F389891

General Info

Members Datasets Scaffolds Average Seq Length
290 168 580 308

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0464278|Ga0436365_0464278_3962_4963
Length 333
Sequence MGDDNKEPPMKVFVAGATGAIGKQLVPRLVAAGHKVVGMTRSESKEAILQQLGATPVVADALDPDQVARAVGQARPDVIVHQLTAIGALDLRHFDRDFALTNRLRTEGTNYLLSAGHAVEVRRFVAQSYCAWPYARVGGPVKREEDPLDPSPPREMRKSLAAIRHLEQEVLGADWVEGIVLRYGAFYGPGTSMVAGGEQFEMVRKHRLPLVGNGGGVWSFIHIADAADATVAAIERGRRGVYNIVDDEPAPVAEWLPGLAKALGAKPPRRVPRFVGRLFAGEAGAVMMTEIRGASNTKAKRELAWEPAHPSWRTGFATSSLPPELAAGVRGCP

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
89 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
90 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
91 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
92 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
93 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
94 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
95 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
96 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
103 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
128 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 1.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 7.93
Rhizosphere 85.17
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0464278 3300039437 Bacteria 5045
2 JGI25407J50210_10011782 3300003373 Bacteria 2238
3 Ga0065715_10129572 3300005293 Bacteria 2043
4 Ga0070658_10023752 3300005327 Bacteria 4917
5 Ga0070658_10063453 3300005327 Bacteria 3012
6 Ga0070680_100079833 3300005336 Bacteria 2697
7 Ga0068868_100079077 3300005338 Bacteria 2634
8 Ga0070660_100032542 3300005339 Bacteria 3925
9 Ga0070661_100134095 3300005344 Bacteria 1862
10 Ga0070668_100027280 3300005347 Bacteria 4336
11 Ga0070659_100447108 3300005366 Bacteria 1096
12 Ga0070667_100008351 3300005367 Bacteria 8583
13 Ga0070709_10152499 3300005434 Bacteria 1598
14 Ga0070713_100370586 3300005436 Bacteria 1332
15 Ga0070708_100058091 3300005445 Bacteria 3446
16 Ga0070681_10015179 3300005458 Bacteria 7661
17 Ga0070681_10058178 3300005458 Bacteria 3845
18 Ga0070681_10299388 3300005458 Bacteria 1518
19 Ga0070707_100005664 3300005468 Bacteria 11665
20 Ga0070707_100023225 3300005468 Bacteria 5866
21 Ga0070698_100003249 3300005471 Bacteria 17867
22 Ga0070699_100003199 3300005518 Bacteria 14485
23 Ga0070679_100076586 3300005530 Bacteria 3334
24 Ga0070679_100167507 3300005530 Bacteria 2170
25 Ga0070679_100313485 3300005530 Bacteria 1518
26 Ga0070684_100412197 3300005535 Bacteria 1247
27 Ga0068855_100234454 3300005563 Bacteria 2053
28 Ga0068857_100199191 3300005577 Bacteria 1825
29 Ga0068856_100184228 3300005614 Bacteria 2101
30 Ga0068856_100520708 3300005614 Bacteria 1210
31 Ga0068860_100080671 3300005843 Bacteria 3094
32 Ga0068862_100010144 3300005844 Bacteria 7773
33 Ga0081455_10000397 3300005937 Bacteria 57358
34 Ga0081455_10037030 3300005937 Bacteria 4336
35 Ga0081455_10076436 3300005937 Bacteria 2759
36 Ga0081538_10000534 3300005981 Bacteria 42006
37 Ga0081538_10001699 3300005981 Bacteria 22436
38 Ga0081538_10002207 3300005981 Bacteria 19294
