882 | 3300045049 | Bacteria | 1573 |
| 244 | Ga0466959_0229769 | 3300045049 | Bacteria | 1284 |
| 245 | Ga0466959_0325241 | 3300045049 | Bacteria | 1051 |
| 246 | Ga0451576_0418701 | 3300045051 | Unclassified | 1405 |
| 247 | Ga0451576_1321803 | 3300045051 | Bacteria | 751 |
| 248 | Ga0466958_0008338 | 3300045836 | Bacteria | 5743 |
| 249 | Ga0466958_0041654 | 3300045836 | Bacteria | 2763 |
| 250 | Ga0466958_0091811 | 3300045836 | Bacteria | 1880 |
| 251 | Ga0466958_0142794 | 3300045836 | Bacteria | 1508 |
| 252 | Ga0466967_0240833 | 3300045976 | Unclassified | 1726 |
| 253 | Ga0466967_0269521 | 3300045976 | Bacteria | 1631 |
| 254 | Ga0495651_0007028 | 3300046462 | Bacteria | 8612 |
| 255 | Ga0495606_0153424 | 3300046507 | Bacteria | 1350 |
| 256 | Ga0495608_0155634 | 3300046511 | Bacteria | 1455 |
| 257 | Ga0495610_0014620 | 3300046512 | Bacteria | 4602 |
| 258 | Ga0495667_0025808 | 3300046559 | Bacteria | 3958 |
| 259 | Ga0495670_0005126 | 3300046691 | Bacteria | 6442 |
| 260 | Ga0495649_0027009 | 3300046694 | Bacteria | 3187 |
| 261 | Ga0495687_009359 | 3300047443 | Bacteria | 5484 |
| 262 | Ga0495675_0101903 | 3300047444 | Bacteria | 1796 |
| 263 | Ga0495684_0059149 | 3300047471 | Bacteria | 2919 |
| 264 | Ga0495602_0005263 | 3300048088 | Bacteria | 13571 |
| 265 | Ga0496101_0076781 | 3300048904 | Bacteria | 2461 |
| 266 | Ga0496103_0166155 | 3300048906 | Bacteria | 1416 |
| 267 | Ga0496104_0557659 | 3300048907 | Bacteria | 1056 |
| 268 | Ga0496106_0076672 | 3300048909 | Bacteria | 2563 |
| 269 | Ga0496106_0326329 | 3300048909 | Unclassified | 1232 |
| 270 | Ga0496106_0613693 | 3300048909 | Bacteria | 871 |
| 271 | Ga0496107_0476176 | 3300048910 | Unclassified | 927 |
| 272 | Ga0496108_0032570 | 3300048911 | Bacteria | 4330 |
| 273 | Ga0496108_0139461 | 3300048911 | Unclassified | 2089 |
| 274 | Ga0496108_1176945 | 3300048911 | Bacteria | 649 |
| 275 | Ga0496109_1198420 | 3300048912 | Unclassified | 696 |
| 276 | Ga0496112_0199496 | 3300048915 | Bacteria | 1961 |
| 277 | Ga0496112_1005546 | 3300048915 | Bacteria | 754 |
| 278 | Ga0496113_0289254 | 3300048916 | Bacteria | 1311 |
| 279 | Ga0496115_0275529 | 3300048918 | Bacteria | 1382 |
| 280 | Ga0496119_0026351 | 3300048922 | Bacteria | 4032 |
| 281 | Ga0501068_0214526 | 3300049584 | Bacteria | 1223 |
| 282 | Ga0501069_0094688 | 3300049585 | Bacteria | 1690 |
| 283 | Ga0501249_012942 | 3300049679 | Bacteria | 1769 |
| 284 | Ga0501272_013308 | 3300049769 | Unclassified | 942 |
| 285 | nmdc:mga05p37_456825_c1 | 3300050507 | Bacteria | 1477 |
| 286 | nmdc:mga08x19_2605_c1 | 3300050514 | Bacteria | 10945 |
| 287 | nmdc:mga08x19_36583_c1 | 3300050514 | Bacteria | 3110 |
| 288 | nmdc:mga08x19_49750_c1 | 3300050514 | Bacteria | 2689 |
| 289 | Ga0466962_0000550 | 3300061719 | Bacteria | 16549 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039447 | Ga0436361_0682191 | Ga0436361_0682191_795_1376 | 193 |
| 2 | 3300044694 | Ga0466963_0000704 | Ga0466963_0000704_6305_6892 | 195 |
| 3 | 3300044842 | Ga0466957_0009466 | Ga0466957_0009466_1146_1733 | 195 |
| 4 | 3300048912 | Ga0496109_1198420 | Ga0496109_1198420_50_664 | 204 |
| 5 | 3300044694 | Ga0466963_0378987 | Ga0466963_0378987_48_710 | 205 |