39 Ga0081538_10004036 3300005981 Bacteria 13655
40 Ga0081538_10010037 3300005981 Bacteria 7809
41 Ga0081538_10042211 3300005981 Bacteria 2881
42 Ga0081538_10048986 3300005981 Bacteria 2568
43 Ga0081538_10071087 3300005981 Unclassified 1917
44 Ga0081538_10083178 3300005981 Bacteria 1693
45 Ga0081540_1000104 3300005983 Bacteria 90590
46 Ga0081540_1000129 3300005983 Bacteria 80446
47 Ga0081540_1016047 3300005983 Bacteria 4714
48 Ga0070717_10150425 3300006028 Bacteria 2013
49 Ga0070715_10016679 3300006163 Bacteria 2765
50 Ga0070712_100071205 3300006175 Bacteria 2487
51 Ga0070712_100319391 3300006175 Bacteria 1262
52 Ga0070712_100348633 3300006175 Bacteria 1211
53 Ga0075428_100015022 3300006844 Bacteria 8602
54 Ga0075430_100029202 3300006846 Bacteria 4681
55 Ga0075430_100286103 3300006846 Bacteria 1364
56 Ga0075431_100007478 3300006847 Bacteria 10877
57 Ga0075431_100012416 3300006847 Bacteria 8597
58 Ga0075434_100087977 3300006871 Bacteria 3107
59 Ga0075429_100005750 3300006880 Bacteria 10705
60 Ga0075436_100009227 3300006914 Bacteria 6750
61 Ga0075435_100000484 3300007076 Bacteria 24170
62 Ga0105240_10050353 3300009093 Bacteria 5252
63 Ga0111539_10037471 3300009094 Bacteria 5854
64 Ga0114129_10018416 3300009147 Bacteria 9947
65 Ga0105238_10138387 3300009551 Bacteria 2412
66 Ga0105249_10018515 3300009553 Bacteria 6199
67 Ga0157369_10002850 3300013105 Bacteria 20654
68 Ga0157369_10281176 3300013105 Bacteria 1733
69 Ga0157372_10016454 3300013307 Bacteria 7937
70 Ga0157372_10050511 3300013307 Bacteria 4626
71 Ga0157372_10057795 3300013307 Bacteria 4336
72 Ga0157379_10009820 3300014968 Bacteria 8341
73 Ga0157379_10077162 3300014968 Bacteria 2983
74 Ga0206356_10618835 3300020070 Bacteria 1320
75 Ga0206349_1299144 3300020075 Bacteria 1389
76 Ga0206353_11390740 3300020082 Bacteria 1374
77 Ga0213876_10001790 3300021384 Bacteria 13007
78 Ga0213876_10050044 3300021384 Bacteria 2208
79 Ga0213875_10015929 3300021388 Bacteria 3653
80 Ga0213875_10037693 3300021388 Bacteria 2278
81 Ga0224712_10014516 3300022467 Bacteria 2539
82 Ga0209758_1003155 3300025297 Bacteria 15485
83 Ga0207692_10080216 3300025898 Bacteria 1743
84 Ga0207684_10000306 3300025910 Bacteria 69573
85 Ga0207707_10008406 3300025912 Bacteria 8954
86 Ga0207707_10016397 3300025912 Bacteria 6463
87 Ga0207707_10224752 3300025912 Bacteria 1634
88 Ga0207695_10043099 3300025913 Bacteria 4812
89 Ga0207693_10065430 3300025915 Bacteria 2847
90 Ga0207693_10079049 3300025915 Bacteria 2574
91 Ga0207693_10276946 3300025915 Bacteria 1315
92 Ga0207660_10026803 3300025917 Unclassified 3927
93 Ga0207657_10042832 3300025919 Bacteria 3991
94 Ga0207652_10007874 3300025921 Bacteria 8554
95 Ga0207652_10043605 3300025921 Bacteria 3819
96 Ga0207652_10486415 3300025921 Bacteria 1111
97 Ga0207646_10000899 3300025922 Bacteria 38326
98 Ga0207646_10008355 3300025922 Bacteria 10389
99 Ga0207694_10136140 3300025924 Bacteria 1973
100 Ga0207664_10155655 3300025929 Bacteria 1945
101 Ga0207665_10204236 3300025939 Bacteria 1441
102 Ga0207661_10159125 3300025944 Bacteria 1958
103 Ga0207679_10042270 3300025945 Bacteria 3274
104 Ga0207712_10018991 3300025961 Bacteria 4484
105 Ga0207677_10084837 3300026023 Bacteria 2284
106 Ga0207708_10193133 3300026075 Bacteria 1621
107 Ga0207702_10117228 3300026078 Bacteria 2377
108 Ga0207702_10128053 3300026078 Bacteria 2282
109 Ga0207702_10286004 3300026078 Bacteria 1560
110 Ga0207674_10150973 3300026116 Bacteria 2281
111 Ga0207698_10200666 3300026142 Bacteria 1786
112 Ga0268265_10011286 3300028380 Bacteria 6039
113 Ga0268264_10195978 3300028381 Bacteria 1844
114 Ga0307408_100260075 3300031548 Bacteria 1436
115 Ga0307410_10009547 3300031852 Bacteria 5448
116 Ga0307414_10104124 3300032004 Bacteria 2143
117 Ga0307411_10152634 3300032005 Bacteria 1718
118 Ga0307415_100125033 3300032126 Bacteria 1936
119 Ga0395900_0064150 3300037418 Bacteria 3776
120 Ga0395900_0190300 3300037418 Bacteria 2082
121 Ga0395898_0075657 3300037466 Bacteria 3252
122 Ga0395898_0093142 3300037466 Bacteria 2896
123 Ga0395905_0346211 3300037471 Bacteria 1378
124 Ga0436364_0079008 3300037853 Bacteria 26462
125 Ga0436364_0228792 3300037853 Bacteria 4179
126 Ga0436364_0836472 3300037853 Bacteria 3387
127 Ga0436364_0874179 3300037853 Bacteria 2244
128 Ga0395901_0057947 3300038443 Bacteria 4029
129 Ga0436365_0380486 3300039437 Bacteria 1946
130 Ga0436365_0695780 3300039437 Bacteria 16622
131 Ga0436365_0792129 3300039437 Bacteria 7460
132 Ga0436365_1034273 3300039437 Bacteria 15593
133 Ga0436365_1920264 3300039437 Bacteria 7319
134 Ga0436361_0449605 3300039447 Bacteria 1106
135 Ga0436363_0329983 3300039450 Bacteria 1566
136 Ga0436363_1243622 3300039450 Bacteria 4074
137 Ga0439448_0028377 3300042005 Bacteria 1767
138 Ga0439450_006413 3300042008 Bacteria 2117
139 Ga0439454_000392 3300042011 Bacteria 3394
140 Ga0450923_001397 3300042125 Bacteria 3181
141 Ga0450906_004003 3300042145 Bacteria 3117
142 Ga0439444_0010017 3300042437 Bacteria 1506
143 Ga0439464_0037463 3300042439 Bacteria 1375
144 Ga0439440_0028469 3300042993 Bacteria 1304
145 Ga0466969_0076348 3300044656 Bacteria 1605
146 Ga0466965_0040559 3300044683 Bacteria 2292
147 Ga0466965_0103798 3300044683 Bacteria 1456
148 Ga0466966_0066707 3300044684 Bacteria 2261
149 Ga0466966_0160417 3300044684 Bacteria 1369
150 Ga0466966_0174497 3300044684 Bacteria 1305
151 Ga0466961_0214855 3300044693 Bacteria 1186
152 Ga0466963_0000657 3300044694 Bacteria 16663
153 Ga0466963_0001340 3300044694 Bacteria 13127
154 Ga0466963_0008614 3300044694 Bacteria 6123
155 Ga0466963_0010145 3300044694 Bacteria 5695
156 Ga0466963_0011337 3300044694 Bacteria 5425
157 Ga0466963_0017441 3300044694 Bacteria 4476
158 Ga0466963_0029827 3300044694 Bacteria 3514
159 Ga0466963_0035377 3300044694 Bacteria 3254
160 Ga0466963_0044899 3300044694 Bacteria 2909
161 Ga0466963_0089262 3300044694 Bacteria 2097
162 Ga0466963_0100903 3300044694 Bacteria 1975
163 Ga0466963_0129949 3300044694 Bacteria 1739
164 Ga0466963_0169574 3300044694 Bacteria 1521
165 Ga0466963_0340286 3300044694 Bacteria 1056
166 Ga0466964_0093809 3300044706 Bacteria 1311
167 Ga0466971_0009119 3300044719 Bacteria 4337
168 Ga0466971_0022587 3300044719 Bacteria 2804