| 6 | 3300045836 | Ga0466958_0091811 | Ga0466958_0091811_1149_1811 | 205 |
| 7 | 3300037418 | Ga0395900_0876538 | Ga0395900_0876538_191_811 | 206 |
| 8 | 3300045049 | Ga0466959_0325241 | Ga0466959_0325241_277_936 | 206 |
| 9 | 3300045051 | Ga0451576_1321803 | Ga0451576_1321803_13_633 | 206 |
| 10 | 3300048910 | Ga0496107_0476176 | Ga0496107_0476176_46_666 | 206 |
| 11 | 3300048911 | Ga0496108_1176945 | Ga0496108_1176945_18_638 | 206 |
| 12 | 3300009098 | Ga0105245_10696965 | Ga0105245_106969651 | 207 |
| 13 | 3300044735 | Ga0466968_0001538 | Ga0466968_0001538_6446_7138 | 213 |
| 14 | 3300048911 | Ga0496108_0139461 | Ga0496108_0139461_305_988 | 215 |
| 15 | 3300003323 | rootH1_10147440 | rootH1_101474401 | 217 |
| 16 | 3300005336 | Ga0070680_100000417 | Ga0070680_1000004175 | 218 |
| 17 | 3300025917 | Ga0207660_10000304 | Ga0207660_1000030418 | 218 |
| 18 | 3300038996 | Ga0242420_027031 | Ga0242420_027031_164_820 | 218 |
| 19 | 3300045836 | Ga0466958_0142794 | Ga0466958_0142794_442_1098 | 218 |
| 20 | 3300005336 | Ga0070680_100022743 | Ga0070680_1000227435 | 219 |
| 21 | 3300005339 | Ga0070660_100021772 | Ga0070660_1000217723 | 219 |
| 22 | 3300005344 | Ga0070661_100022559 | Ga0070661_1000225593 | 219 |
| 23 | 3300005366 | Ga0070659_100700411 | Ga0070659_1007004111 | 219 |
| 24 | 3300005435 | Ga0070714_100107707 | Ga0070714_1001077071 | 219 |
| 25 | 3300005455 | Ga0070663_100090589 | Ga0070663_1000905891 | 219 |
| 26 | 3300005458 | Ga0070681_10153006 | Ga0070681_101530062 | 219 |
| 27 | 3300005530 | Ga0070679_100038347 | Ga0070679_1000383473 | 219 |
| 28 | 3300005539 | Ga0068853_100018598 | Ga0068853_1000185983 | 219 |
| 29 | 3300005547 | Ga0070693_100085283 | Ga0070693_1000852832 | 219 |
| 30 | 3300005563 | Ga0068855_100194963 | Ga0068855_1001949632 | 219 |
| 31 | 3300005578 | Ga0068854_100032713 | Ga0068854_1000327132 | 219 |
| 32 | 3300005616 | Ga0068852_100031768 | Ga0068852_1000317684 | 219 |
| 33 | 3300009093 | Ga0105240_10034003 | Ga0105240_100340033 | 219 |
| 34 | 3300009551 | Ga0105238_10057623 | Ga0105238_100576234 | 219 |
| 35 | 3300013100 | Ga0157373_10056084 | Ga0157373_100560842 | 219 |
| 36 | 3300013105 | Ga0157369_10284841 | Ga0157369_102848412 | 219 |
| 37 | 3300013307 | Ga0157372_10026521 | Ga0157372_100265213 | 219 |
| 38 | 3300020069 | Ga0197907_10650211 | Ga0197907_106502111 | 219 |
| 39 | 3300020076 | Ga0206355_1134839 | Ga0206355_11348392 | 219 |
| 40 | 3300020077 | Ga0206351_10249439 | Ga0206351_102494393 | 219 |
| 41 | 3300020080 | Ga0206350_10738944 | Ga0206350_107389447 | 219 |
| 42 | 3300022467 | Ga0224712_10022678 | Ga0224712_100226782 | 219 |
| 43 | 3300025909 | Ga0207705_10001502 | Ga0207705_1000150215 | 219 |
| 44 | 3300025917 | Ga0207660_10014019 | Ga0207660_100140192 | 219 |
| 45 | 3300025919 | Ga0207657_10045108 | Ga0207657_100451082 | 219 |
| 46 | 3300025920 | Ga0207649_10040665 | Ga0207649_100406653 | 219 |
| 47 | 3300025921 | Ga0207652_10190769 | Ga0207652_101907691 | 219 |
| 48 | 3300025924 | Ga0207694_10029655 | Ga0207694_100296554 | 219 |
| 49 | 3300025932 | Ga0207690_10145540 | Ga0207690_101455402 | 219 |
| 50 | 3300025949 | Ga0207667_10096526 | Ga0207667_100965263 | 219 |