169 Ga0466971_0051750 3300044719 Bacteria 1849
170 Ga0466971_0116166 3300044719 Bacteria 1237
171 Ga0466971_0122369 3300044719 Bacteria 1205
172 Ga0466968_0006140 3300044735 Bacteria 4515
173 Ga0466968_0085515 3300044735 Bacteria 1391
174 Ga0466970_0026584 3300044765 Bacteria 3033
175 Ga0466970_0078646 3300044765 Bacteria 1780
176 Ga0466970_0159611 3300044765 Bacteria 1247
177 Ga0466957_0002826 3300044842 Bacteria 9388
178 Ga0466957_0016595 3300044842 Bacteria 4307
179 Ga0466957_0050825 3300044842 Bacteria 2523
180 Ga0466957_0054280 3300044842 Bacteria 2445
181 Ga0466960_0012898 3300044901 Bacteria 3539
182 Ga0466959_0002556 3300045049 Bacteria 11674
183 Ga0466959_0038317 3300045049 Bacteria 3542
184 Ga0466959_0081705 3300045049 Bacteria 2329
185 Ga0466959_0096412 3300045049 Bacteria 2120
186 Ga0466959_0127905 3300045049 Bacteria 1802
187 Ga0466959_0166310 3300045049 Bacteria 1549
188 Ga0466958_0003034 3300045836 Bacteria 8606
189 Ga0466958_0016467 3300045836 Bacteria 4257
190 Ga0466958_0020837 3300045836 Bacteria 3826
191 Ga0466958_0025798 3300045836 Bacteria 3468
192 Ga0466958_0029870 3300045836 Bacteria 3235
193 Ga0466958_0111382 3300045836 Bacteria 1709
194 Ga0466958_0166008 3300045836 Bacteria 1397
195 Ga0466958_0194303 3300045836 Bacteria 1290
196 Ga0466967_0015980 3300045976 Bacteria 5902
197 Ga0466967_0020622 3300045976 Bacteria 5332
198 Ga0466967_0023935 3300045976 Bacteria 5013
199 Ga0466967_0040115 3300045976 Bacteria 4029
200 Ga0466967_0044198 3300045976 Bacteria 3862
201 Ga0466967_0076164 3300045976 Bacteria 3017
202 Ga0466967_0094006 3300045976 Bacteria 2729
203 Ga0466967_0147575 3300045976 Bacteria 2195
204 Ga0466967_0249144 3300045976 Bacteria 1696
205 Ga0466967_0363845 3300045976 Bacteria 1402
206 Ga0466967_0404006 3300045976 Bacteria 1329
207 Ga0495638_0040235 3300046460 Bacteria 2963
208 Ga0495625_0168956 3300046660 Bacteria 1461
209 Ga0495602_0405259 3300048088 Bacteria 972
210 Ga0496100_0272352 3300048903 Bacteria 1259
211 Ga0496101_0110725 3300048904 Bacteria 2066
212 Ga0496101_0123761 3300048904 Bacteria 1958
213 Ga0496102_0143515 3300048905 Bacteria 2240
214 Ga0496102_0162887 3300048905 Bacteria 2098
215 Ga0496102_0200259 3300048905 Bacteria 1882
216 Ga0496104_0012039 3300048907 Bacteria 7764
217 Ga0496105_0017215 3300048908 Bacteria 5790
218 Ga0496105_0048366 3300048908 Bacteria 3510
219 Ga0496107_0359414 3300048910 Bacteria 1083
220 Ga0496108_0000699 3300048911 Bacteria 26051
221 Ga0496108_0061963 3300048911 Bacteria 3149
222 Ga0496109_0016172 3300048912 Bacteria 6520
223 Ga0496110_0055719 3300048913 Bacteria 3479
224 Ga0496110_0478406 3300048913 Bacteria 1134
225 Ga0496111_0000257 3300048914 Bacteria 25776
226 Ga0496111_0101705 3300048914 Bacteria 2112
227 Ga0496112_0002195 3300048915 Bacteria 15543
228 Ga0496112_0002713 3300048915 Bacteria 14324
229 Ga0496112_0104582 3300048915 Bacteria 2801
230 Ga0496113_0211679 3300048916 Bacteria 1543
231 Ga0496114_0021252 3300048917 Bacteria 5278
232 Ga0496115_0193954 3300048918 Bacteria 1678
233 Ga0496119_0013100 3300048922 Bacteria 6646
234 Ga0496120_0093127 3300048923 Bacteria 1606
235 Ga0496121_0009740 3300048924 Bacteria 10989
236 Ga0501031_0000197 3300049568 Bacteria 34286
237 Ga0501032_0000923 3300049569 Bacteria 23754
238 Ga0501033_0000411 3300049570 Bacteria 40975
239 Ga0501034_0008487 3300049571 Bacteria 10849
240 Ga0501034_0013517 3300049571 Bacteria 8402
241 Ga0501036_0000352 3300049572 Bacteria 32373
242 Ga0501037_0000324 3300049573 Bacteria 40550
243 Ga0501037_0130422 3300049573 Bacteria 1803
244 Ga0501038_0000335 3300049574 Bacteria 40628
245 Ga0501039_0002530 3300049575 Bacteria 13647
246 Ga0501040_0016365 3300049576 Bacteria 4909
247 Ga0501040_0245628 3300049576 Bacteria 1276
248 Ga0501042_0038260 3300049578 Bacteria 3407
249 Ga0501042_0153074 3300049578 Bacteria 1663
250 Ga0501043_0000374 3300049579 Bacteria 40575
251 Ga0501046_0000785 3300049580 Bacteria 30716
252 Ga0501047_0000540 3300049581 Bacteria 40769
253 Ga0501048_0000171 3300049582 Bacteria 40760
254 Ga0501067_0006322 3300049583 Bacteria 6569
255 Ga0501068_0126927 3300049584 Bacteria 1593
256 Ga0501069_0024541 3300049585 Bacteria 3289
257 Ga0501070_0000371 3300049586 Bacteria 40848
258 Ga0501070_0207796 3300049586 Bacteria 1607
259 Ga0501071_0515655 3300049587 Bacteria 917
260 Ga0501072_0254990 3300049588 Bacteria 1397
261 Ga0501073_0000467 3300049589 Bacteria 28058
262 Ga0501074_0006919 3300049590 Bacteria 8188
263 Ga0501075_0042683 3300049591 Bacteria 3401
264 Ga0501075_0367872 3300049591 Bacteria 1096
265 Ga0501077_0198042 3300049593 Bacteria 1276
266 Ga0501079_0001339 3300049741 Bacteria 17315
267 Ga0501079_0272431 3300049741 Bacteria 1323
268 Ga0501080_0001647 3300049742 Bacteria 18977
269 Ga0501081_0176733 3300049743 Bacteria 1543
270 Ga0501083_0000793 3300049744 Bacteria 20753
271 Ga0501035_0001313 3300049822 Bacteria 25680
272 Ga0501035_0390854 3300049822 Bacteria 1159
273 Ga0501044_0000687 3300049823 Bacteria 40888
274 Ga0501045_0025518 3300049824 Bacteria 4249
275 nmdc:mga05p37_2495_c1 3300050507 Bacteria 21408
276 nmdc:mga09592_82_c1 3300050508 Bacteria 55790
277 nmdc:mga0qj67_126117_c1 3300050509 Bacteria 2072
278 nmdc:mga0qj67_350918_c1 3300050509 Bacteria 1193
279 nmdc:mga06r32_1278_c1 3300050510 Bacteria 22651
280 nmdc:mga06r32_158713_c1 3300050510 Bacteria 2244
281 nmdc:mga06r32_794_c1 3300050510 Bacteria 27944
282 nmdc:mga08y16_1537_c1 3300050511 Bacteria 23198
283 nmdc:mga08y16_474103_c1 3300050511 Bacteria 1274
284 Ga0501084_0036856 3300054114 Bacteria 4086
285 Ga0501084_0294903 3300054114 Bacteria 1370
286 Ga0501084_0308831 3300054114 Bacteria 1336
287 Ga0501082_0002130 3300060353 Bacteria 17354
288 Ga0466962_0005379 3300061719 Bacteria 6159
289 Ga0466962_0010730 3300061719 Bacteria 4404
290 Ga0466962_0079550 3300061719 Bacteria 1567
291 Ga0436365_0464278
292 JGI25407J50210_10011782
293 Ga0065715_10129572
294 Ga0070658_10023752
295 Ga0070658_10063453
296 Ga0070680_100079833
297 Ga0068868_100079077
298 Ga0070660_100032542
299 Ga0070661_100134095
300 Ga0070668_100027280
301 Ga0070659_100447108
302 Ga0070667_100008351
303 Ga0070709_10152499
304 Ga0070713_100370586
305 Ga0070708_100058091
306 Ga0070681_10015179
307 Ga0070681_10058178