| 51 | 3300025981 | Ga0207640_10029033 | Ga0207640_100290332 | 219 |
| 52 | 3300026041 | Ga0207639_10006574 | Ga0207639_100065742 | 219 |
| 53 | 3300026078 | Ga0207702_10124912 | Ga0207702_101249122 | 219 |
| 54 | 3300026142 | Ga0207698_10013370 | Ga0207698_100133704 | 219 |
| 55 | 3300005343 | Ga0070687_100545360 | Ga0070687_1005453601 | 220 |
| 56 | 3300025918 | Ga0207662_10631961 | Ga0207662_106319611 | 220 |
| 57 | 3300042876 | Ga0451577_0266257 | Ga0451577_0266257_439_1101 | 220 |
| 58 | 3300044683 | Ga0466965_0199581 | Ga0466965_0199581_109_771 | 220 |
| 59 | 3300044694 | Ga0466963_0046953 | Ga0466963_0046953_179_841 | 220 |
| 60 | 3300044765 | Ga0466970_0175785 | Ga0466970_0175785_19_681 | 220 |
| 61 | 3300045051 | Ga0451576_0418701 | Ga0451576_0418701_370_1032 | 220 |
| 62 | iso_pu_bacteria | 8055301274 | 8055307072 | 220 |
| 63 | 3300005434 | Ga0070709_10009321 | Ga0070709_100093215 | 221 |
| 64 | 3300005439 | Ga0070711_100215623 | Ga0070711_1002156232 | 221 |
| 65 | 3300006028 | Ga0070717_10589667 | Ga0070717_105896671 | 221 |
| 66 | 3300006173 | Ga0070716_100051107 | Ga0070716_1000511074 | 221 |
| 67 | 3300006914 | Ga0075436_100013356 | Ga0075436_1000133561 | 221 |
| 68 | 3300025906 | Ga0207699_10007881 | Ga0207699_100078813 | 221 |
| 69 | 3300025939 | Ga0207665_10000676 | Ga0207665_100006763 | 221 |
| 70 | 3300035115 | Ga0373941_0066939 | Ga0373941_0066939_133_798 | 221 |
| 71 | 3300050514 | nmdc:mga08x19_36583_c1 | nmdc:mga08x19_36583_c1_1465_2130 | 221 |
| 72 | 3300009177 | Ga0105248_10084795 | Ga0105248_100847954 | 222 |
| 73 | 3300013307 | Ga0157372_10841861 | Ga0157372_108418611 | 222 |
| 74 | 3300005364 | Ga0070673_100007869 | Ga0070673_1000078695 | 224 |
| 75 | 3300047443 | Ga0495687_009359 | Ga0495687_009359_4157_4846 | 224 |
| 76 | 3300031731 | Ga0307405_10794050 | Ga0307405_107940501 | 225 |
| 77 | 3300031824 | Ga0307413_10540069 | Ga0307413_105400691 | 225 |
| 78 | 3300031852 | Ga0307410_10189962 | Ga0307410_101899622 | 225 |
| 79 | 3300031995 | Ga0307409_100957419 | Ga0307409_1009574191 | 225 |
| 80 | 3300005336 | Ga0070680_100015523 | Ga0070680_1000155234 | 226 |
| 81 | 3300005341 | Ga0070691_10084643 | Ga0070691_100846432 | 226 |
| 82 | 3300005435 | Ga0070714_100010695 | Ga0070714_1000106959 | 226 |
| 83 | 3300005530 | Ga0070679_100034877 | Ga0070679_1000348775 | 226 |
| 84 | 3300005543 | Ga0070672_100226007 | Ga0070672_1002260073 | 226 |
| 85 | 3300005546 | Ga0070696_100024812 | Ga0070696_1000248124 | 226 |
| 86 | 3300005547 | Ga0070693_100007181 | Ga0070693_1000071813 | 226 |
| 87 | 3300005618 | Ga0068864_100203514 | Ga0068864_1002035142 | 226 |
| 88 | 3300006914 | Ga0075436_100013115 | Ga0075436_1000131156 | 226 |
| 89 | 3300009177 | Ga0105248_10650790 | Ga0105248_106507902 | 226 |
| 90 | 3300013308 | Ga0157375_10213372 | Ga0157375_102133723 | 226 |
| 91 | 3300013308 | Ga0157375_10691669 | Ga0157375_106916691 | 226 |
| 92 | 3300025917 | Ga0207660_10236702 | Ga0207660_102367021 | 226 |
| 93 | 3300025921 | Ga0207652_10079000 | Ga0207652_100790003 | 226 |
| 94 | 3300025929 | Ga0207664_10251337 | Ga0207664_102513372 | 226 |
| 95 | 3300025933 | Ga0207706_10348784 | Ga0207706_103487841 | 226 |