308 Ga0070681_10299388
309 Ga0070707_100005664
310 Ga0070707_100023225
311 Ga0070698_100003249
312 Ga0070699_100003199
313 Ga0070679_100076586
314 Ga0070679_100167507
315 Ga0070679_100313485
316 Ga0070684_100412197
317 Ga0068855_100234454
318 Ga0068857_100199191
319 Ga0068856_100184228
320 Ga0068856_100520708
321 Ga0068860_100080671
322 Ga0068862_100010144
323 Ga0081455_10000397
324 Ga0081455_10037030
325 Ga0081455_10076436
326 Ga0081538_10000534
327 Ga0081538_10001699
328 Ga0081538_10002207
329 Ga0081538_10004036
330 Ga0081538_10010037
331 Ga0081538_10042211
332 Ga0081538_10048986
333 Ga0081538_10071087
334 Ga0081538_10083178
335 Ga0081540_1000104
336 Ga0081540_1000129
337 Ga0081540_1016047
338 Ga0070717_10150425
339 Ga0070715_10016679
340 Ga0070712_100071205
341 Ga0070712_100319391
342 Ga0070712_100348633
343 Ga0075428_100015022
344 Ga0075430_100029202
345 Ga0075430_100286103
346 Ga0075431_100007478
347 Ga0075431_100012416
348 Ga0075434_100087977
349 Ga0075429_100005750
350 Ga0075436_100009227
351 Ga0075435_100000484
352 Ga0105240_10050353
353 Ga0111539_10037471
354 Ga0114129_10018416
355 Ga0105238_10138387
356 Ga0105249_10018515
357 Ga0157369_10002850
358 Ga0157369_10281176
359 Ga0157372_10016454
360 Ga0157372_10050511
361 Ga0157372_10057795
362 Ga0157379_10009820
363 Ga0157379_10077162
364 Ga0206356_10618835
365 Ga0206349_1299144
366 Ga0206353_11390740
367 Ga0213876_10001790
368 Ga0213876_10050044
369 Ga0213875_10015929
370 Ga0213875_10037693
371 Ga0224712_10014516
372 Ga0209758_1003155
373 Ga0207692_10080216
374 Ga0207684_10000306
375 Ga0207707_10008406
376 Ga0207707_10016397
377 Ga0207707_10224752
378 Ga0207695_10043099
379 Ga0207693_10065430
380 Ga0207693_10079049
381 Ga0207693_10276946
382 Ga0207660_10026803
383 Ga0207657_10042832
384 Ga0207652_10007874
385 Ga0207652_10043605
386 Ga0207652_10486415
387 Ga0207646_10000899
388 Ga0207646_10008355
389 Ga0207694_10136140
390 Ga0207664_10155655
391 Ga0207665_10204236
392 Ga0207661_10159125
393 Ga0207679_10042270
394 Ga0207712_10018991
395 Ga0207677_10084837
396 Ga0207708_10193133
397 Ga0207702_10117228
398 Ga0207702_10128053
399 Ga0207702_10286004
400 Ga0207674_10150973
401 Ga0207698_10200666
402 Ga0268265_10011286
403 Ga0268264_10195978
404 Ga0307408_100260075
405 Ga0307410_10009547
406 Ga0307414_10104124
407 Ga0307411_10152634
408 Ga0307415_100125033
409 Ga0395900_0064150
410 Ga0395900_0190300
411 Ga0395898_0075657
412 Ga0395898_0093142
413 Ga0395905_0346211
414 Ga0436364_0079008
415 Ga0436364_0228792
416 Ga0436364_0836472
417 Ga0436364_0874179
418 Ga0395901_0057947
419 Ga0436365_0380486
420 Ga0436365_0695780
421 Ga0436365_0792129
422 Ga0436365_1034273
423 Ga0436365_1920264
424 Ga0436361_0449605
425 Ga0436363_0329983
426 Ga0436363_1243622
427 Ga0439448_0028377
428 Ga0439450_006413
429 Ga0439454_000392
430 Ga0450923_001397
431 Ga0450906_004003
432 Ga0439444_0010017
433 Ga0439464_0037463
434 Ga0439440_0028469
435 Ga0466969_0076348
436 Ga0466965_0040559
437 Ga0466965_0103798
438 Ga0466966_0066707
439 Ga0466966_0160417
440 Ga0466966_0174497
441 Ga0466961_0214855
442 Ga0466963_0000657
443 Ga0466963_0001340
444 Ga0466963_0008614
445 Ga0466963_0010145
446 Ga0466963_0011337
447 Ga0466963_0017441
448 Ga0466963_0029827
449 Ga0466963_0035377
450 Ga0466963_0044899
451 Ga0466963_0089262
452 Ga0466963_0100903
453 Ga0466963_0129949
454 Ga0466963_0169574
455 Ga0466963_0340286
456 Ga0466964_0093809
457 Ga0466971_0009119
458 Ga0466971_0022587
459 Ga0466971_0051750
460 Ga0466971_0116166
461 Ga0466971_0122369
462 Ga0466968_0006140
463 Ga0466968_0085515
464 Ga0466970_0026584
465 Ga0466970_0078646
466 Ga0466970_0159611
467 Ga0466957_0002826
468 Ga0466957_0016595
469 Ga0466957_0050825
470 Ga0466957_0054280
471 Ga0466960_0012898
472 Ga0466959_0002556
473 Ga0466959_0038317
474 Ga0466959_0081705
475 Ga0466959_0096412
476 Ga0466959_0127905
477 Ga0466959_0166310
478 Ga0466958_0003034
479 Ga0466958_0016467
480 Ga0466958_0020837
481 Ga0466958_0025798
482 Ga0466958_0029870
483 Ga0466958_0111382
484 Ga0466958_0166008
485 Ga0466958_0194303
486 Ga0466967_0015980
487 Ga0466967_0020622
488 Ga0466967_0023935
489 Ga0466967_0040115
490 Ga0466967_0044198
491 Ga0466967_0076164
492 Ga0466967_0094006
493 Ga0466967_0147575
494 Ga0466967_0249144
495 Ga0466967_0363845
496 Ga0466967_0404006
497 Ga0495638_0040235
498 Ga0495625_0168956
499 Ga0495602_0405259
500 Ga0496100_0272352
501 Ga0496101_0110725
502 Ga0496101_0123761
503 Ga0496102_0143515
504 Ga0496102_0162887
505 Ga0496102_0200259
506 Ga0496104_0012039
507 Ga0496105_0017215
508 Ga0496105_0048366
509 Ga0496107_0359414
510 Ga0496108_0000699
511 Ga0496108_0061963
512 Ga0496109_0016172
513 Ga0496110_0055719
514 Ga0496110_0478406
515 Ga0496111_0000257
516 Ga0496111_0101705
517 Ga0496112_0002195
518 Ga0496112_0002713
519 Ga0496112_0104582
520 Ga0496113_0211679
521 Ga0496114_0021252
522 Ga0496115_0193954
523 Ga0496119_0013100
524 Ga0496120_0093127
525 Ga0496121_0009740
526 Ga0501031_0000197
527 Ga0501032_0000923
528 Ga0501033_0000411
529 Ga0501034_0008487
530 Ga0501034_0013517
531 Ga0501036_0000352
532 Ga0501037_0000324
533 Ga0501037_0130422
534 Ga0501038_0000335
535 Ga0501039_0002530
536 Ga0501040_0016365
537 Ga0501040_0245628
538 Ga0501042_0038260
539 Ga0501042_0153074
540 Ga0501043_0000374
541 Ga0501046_0000785
542 Ga0501047_0000540
543 Ga0501048_0000171
544 Ga0501067_0006322
545 Ga0501068_0126927
546 Ga0501069_0024541
547 Ga0501070_0000371
548 Ga0501070_0207796
549 Ga0501071_0515655
550 Ga0501072_0254990
551 Ga0501073_0000467
552 Ga0501074_0006919
553 Ga0501075_0042683
554 Ga0501075_0367872
555 Ga0501077_0198042
556 Ga0501079_0001339
557 Ga0501079_0272431
558 Ga0501080_0001647
559 Ga0501081_0176733
560 Ga0501083_0000793
561 Ga0501035_0001313
562 Ga0501035_0390854
563 Ga0501044_0000687
564 Ga0501045_0025518
565 nmdc:mga05p37_2495_c1
566 nmdc:mga09592_82_c1
567 nmdc:mga0qj67_126117_c1
568 nmdc:mga0qj67_350918_c1
569 nmdc:mga06r32_1278_c1
570 nmdc:mga06r32_158713_c1
571 nmdc:mga06r32_794_c1
572 nmdc:mga08y16_1537_c1
573 nmdc:mga08y16_474103_c1
574 Ga0501084_0036856
575 Ga0501084_0294903
576 Ga0501084_0308831
577 Ga0501082_0002130
578 Ga0466962_0005379
579 Ga0466962_0010730
580 Ga0466962_0079550