| 96 | 3300025940 | Ga0207691_10496489 | Ga0207691_104964892 | 226 |
| 97 | 3300026075 | Ga0207708_10700389 | Ga0207708_107003891 | 226 |
| 98 | 3300028381 | Ga0268264_10027582 | Ga0268264_100275823 | 226 |
| 99 | 3300044656 | Ga0466969_0175704 | Ga0466969_0175704_138_818 | 226 |
| 100 | 3300044684 | Ga0466966_0336916 | Ga0466966_0336916_121_801 | 226 |
| 101 | 3300045049 | Ga0466959_0161882 | Ga0466959_0161882_46_726 | 226 |
| 102 | 3300045836 | Ga0466958_0041654 | Ga0466958_0041654_2057_2737 | 226 |
| 103 | 3300045976 | Ga0466967_0240833 | Ga0466967_0240833_326_1006 | 226 |
| 104 | 3300050514 | nmdc:mga08x19_2605_c1 | nmdc:mga08x19_2605_c1_2111_2791 | 226 |
| 105 | 3300002459 | JGI24751J29686_10000418 | JGI24751J29686_100004185 | 227 |
| 106 | 3300003322 | rootL2_10334473 | rootL2_103344732 | 227 |
| 107 | 3300005290 | Ga0065712_10165183 | Ga0065712_101651832 | 227 |
| 108 | 3300005293 | Ga0065715_10132142 | Ga0065715_101321421 | 227 |
| 109 | 3300005293 | Ga0065715_10142912 | Ga0065715_101429122 | 227 |
| 110 | 3300005293 | Ga0065715_10232166 | Ga0065715_102321661 | 227 |
| 111 | 3300005293 | Ga0065715_10236207 | Ga0065715_102362071 | 227 |
| 112 | 3300005295 | Ga0065707_10215083 | Ga0065707_102150832 | 227 |
| 113 | 3300005331 | Ga0070670_100000084 | Ga0070670_10000008419 | 227 |
| 114 | 3300005336 | Ga0070680_100007659 | Ga0070680_1000076591 | 227 |
| 115 | 3300005353 | Ga0070669_100102816 | Ga0070669_1001028162 | 227 |
| 116 | 3300005438 | Ga0070701_10007169 | Ga0070701_100071695 | 227 |
| 117 | 3300005438 | Ga0070701_10076621 | Ga0070701_100766211 | 227 |
| 118 | 3300005441 | Ga0070700_100037480 | Ga0070700_1000374801 | 227 |
| 119 | 3300005458 | Ga0070681_10000328 | Ga0070681_1000032810 | 227 |
| 120 | 3300005458 | Ga0070681_10528484 | Ga0070681_105284841 | 227 |
| 121 | 3300005468 | Ga0070707_100333356 | Ga0070707_1003333561 | 227 |
| 122 | 3300005530 | Ga0070679_100000491 | Ga0070679_1000004918 | 227 |
| 123 | 3300005539 | Ga0068853_100370614 | Ga0068853_1003706142 | 227 |
| 124 | 3300005539 | Ga0068853_100822829 | Ga0068853_1008228291 | 227 |
| 125 | 3300005545 | Ga0070695_100114199 | Ga0070695_1001141992 | 227 |
| 126 | 3300005546 | Ga0070696_100415129 | Ga0070696_1004151291 | 227 |
| 127 | 3300005546 | Ga0070696_100561707 | Ga0070696_1005617071 | 227 |
| 128 | 3300005547 | Ga0070693_100054502 | Ga0070693_1000545022 | 227 |
| 129 | 3300005564 | Ga0070664_100516698 | Ga0070664_1005166982 | 227 |
| 130 | 3300005614 | Ga0068856_100005586 | Ga0068856_1000055862 | 227 |
| 131 | 3300005617 | Ga0068859_100021552 | Ga0068859_1000215522 | 227 |
| 132 | 3300005617 | Ga0068859_100070003 | Ga0068859_1000700032 | 227 |
| 133 | 3300005617 | Ga0068859_100170129 | Ga0068859_1001701293 | 227 |
| 134 | 3300005617 | Ga0068859_100418384 | Ga0068859_1004183842 | 227 |
| 135 | 3300005618 | Ga0068864_100118212 | Ga0068864_1001182122 | 227 |
| 136 | 3300005718 | Ga0068866_10429761 | Ga0068866_104297611 | 227 |
| 137 | 3300005842 | Ga0068858_100024892 | Ga0068858_1000248923 | 227 |
| 138 | 3300005842 | Ga0068858_100321511 | Ga0068858_1003215112 | 227 |
| 139 | 3300005843 | Ga0068860_100045107 | Ga0068860_1000451076 | 227 |
| 140 | 3300005843 | Ga0068860_100092124 | Ga0068860_1000921242 | 227 |
| 141 | 3300005844 | Ga0068862_100340641 | Ga0068862_1003406411 | 227 |
| 142 | 3300006881 | Ga0068865_100250724 | Ga0068865_1002507243 | 227 |
| 143 | 3300006914 | Ga0075436_100056720 | Ga0075436_1000567202 | 227 |
| 144 | 3300006931 | Ga0097620_100021553 | Ga0097620_1000215533 | 227 |
| 145 | 3300006931 | Ga0097620_100070004 | Ga0097620_1000700042 | 227 |
| 146 | 3300006931 | Ga0097620_100170139 | Ga0097620_1001701393 | 227 |
| 147 | 3300006931 | Ga0097620_100305817 | Ga0097620_1003058171 | 227 |
| 148 | 3300006931 | Ga0097620_100418372 | Ga0097620_1004183722 | 227 |
| 149 | 3300009101 | Ga0105247_10000485 | Ga0105247_1000048512 | 227 |
| 150 | 3300009148 | Ga0105243_10010280 | Ga0105243_100102808 | 227 |
| 151 | 3300009174 | Ga0105241_10061181 | Ga0105241_100611812 | 227 |
| 152 | 3300009174 | Ga0105241_10117740 | Ga0105241_101177402 | 227 |
| 153 | 3300009176 | Ga0105242_10007007 | Ga0105242_100070073 | 227 |
| 154 | 3300009177 | Ga0105248_10020551 | Ga0105248_100205513 | 227 |
| 155 | 3300009545 | Ga0105237_10730721 | Ga0105237_107307211 | 227 |
| 156 | 3300009551 | Ga0105238_10004962 | Ga0105238_100049628 | 227 |
| 157 | 3300009553 | Ga0105249_10007883 | Ga0105249_100078833 | 227 |
| 158 | 3300010375 | Ga0105239_10633141 | Ga0105239_106331412 | 227 |
| 159 | 3300013297 | Ga0157378_10236826 | Ga0157378_102368262 | 227 |
| 160 | 3300013306 | Ga0163162_10080672 | Ga0163162_100806722 | 227 |
| 161 | 3300013306 | Ga0163162_11194402 | Ga0163162_111944021 | 227 |
| 162 | 3300013307 | Ga0157372_10388233 | Ga0157372_103882331 | 227 |
| 163 | 3300014325 | Ga0163163_10000964 | Ga0163163_100009645 | 227 |
| 164 | 3300014968 | Ga0157379_10179439 | Ga0157379_101794393 | 227 |
| 165 | 3300025900 | Ga0207710_10001072 | Ga0207710_1000107212 | 227 |
| 166 | 3300025904 | Ga0207647_10113707 | Ga0207647_101137072 | 227 |
| 167 | 3300025908 | Ga0207643_10345882 | Ga0207643_103458821 | 227 |
| 168 | 3300025912 | Ga0207707_10000330 | Ga0207707_1000033020 | 227 |
| 169 | 3300025917 | Ga0207660_10029810 | Ga0207660_100298104 | 227 |
| 170 | 3300025921 | Ga0207652_10000839 | Ga0207652_100008393 | 227 |
| 171 | 3300025922 | Ga0207646_10226394 | Ga0207646_102263941 | 227 |
| 172 | 3300025923 | Ga0207681_10089356 | Ga0207681_100893563 | 227 |
| 173 | 3300025924 | Ga0207694_10002288 | Ga0207694_100022886 | 227 |
| 174 | 3300025925 | Ga0207650_10000017 | Ga0207650_10000017119 | 227 |
| 175 | 3300025934 | Ga0207686_10274753 | Ga0207686_102747532 | 227 |
| 176 | 3300025935 | Ga0207709_10004946 | Ga0207709_100049462 | 227 |
| 177 | 3300025936 | Ga0207670_10061623 | Ga0207670_100616233 | 227 |
| 178 | 3300025940 | Ga0207691_10150474 | Ga0207691_101504741 | 227 |
| 179 | 3300025941 | Ga0207711_10169713 | Ga0207711_101697133 | 227 |
| 180 | 3300025961 | Ga0207712_10012283 | Ga0207712_100122835 | 227 |
| 181 | 3300026035 | Ga0207703_10102874 | Ga0207703_101028743 | 227 |
| 182 | 3300026035 | Ga0207703_10296020 | Ga0207703_102960202 | 227 |
| 183 | 3300026041 | Ga0207639_10272414 | Ga0207639_102724143 | 227 |
| 184 | 3300026075 | Ga0207708_10046310 | Ga0207708_100463102 | 227 |