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

12

94

0.9

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

12

130

0.8

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

13

271

0.79

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

12

245

0.79

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

13

311

0.73

PF13460

NAD_binding_10

NAD(P)H-binding

16

203

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j34-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase - truncated at position 394 plus his tag cleaved. 0.8475 2 37
3d4o-assembly2.cif.gz_B crystal structure of dipicolinate synthase subunit a (np_243269.1) from bacillus halodurans at 2.10 a resolution 0.8466 2 77
1l7d-assembly1.cif.gz_B crystal structure of r. rubrum transhydrogenase domain i without bound nad(h) 0.8287 2 79
3ic5-assembly2.cif.gz_B n-terminal domain of putative saccharopine dehydrogenase from ruegeria pomeroyi. 0.8187 2 115
2x4g-assembly1.cif.gz_A-2 crystal structure of pa4631, a nucleoside-diphosphate-sugar epimerase from pseudomonas aeruginosa 0.8133 1 308
ID Description Score Start End Superfamily
af_Q2FVH5_1_283_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9211 2 308 3.40.50.720
af_Q2FVH5_1_283_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8994 2 308 3.40.50.720
af_Q5VQP1_29_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8902 3 32 3.50.50.60
5twcA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8785 2 34 3.50.50.60
af_D3ZBP5_4_394_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.874 1 34 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A539CWQ6-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.997 1 110
AF-A0A538ETA7-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9907 1 262 GO:0004029
GO:0005737
AF-A0A4Q7YX54-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9883 1 311 GO:0004029
GO:0005737
AF-A0A7M4DN46-F1-model_v4 NAD dependent epimerase/dehydratase family protein 0.9874 111 308 GO:0004029
GO:0005737
AF-A0A1Q5REE9-F1-model_v4 Dehydrogenase 0.9872 1 311 GO:0004029
GO:0005737

Map