| 185 | 3300026075 | Ga0207708_10209305 | Ga0207708_102093052 | 227 |
| 186 | 3300026078 | Ga0207702_10085732 | Ga0207702_100857322 | 227 |
| 187 | 3300026095 | Ga0207676_10274145 | Ga0207676_102741452 | 227 |
| 188 | 3300026116 | Ga0207674_10096646 | Ga0207674_100966464 | 227 |
| 189 | 3300028380 | Ga0268265_10295196 | Ga0268265_102951961 | 227 |
| 190 | 3300028381 | Ga0268264_10023013 | Ga0268264_100230135 | 227 |
| 191 | 3300032002 | Ga0307416_100657936 | Ga0307416_1006579362 | 227 |
| 192 | 3300035091 | Ga0373951_0001997 | Ga0373951_0001997_2280_2963 | 227 |
| 193 | 3300038996 | Ga0242420_032705 | Ga0242420_032705_172_855 | 227 |
| 194 | 3300048906 | Ga0496103_0166155 | Ga0496103_0166155_451_1134 | 227 |
| 195 | 3300048907 | Ga0496104_0557659 | Ga0496104_0557659_215_898 | 227 |
| 196 | 3300048909 | Ga0496106_0076672 | Ga0496106_0076672_130_813 | 227 |
| 197 | 3300048909 | Ga0496106_0326329 | Ga0496106_0326329_392_1075 | 227 |
| 198 | 3300048909 | Ga0496106_0613693 | Ga0496106_0613693_39_722 | 227 |
| 199 | 3300048911 | Ga0496108_0032570 | Ga0496108_0032570_1982_2665 | 227 |
| 200 | 3300048915 | Ga0496112_0199496 | Ga0496112_0199496_1257_1940 | 227 |
| 201 | 3300048915 | Ga0496112_1005546 | Ga0496112_1005546_19_702 | 227 |
| 202 | 3300048916 | Ga0496113_0289254 | Ga0496113_0289254_88_771 | 227 |
| 203 | 3300049585 | Ga0501069_0094688 | Ga0501069_0094688_932_1615 | 227 |
| 204 | 3300050514 | nmdc:mga08x19_49750_c1 | nmdc:mga08x19_49750_c1_1059_1742 | 227 |
| 205 | iso_pu_bacteria | 2842918807 | 2842921897 | 227 |
| 206 | iso_pu_bacteria | 2953994433 | 2953997885 | 227 |
| 207 | 3300005577 | Ga0068857_100631232 | Ga0068857_1006312321 | 228 |
| 208 | 3300009147 | Ga0114129_10540020 | Ga0114129_105400201 | 228 |
| 209 | 3300031548 | Ga0307408_100026772 | Ga0307408_1000267726 | 228 |
| 210 | 3300031548 | Ga0307408_100048750 | Ga0307408_1000487502 | 228 |
| 211 | 3300031731 | Ga0307405_10091818 | Ga0307405_100918181 | 228 |
| 212 | 3300031731 | Ga0307405_10173060 | Ga0307405_101730601 | 228 |
| 213 | 3300031852 | Ga0307410_10001136 | Ga0307410_1000113613 | 228 |
| 214 | 3300031852 | Ga0307410_10067995 | Ga0307410_100679953 | 228 |
| 215 | 3300031852 | Ga0307410_10605282 | Ga0307410_106052821 | 228 |
| 216 | 3300031852 | Ga0307410_10837560 | Ga0307410_108375601 | 228 |
| 217 | 3300031901 | Ga0307406_10095126 | Ga0307406_100951262 | 228 |
| 218 | 3300031903 | Ga0307407_10018059 | Ga0307407_100180592 | 228 |
| 219 | 3300031903 | Ga0307407_10029814 | Ga0307407_100298142 | 228 |
| 220 | 3300031911 | Ga0307412_10100324 | Ga0307412_101003242 | 228 |
| 221 | 3300031911 | Ga0307412_10177289 | Ga0307412_101772891 | 228 |
| 222 | 3300031995 | Ga0307409_100003510 | Ga0307409_1000035102 | 228 |
| 223 | 3300031995 | Ga0307409_100175204 | Ga0307409_1001752042 | 228 |
| 224 | 3300032002 | Ga0307416_100003047 | Ga0307416_10000304710 | 228 |
| 225 | 3300032002 | Ga0307416_100014624 | Ga0307416_1000146243 | 228 |
| 226 | 3300032002 | Ga0307416_100201288 | Ga0307416_1002012882 | 228 |
| 227 | 3300032004 | Ga0307414_10052396 | Ga0307414_100523962 | 228 |
| 228 | 3300032004 | Ga0307414_10326443 | Ga0307414_103264431 | 228 |
| 229 | 3300032005 | Ga0307411_10011368 | Ga0307411_100113684 | 228 |
| 230 | 3300032005 | Ga0307411_10180272 | Ga0307411_101802722 | 228 |
| 231 | 3300032126 | Ga0307415_100003638 | Ga0307415_1000036382 | 228 |
| 232 | 3300032126 | Ga0307415_100010261 | Ga0307415_1000102616 | 228 |
| 233 | 3300032126 | Ga0307415_100106462 | Ga0307415_1001064623 | 228 |
| 234 | 3300037471 | Ga0395905_0429427 | Ga0395905_0429427_389_1081 | 228 |
| 235 | 3300038443 | Ga0395901_0556608 | Ga0395901_0556608_402_1094 | 228 |
| 236 | 3300049584 | Ga0501068_0214526 | Ga0501068_0214526_87_773 | 228 |
| 237 | 3300049679 | Ga0501249_012942 | Ga0501249_012942_899_1585 | 228 |
| 238 | 3300049769 | Ga0501272_013308 | Ga0501272_013308_199_885 | 228 |
| 239 | 3300050507 | nmdc:mga05p37_456825_c1 | nmdc:mga05p37_456825_c1_748_1434 | 228 |
| 240 | 3300005578 | Ga0068854_100396497 | Ga0068854_1003964972 | 229 |
| 241 | 3300044683 | Ga0466965_0084827 | Ga0466965_0084827_161_850 | 229 |
| 242 | 3300044684 | Ga0466966_0003390 | Ga0466966_0003390_2282_2971 | 229 |
| 243 | 3300044694 | Ga0466963_0007934 | Ga0466963_0007934_2579_3268 | 229 |
| 244 | 3300044706 | Ga0466964_0027824 | Ga0466964_0027824_1153_1842 | 229 |
| 245 | 3300044719 | Ga0466971_0001806 | Ga0466971_0001806_2581_3270 | 229 |
| 246 | 3300044842 | Ga0466957_0005856 | Ga0466957_0005856_3666_4355 | 229 |
| 247 | 3300045049 | Ga0466959_0229769 | Ga0466959_0229769_330_1019 | 229 |
| 248 | 3300045836 | Ga0466958_0008338 | Ga0466958_0008338_2459_3148 | 229 |
| 249 | 3300045976 | Ga0466967_0269521 | Ga0466967_0269521_604_1293 | 229 |
| 250 | 3300061719 | Ga0466962_0000550 | Ga0466962_0000550_4677_5366 | 229 |
| 251 | 3300021358 | Ga0213873_10000476 | Ga0213873_100004765 | 230 |
| 252 | 3300021384 | Ga0213876_10035881 | Ga0213876_100358811 | 230 |
| 253 | 3300022467 | Ga0224712_10090262 | Ga0224712_100902621 | 230 |
| 254 | 3300039437 | Ga0436365_0243521 | Ga0436365_0243521_1520_2212 | 230 |
| 255 | 3300039453 | Ga0436362_0551347 | Ga0436362_0551347_4134_4826 | 230 |
| 256 | 3300044765 | Ga0466970_0021291 | Ga0466970_0021291_1849_2541 | 230 |
| 257 | 3300002075 | JGI24738J21930_10001548 | JGI24738J21930_100015487 | 231 |
| 258 | 3300005535 | Ga0070684_100017970 | Ga0070684_1000179704 | 231 |
| 259 | 3300006175 | Ga0070712_100689909 | Ga0070712_1006899091 | 231 |
| 260 | 3300009093 | Ga0105240_10375498 | Ga0105240_103754983 | 231 |
| 261 | 3300009545 | Ga0105237_10717216 | Ga0105237_107172162 | 231 |
| 262 | 3300013105 | Ga0157369_10038838 | Ga0157369_100388385 | 231 |
| 263 | 3300014497 | Ga0182008_10010143 | Ga0182008_100101434 | 231 |
| 264 | 3300014969 | Ga0157376_10027716 | Ga0157376_100277164 | 231 |
| 265 | 3300015261 | Ga0182006_1002374 | Ga0182006_100237411 | 231 |
| 266 | 3300015265 | Ga0182005_1004417 | Ga0182005_10044171 | 231 |
| 267 | 3300020070 | Ga0206356_10470557 | Ga0206356_104705571 | 231 |
| 268 | 3300020078 | Ga0206352_11225234 | Ga0206352_112252341 | 231 |
| 269 | 3300020080 | Ga0206350_10437509 | Ga0206350_104375092 | 231 |
| 270 | 3300020080 | Ga0206350_10790397 | Ga0206350_107903971 | 231 |
| 271 | 3300020081 | Ga0206354_11213241 | Ga0206354_112132412 | 231 |
| 272 | 3300021441 | Ga0213871_10001724 | Ga0213871_100017244 | 231 |
| 273 | 3300022467 | Ga0224712_10002746 | Ga0224712_100027463 | 231 |
| 274 | 3300022467 | Ga0224712_10031980 | Ga0224712_100319801 | 231 |
| 275 | 3300025913 | Ga0207695_10266240 | Ga0207695_102662403 | 231 |
| 276 | 3300025944 | Ga0207661_10785858 | Ga0207661_107858581 | 231 |
| 277 | 3300031911 | Ga0307412_10004644 | Ga0307412_100046447 | 231 |
| 278 | 3300041404 | Ga0439436_0000020 | Ga0439436_0000020_20988_21683 | 231 |
| 279 | 3300042157 | Ga0439458_0025770 | Ga0439458_0025770_253_948 | 231 |
| 280 | 3300046462 | Ga0495651_0007028 | Ga0495651_0007028_6647_7342 | 231 |
| 281 | 3300046507 | Ga0495606_0153424 | Ga0495606_0153424_235_930 | 231 |
| 282 | 3300046511 | Ga0495608_0155634 | Ga0495608_0155634_689_1384 | 231 |
| 283 | 3300046512 | Ga0495610_0014620 | Ga0495610_0014620_430_1125 | 231 |
| 284 | 3300046559 | Ga0495667_0025808 | Ga0495667_0025808_2502_3197 | 231 |
| 285 | 3300046691 | Ga0495670_0005126 | Ga0495670_0005126_319_1041 | 231 |
| 286 | 3300046694 | Ga0495649_0027009 | Ga0495649_0027009_2281_2976 | 231 |
| 287 | 3300047444 | Ga0495675_0101903 | Ga0495675_0101903_446_1141 | 231 |
| 288 | 3300047471 | Ga0495684_0059149 | Ga0495684_0059149_1950_2645 | 231 |
| 289 | 3300048088 | Ga0495602_0005263 | Ga0495602_0005263_1249_1944 | 231 |
| 290 | 3300048904 | Ga0496101_0076781 | Ga0496101_0076781_1024_1719 | 231 |
| 291 | 3300048918 | Ga0496115_0275529 | Ga0496115_0275529_482_1177 | 231 |
| 292 | 3300048922 | Ga0496119_0026351 | Ga0496119_0026351_340_1035 | 231 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6foz-assembly1.cif.gz_A | the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 13 | 1.006 | 2 | 29 |
| 5x6p-assembly2.cif.gz_B | crystal structure of pseudomonas fluorescens kmo | 1.002 | 2 | 29 |
| 5mzk-assembly1.cif.gz_A | pseudomonas fluorescens kynurenine 3-monooxygenase (kmo) in complex with 3-[5-chloro-6-(cyclobutylmethoxy)-2-oxo-2,3-dihydro-1,3-benzoxazol-3-yl]propanoic acid | 1.002 | 2 | 29 |
| 5nak-assembly1.cif.gz_B | pseudomonas fluorescens kynurenine 3-monooxygenase (kmo) in complex with the enzyme substrate l-kynurenine | 0.9998 | 2 | 29 |
| 3alm-assembly2.cif.gz_B | crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, mutant c294a | 0.9994 | 2 | 29 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5nahA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 1.001 | 2 | 29 | 3.50.50.60 |
| af_P37906_24_389_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9899 | 2 | 29 | 3.50.50.60 |
| af_Q54RE8_8_392_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9892 | 3 | 30 | 3.50.50.60 |
| af_P49086_94_556_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9771 | 2 | 31 | 3.50.50.60 |
| af_Q0D7W4_71_358_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9728 | 2 | 31 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522N821-F1-model_v4 | NADP oxidoreductase | 0.9892 | 1 | 231 |
|
| AF-A0A7K1XA95-F1-model_v4 | deleted | 0.9881 | 138 | 210 |
|
| AF-A0A4Q3XNB6-F1-model_v4 | deleted | 0.9879 | 1 | 128 |
|
| AF-A0A1F3BLC8-F1-model_v4 | NADP oxidoreductase | 0.9873 | 1 | 210 |
|
| AF-A0A522N821-F1-model_v4 | NADP oxidoreductase | 0.9849 | 1 | 231 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar