F389304

General Info

Members Datasets Scaffolds Average Seq Length
289 156 289 216

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0186006|Ga0316582_0186006_542_1321
Length 259
Sequence LLPPFVRQWEKPKLEIVQSRAILKGAQHSAQAALRDGEIMDLLATFIDLFLHLDKHLSAVIQSYGTWTYLLLLLIIFMETGFVVTPFLPGDSLLFAAGTFASPALGSPLNILVLFVLLCAAAILGDTVNYWIGHFIGERAFSGNIRFLKKEYLDRTQEFYERHGGKTIILARFVPIVRTFAPFVAGVGKMSYGHFIAYNIVGGITWVALFTFGGYFFGNLSFVKDNFSLVVLAIIAISVLPAIIEILKERSRKAAGAQA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
102 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
108 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
116 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
118 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
119 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
126 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.27
Stem 0
Stem Tuber 0
Unclassified 1.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_8621803 2162886012 Bacteria 1019
2 MBSR1b_contig_9875890 2162886012 Bacteria 1765
3 JGI25406J46586_10009887 3300003203 Bacteria 4259
4 rootH1_10118473 3300003323 Bacteria 3667
5 rootH1_10118474 3300003323 Bacteria 4364
6 JGI25405J52794_10005992 3300003911 Bacteria 2212
7 Ga0058859_11631270 3300004798 Bacteria 846
8 Ga0065715_10041072 3300005293 Bacteria 1267
9 Ga0065715_10531079 3300005293 Bacteria 755
10 Ga0065707_10223904 3300005295 Bacteria 1214
11 Ga0070690_100099443 3300005330 Bacteria 1927
12 Ga0070690_100480312 3300005330 Bacteria 926
13 Ga0070690_100704530 3300005330 Bacteria 776
14 Ga0068869_100766181 3300005334 Bacteria 827
15 Ga0070680_100092459 3300005336 Bacteria 2505
16 Ga0070682_100007446 3300005337 Bacteria 6172
17 Ga0070682_100128432 3300005337 Bacteria 1712
18 Ga0070689_100010463 3300005340 Bacteria 6612
19 Ga0070689_100093525 3300005340 Bacteria 2373
20 Ga0070689_100701568 3300005340 Bacteria 884
21 Ga0070687_100193860 3300005343 Bacteria 1226
22 Ga0070692_10043667 3300005345 Bacteria 2306
23 Ga0070692_10312893 3300005345 Bacteria 963
24 Ga0070669_100450293 3300005353 Bacteria 1061
25 Ga0070673_100248680 3300005364 Bacteria 1549
26 Ga0070673_100340305 3300005364 Bacteria 1329
27 Ga0070673_100689866 3300005364 Bacteria 937
28 Ga0070688_100008161 3300005365 Bacteria 5674
29 Ga0070705_100000827 3300005440 Bacteria 17379
30 Ga0070705_100036131 3300005440 Bacteria 2775
31 Ga0070700_100001244 3300005441 Bacteria 12634
32 Ga0070700_100051370 3300005441 Bacteria 2566
33 Ga0070694_100108535 3300005444 Bacteria 1974
34 Ga0070708_100355280 3300005445 Bacteria 1381
35 Ga0070708_100465182 3300005445 Bacteria 1193
36 Ga0070708_100992401 3300005445 Bacteria 787
37 Ga0070678_100013985 3300005456 Bacteria 5046
38 Ga0070678_100312167 3300005456 Bacteria 1340
39 Ga0070662_100434902 3300005457 Bacteria 1087
40 Ga0070662_100739361 3300005457 Bacteria 834
41 Ga0068867_100000637 3300005459 Bacteria 23186
42 Ga0070685_10218372 3300005466 Bacteria 1248
43 Ga0070706_100043102 3300005467 Unclassified 4169
44 Ga0070706_100062482 3300005467 Bacteria 3441
45 Ga0070706_100496281 3300005467 Bacteria 1136
46 Ga0070707_100179294 3300005468 Bacteria 2065
47 Ga0070698_100009505 3300005471 Bacteria 10413
48 Ga0070698_100100626 3300005471 Bacteria 2863
49 Ga0070698_100207737 3300005471 Bacteria 1893
50 Ga0070699_100485969 3300005518 Bacteria 1121
51 Ga0070672_100224605 3300005543 Bacteria 1576
52 Ga0070672_100255335 3300005543 Bacteria 1477
53 Ga0070686_100000404 3300005544 Bacteria 27098
54 Ga0070686_100061495 3300005544 Bacteria 2427
55 Ga0070686_100345924 3300005544 Bacteria 1116
56 Ga0070695_100159064 3300005545 Bacteria 1584
57 Ga0070696_100375324 3300005546 Bacteria 1107
58 Ga0070665_100190801 3300005548 Bacteria 2050
59 Ga0070704_100007839 3300005549 Bacteria 6369
60 Ga0070704_100019768 3300005549 Bacteria 4333
61 Ga0070704_100068524 3300005549 Bacteria 2567
62 Ga0068857_100062185 3300005577 Bacteria 3319
63 Ga0070702_100001906 3300005615 Bacteria 8754
64 Ga0068859_100097440 3300005617 Bacteria 2994
65 Ga0068859_100140276 3300005617 Bacteria 2490
66 Ga0068859_100213269 3300005617 Bacteria 2017
67 Ga0068859_100741629 3300005617 Bacteria 1071
68 Ga0068859_100780613 3300005617 Bacteria 1044
69 Ga0068866_10112160 3300005718 Bacteria 1523
70 Ga0068861_100000207 3300005719 Bacteria 31461
71 Ga0068858_100005929 3300005842 Bacteria 11929
72 Ga0068860_100082249 3300005843 Bacteria 3062
73 Ga0068860_100119548 3300005843 Bacteria 2522
74 Ga0068860_100126137 3300005843 Bacteria 2453
75 Ga0068860_100351759 3300005843 Bacteria 1450
76 Ga0068862_100002710 3300005844 Bacteria 15551
77 Ga0068862_100002989 3300005844 Bacteria 14758
78 Ga0068862_100127196 3300005844 Bacteria 2251
79 Ga0081455_10001096 3300005937 Bacteria 33992
80 Ga0081455_10034138 3300005937 Bacteria 4561
81 Ga0081540_1019031 3300005983 Bacteria 4191
82 Ga0081539_10001995 3300005985 Bacteria 31013
83 Ga0081539_10008507 3300005985 Bacteria 8910
84 Ga0075427_10026249 3300006194 Bacteria 943
85 Ga0068871_100794377 3300006358 Bacteria 872
86 Ga0075428_100025039 3300006844 Bacteria 6602
87 Ga0075428_100026280 3300006844 Bacteria 6447
88 Ga0075428_100158170 3300006844 Bacteria 2460
89 Ga0075428_100760954 3300006844 Unclassified 1030
90 Ga0075430_100004361 3300006846 Bacteria 11946
91 Ga0075430_100440696 3300006846 Bacteria 1075
92 Ga0075431_100000440 3300006847 Bacteria 34030
93 Ga0075431_100003769 3300006847 Bacteria 14736
94 Ga0075431_100017511 3300006847 Bacteria 7283
95 Ga0075431_100161628 3300006847 Bacteria 2303
96 Ga0075433_10045150 3300006852 Bacteria 3830
97 Ga0075434_100132716 3300006871 Bacteria 2510
98 Ga0075429_100058239 3300006880 Bacteria 3364
99 Ga0075429_100065235 3300006880 Bacteria 3170
100 Ga0075429_100201979 3300006880 Bacteria 1742
101 Ga0068865_100001774 3300006881 Bacteria 12663
102 Ga0068865_100501956 3300006881 Bacteria 1012
103 Ga0097620_100097442 3300006931 Bacteria 2994
104 Ga0097620_100140273 3300006931 Bacteria 2490
105 Ga0097620_100213287 3300006931 Bacteria 2017
106 Ga0097620_100741641 3300006931 Bacteria 1071
107 Ga0097620_100780575 3300006931 Bacteria 1044
108 Ga0075435_100072532 3300007076 Bacteria 2813
109 Ga0075435_100092066 3300007076 Bacteria 2503
110 Ga0075435_100257495 3300007076 Bacteria 1486
111 Ga0075435_100698762 3300007076 Bacteria 881
112 Ga0099794_10000965 3300007265 Bacteria 9702
113 Ga0111539_10038553 3300009094 Bacteria 5764
114 Ga0111539_10076126 3300009094 Bacteria 3952
115 Ga0105245_10040910 3300009098 Bacteria 4131
116 Ga0114129_10058453 3300009147 Bacteria 5393
117 Ga0114129_10097783 3300009147 Bacteria 4064
118 Ga0114129_10179655 3300009147 Bacteria 2881
119 Ga0114129_10671382 3300009147 Unclassified 1335
120 Ga0105243_10008323 3300009148 Bacteria 7966
121 Ga0105243_10506951 3300009148 Bacteria 1145
122 Ga0105248_10288593 3300009177 Bacteria 1847
123 Ga0105248_10791674 3300009177 Bacteria 1070
124 Ga0105249_10060542 3300009553 Bacteria 3473
125 Ga0105249_10073848 3300009553 Bacteria 3155
126 Ga0105249_10209835 3300009553 Bacteria 1911
127 Ga0105246_10044544 3300011119 Bacteria 3016
128 Ga0157378_10004592 3300013297 Bacteria 12114
129 Ga0157378_10212241 3300013297 Bacteria 1836
130 Ga0163162_10063469 3300013306 Bacteria 3737
131 Ga0163162_10167611 3300013306 Bacteria 2320
132 Ga0163162_10588986 3300013306 Bacteria 1239
133 Ga0157372_10475866 3300013307 Bacteria 1456
134 Ga0157375_10035533 3300013308 Bacteria 4757
135 Ga0157375_10078893 3300013308 Bacteria 3327
136 Ga0157375_10244511 3300013308 Bacteria 1954
137 Ga0157375_10371844 3300013308 Bacteria 1596
138 Ga0157375_10441989 3300013308 Bacteria 1466
139 Ga0157380_10010411 3300014326 Bacteria 6690
140 Ga0157380_10153348 3300014326 Bacteria 1994
141 Ga0157380_10429005 3300014326 Bacteria 1263
142 Ga0157379_10214128 3300014968 Bacteria 1745
143 Ga0157379_10606231 3300014968 Bacteria 1022
144 Ga0157376_10050950 3300014969 Bacteria 3437
145 Ga0207642_10007100 3300025899 Bacteria 3763
146 Ga0207684_10047221 3300025910 Unclassified 3652
147 Ga0207684_10173489 3300025910 Bacteria 1859
148 Ga0207660_10031175 3300025917 Bacteria 3669
149 Ga0207660_10102035 3300025917 Bacteria 2144
150 Ga0207662_10049236 3300025918 Bacteria 2499
151 Ga0207646_10123036 3300025922 Bacteria 2332
152 Ga0207681_10035401 3300025923 Bacteria 3290
153 Ga0207681_10582655 3300025923 Bacteria 923
154 Ga0207687_10003681 3300025927 Bacteria 10321
155 Ga0207706_10476488 3300025933 Bacteria 1078
156 Ga0207686_10003040 3300025934 Bacteria 9038
157 Ga0207709_10003196 3300025935 Bacteria 9850
158 Ga0207670_10006140 3300025936 Bacteria 6645
159 Ga0207670_10097120 3300025936 Bacteria 2097
160 Ga0207670_10201149 3300025936 Bacteria 1514
161 Ga0207704_10001670 3300025938 Bacteria 9947
162 Ga0207691_10142851 3300025940 Bacteria 2108
163 Ga0207689_10000465 3300025942 Bacteria 38002
164 Ga0207689_10042589 3300025942 Bacteria 3755
165 Ga0207651_10480484 3300025960 Bacteria 1071
166 Ga0207712_10017662 3300025961 Bacteria 4638
167 Ga0207712_10074516 3300025961 Bacteria 2451
168 Ga0207712_10403271 3300025961 Bacteria 1150
169 Ga0207677_10238300 3300026023 Bacteria 1470
170 Ga0207703_10018735 3300026035 Bacteria 5407
171 Ga0207708_10000376 3300026075 Bacteria 34827
172 Ga0207708_10065158 3300026075 Bacteria 2784
173 Ga0207648_10000092 3300026089 Bacteria 84700
174 Ga0207675_100000181 3300026118 Bacteria 56942
175 Ga0207675_100251986 3300026118 Bacteria 1709
176 Ga0207683_10028880 3300026121 Bacteria 4799
177 Ga0207683_10337009 3300026121 Bacteria 1383
178 Ga0207428_10011213 3300027907 Bacteria 7947
179 Ga0207428_10179106 3300027907 Bacteria 1602
180 Ga0268266_10590137 3300028379 Bacteria 1067
181 Ga0268265_10085754 3300028380 Bacteria 2501
182 Ga0268265_10108236 3300028380 Bacteria 2262
183 Ga0268264_10049300 3300028381 Bacteria 3503
184 Ga0268264_10162026 3300028381 Bacteria 2016
185 Ga0265334_10015928 3300028573 Bacteria 3117
186 Ga0265318_10005632 3300028577 Bacteria 5866
187 Ga0265323_10100248 3300028653 Bacteria 959
188 Ga0265336_10006696 3300028666 Bacteria 4133
189 Ga0265338_10193722 3300028800 Bacteria 1538
190 Ga0265320_10025312 3300031240 Bacteria 3121
191 Ga0265340_10033875 3300031247 Bacteria 2541
192 Ga0265316_10018076 3300031344 Bacteria 6073
193 Ga0316579_10022557 3300031691 Bacteria 2816
194 Ga0316579_10083249 3300031691 Bacteria 1525
195 Ga0316579_10161571 3300031691 Bacteria 1082
196 Ga0316576_10009485 3300031727 Bacteria 6284
197 Ga0307405_10119372 3300031731 Bacteria 1802
198 Ga0307405_10220126 3300031731 Bacteria 1392
199 Ga0316577_10156607 3300031733 Bacteria 1284
200 Ga0307410_10481336 3300031852 Bacteria 1018
201 Ga0307416_100130804 3300032002 Bacteria 2259
202 Ga0307416_100177740 3300032002 Bacteria 1991
203 Ga0307414_10434364 3300032004 Bacteria 1148
204 Ga0307415_100217831 3300032126 Bacteria 1528
205 Ga0316585_10066481 3300032137 Bacteria 1168
206 Ga0316593_10148735 3300032168 Bacteria 851
207 Ga0373930_0151870 3300034816 Bacteria 581
208 Ga0373949_0072602 3300035090 Bacteria 904
209 Ga0373941_0036907 3300035115 Bacteria 1489
210 Ga0373941_0180382 3300035115 Bacteria 792
211 Ga0373933_0369668 3300035724 Bacteria 933
212 Ga0316582_0186006 3300036647 Bacteria 1414
213 Ga0316584_0010110 3300036712 Bacteria 6581
214 Ga0316584_0059109 3300036712 Bacteria 2871
215 Ga0451849_1250482 3300041505 Bacteria 1179
216 Ga0451853_1657958 3300041512 Bacteria 1007
217 Ga0439450_029021 3300042008 Bacteria 1234
218 Ga0439460_0037326 3300042461 Bacteria 1413
219 Ga0451577_0000640 3300042876 Bacteria 55750
220 Ga0451577_0000864 3300042876 Bacteria 45147
221 Ga0451577_0010286 3300042876 Bacteria 8954
222 Ga0451577_0125552 3300042876 Bacteria 2299
223 Ga0451577_0168086 3300042876 Bacteria 1976
224 Ga0451577_0329185 3300042876 Bacteria 1386
225 Ga0451577_0941606 3300042876 Bacteria 777
226 Ga0453683_0031474 3300044673 Bacteria 3352
227 Ga0453683_0146175 3300044673 Bacteria 1493
228 Ga0453684_0000036 3300044712 Bacteria 711481
229 Ga0453684_0000317 3300044712 Bacteria 204407
230 Ga0453684_0000318 3300044712 Bacteria 203553
231 Ga0453684_0005793 3300044712 Bacteria 24103
232 Ga0453684_0010010 3300044712 Bacteria 16328
233 Ga0453684_0039213 3300044712 Bacteria 6460
234 Ga0453684_0053058 3300044712 Bacteria 5295
235 Ga0453684_0068600 3300044712 Bacteria 4502
236 Ga0453684_0119394 3300044712 Bacteria 3187
237 Ga0453684_0265891 3300044712 Bacteria 1962
238 Ga0453684_0394906 3300044712 Bacteria 1550
239 Ga0453684_0818544 3300044712 Bacteria 1003
240 Ga0453684_2126536 3300044712 Bacteria 562
241 Ga0451576_0000054 3300045051 Bacteria 308162
242 Ga0451576_0110172 3300045051 Bacteria 2865
243 Ga0451576_0266077 3300045051 Bacteria 1792
244 Ga0501034_0031455 3300049571 Bacteria 5389
245 Ga0501034_0205057 3300049571 Bacteria 1928
246 Ga0501048_0152970 3300049582 Bacteria 1632
247 Ga0501048_0693740 3300049582 Bacteria 731
248 Ga0501067_0018068 3300049583 Bacteria 3904
249 Ga0501068_0000311 3300049584 Bacteria 24353
250 Ga0501069_0115835 3300049585 Bacteria 1528
251 Ga0501071_0002649 3300049587 Bacteria 10959
252 Ga0501072_0005412 3300049588 Bacteria 9719
253 Ga0501072_0053948 3300049588 Bacteria 3167
254 Ga0501073_0017215 3300049589 Bacteria 5235
255 Ga0501074_0052337 3300049590 Bacteria 2947
256 Ga0501075_0043157 3300049591 Unclassified 3382
257 Ga0501076_0010705 3300049592 Bacteria 6818
258 Ga0501076_0160069 3300049592 Bacteria 1834
259 Ga0501076_0576375 3300049592 Bacteria 928
260 Ga0501243_000854 3300049675 Bacteria 4243
261 Ga0501080_0022213 3300049742 Bacteria 5877
262 Ga0501083_0002285 3300049744 Bacteria 13120
263 Ga0501045_0023085 3300049824 Bacteria 4457
264 nmdc:mga05p37_442596_c1 3300050507 Bacteria 1507
265 nmdc:mga05p37_604894_c1 3300050507 Bacteria 1237
266 nmdc:mga05p37_64692_c1 3300050507 Bacteria 4500
267 nmdc:mga09592_18202_c1 3300050508 Bacteria 5760
268 nmdc:mga09592_461972_c1 3300050508 Bacteria 1095
269 nmdc:mga09592_669134_c1 3300050508 Bacteria 885
270 nmdc:mga09592_72605_c1 3300050508 Bacteria 2922
271 nmdc:mga0qj67_12917_c1 3300050509 Bacteria 6301
272 nmdc:mga0qj67_406661_c1 3300050509 Bacteria 1098
273 nmdc:mga06r32_116455_c1 3300050510 Bacteria 2633
274 nmdc:mga06r32_271263_c1 3300050510 Bacteria 1684
275 nmdc:mga06r32_504067_c1 3300050510 Bacteria 1187
276 nmdc:mga08y16_16066_c1 3300050511 Bacteria 7871
277 nmdc:mga08y16_535661_c1 3300050511 Bacteria 1186
278 nmdc:mga0n895_136431_c1 3300050512 Bacteria 2480
279 nmdc:mga0n895_465968_c1 3300050512 Bacteria 1275
280 nmdc:mga0rr50_10648_c1 3300050513 Bacteria 5848
281 nmdc:mga0rr50_228944_c1 3300050513 Bacteria 1537
282 nmdc:mga0rr50_78370_c1 3300050513 Bacteria 2542
283 nmdc:mga0a205_42607_c1 3300050515 Bacteria 4374
284 nmdc:mga0a205_556443_c1 3300050515 Bacteria 1002
285 Ga0501084_0001049 3300054114 Bacteria 21463
286 Ga0501084_0341721 3300054114 Bacteria 1264
287 Ga0501082_0240155 3300060353 Bacteria 1576
288 Ga0530510_0230350 3300061734 Bacteria 1378
289 Ga0530510_0379829 3300061734 Unclassified 1063

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300034816 Ga0373930_0151870 Ga0373930_0151870_22_564 169
2 3300005445 Ga0070708_100992401 Ga0070708_1009924011 175
3 3300044712 Ga0453684_2126536 Ga0453684_2126536_13_543 176
4 3300003323 rootH1_10118473 rootH1_101184734 191
5 3300014326 Ga0157380_10429005 Ga0157380_104290051 192
6 3300007076 Ga0075435_100257495 Ga0075435_1002574951 196
7 3300050513 nmdc:mga0rr50_228944_c1 nmdc:mga0rr50_228944_c1_851_1489 196
8 3300050510 nmdc:mga06r32_504067_c1 nmdc:mga06r32_504067_c1_11_643 199
9 3300044712 Ga0453684_0000036 Ga0453684_0000036_353885_354523 200
10 3300005340 Ga0070689_100093525 Ga0070689_1000935253 202
11 3300005345 Ga0070692_10312893 Ga0070692_103128931 202
12 3300005549 Ga0070704_100019768 Ga0070704_1000197684 202
13 3300005577 Ga0068857_100062185 Ga0068857_1000621853 202
14 3300005843 Ga0068860_100126137 Ga0068860_1001261373 202
15 3300005844 Ga0068862_100002989 Ga0068862_10000298915 202
16 3300009553 Ga0105249_10209835 Ga0105249_102098352 202
17 3300013306 Ga0163162_10167611 Ga0163162_101676113 202
18 3300013308 Ga0157375_10371844 Ga0157375_103718442 202
19 3300025936 Ga0207670_10097120 Ga0207670_100971202 202
20 3300025961 Ga0207712_10017662 Ga0207712_100176623 202
21 3300005471 Ga0070698_100100626 Ga0070698_1001006262 204
22 3300009148 Ga0105243_10506951 Ga0105243_105069511 205
23 3300005440 Ga0070705_100000827 Ga0070705_1000008277 207
24 3300005456 Ga0070678_100013985 Ga0070678_1000139852 208
25 3300006852 Ga0075433_10045150 Ga0075433_100451503 208
26 3300007076 Ga0075435_100072532 Ga0075435_1000725323 208
27 3300011119 Ga0105246_10044544 Ga0105246_100445442 208
28 3300026121 Ga0207683_10028880 Ga0207683_100288802 208
29 3300049571 Ga0501034_0205057 Ga0501034_0205057_390_1031 208
30 3300049583 Ga0501067_0018068 Ga0501067_0018068_2059_2700 208
31 3300049584 Ga0501068_0000311 Ga0501068_0000311_14977_15618 208
32 3300049585 Ga0501069_0115835 Ga0501069_0115835_255_896 208
33 3300049587 Ga0501071_0002649 Ga0501071_0002649_3282_3923 208
34 3300049588 Ga0501072_0053948 Ga0501072_0053948_2412_3053 208
35 3300049589 Ga0501073_0017215 Ga0501073_0017215_1205_1846 208
36 3300049590 Ga0501074_0052337 Ga0501074_0052337_729_1370 208
37 3300049592 Ga0501076_0576375 Ga0501076_0576375_48_689 208
38 3300049742 Ga0501080_0022213 Ga0501080_0022213_420_1061 208
39 3300049744 Ga0501083_0002285 Ga0501083_0002285_8699_9340 208
40 3300050512 nmdc:mga0n895_465968_c1 nmdc:mga0n895_465968_c1_190_846 208
41 3300050513 nmdc:mga0rr50_10648_c1 nmdc:mga0rr50_10648_c1_2495_3151 208
42 3300050515 nmdc:mga0a205_42607_c1 nmdc:mga0a205_42607_c1_46_702 208
43 3300054114 Ga0501084_0001049 Ga0501084_0001049_9945_10586 208
44 3300060353 Ga0501082_0240155 Ga0501082_0240155_330_971 208
45 3300007265 Ga0099794_10000965 Ga0099794_100009652 209
46 3300035115 Ga0373941_0036907 Ga0373941_0036907_132_791 209
47 3300044673 Ga0453683_0031474 Ga0453683_0031474_1515_2144 209
48 3300045051 Ga0451576_0266077 Ga0451576_0266077_873_1502 209
49 3300050510 nmdc:mga06r32_271263_c1 nmdc:mga06r32_271263_c1_668_1327 209
50 3300003323 rootH1_10118474 rootH1_101184744 210
51 3300005330 Ga0070690_100099443 Ga0070690_1000994432 210
52 3300005334 Ga0068869_100766181 Ga0068869_1007661811 210
53 3300005353 Ga0070669_100450293 Ga0070669_1004502931 210
54 3300005364 Ga0070673_100248680 Ga0070673_1002486801 210
55 3300005543 Ga0070672_100224605 Ga0070672_1002246052 210
56 3300005544 Ga0070686_100061495 Ga0070686_1000614952 210
57 3300005617 Ga0068859_100780613 Ga0068859_1007806131 210
58 3300005843 Ga0068860_100351759 Ga0068860_1003517592 210
59 3300006931 Ga0097620_100780575 Ga0097620_1007805751 210
60 3300013308 Ga0157375_10441989 Ga0157375_104419892 210
61 3300014326 Ga0157380_10153348 Ga0157380_101533482 210
62 3300025923 Ga0207681_10035401 Ga0207681_100354011 210
63 3300025940 Ga0207691_10142851 Ga0207691_101428511 210
64 3300025942 Ga0207689_10042589 Ga0207689_100425893 210
65 3300025961 Ga0207712_10403271 Ga0207712_104032712 210
66 3300026118 Ga0207675_100251986 Ga0207675_1002519862 210
67 3300028381 Ga0268264_10162026 Ga0268264_101620262 210
68 3300028653 Ga0265323_10100248 Ga0265323_101002482 210
69 3300028666 Ga0265336_10006696 Ga0265336_100066963 210
70 3300031344 Ga0265316_10018076 Ga0265316_100180764 210
71 3300035724 Ga0373933_0369668 Ga0373933_0369668_51_713 210
72 3300041505 Ga0451849_1250482 Ga0451849_1250482_185_859 210
73 3300042876 Ga0451577_0000640 Ga0451577_0000640_38973_39608 210
74 3300044712 Ga0453684_0000317 Ga0453684_0000317_159948_160583 210
75 3300044712 Ga0453684_0119394 Ga0453684_0119394_18_650 210
76 3300003911 JGI25405J52794_10005992 JGI25405J52794_100059922 211
77 3300004798 Ga0058859_11631270 Ga0058859_116312702 211
78 3300005295 Ga0065707_10223904 Ga0065707_102239041 211
79 3300005330 Ga0070690_100480312 Ga0070690_1004803122 211
80 3300005337 Ga0070682_100007446 Ga0070682_1000074464 211
81 3300005337 Ga0070682_100128432 Ga0070682_1001284323 211
82 3300005445 Ga0070708_100465182 Ga0070708_1004651822 211
83 3300005467 Ga0070706_100043102 Ga0070706_1000431021 211
84 3300005467 Ga0070706_100062482 Ga0070706_1000624822 211
85 3300005617 Ga0068859_100097440 Ga0068859_1000974402 211
86 3300005937 Ga0081455_10001096 Ga0081455_100010968 211
87 3300005983 Ga0081540_1019031 Ga0081540_10190314 211
88 3300005985 Ga0081539_10008507 Ga0081539_100085073 211
89 3300006194 Ga0075427_10026249 Ga0075427_100262492 211
90 3300006844 Ga0075428_100026280 Ga0075428_1000262802 211
91 3300006844 Ga0075428_100760954 Ga0075428_1007609542 211
92 3300006847 Ga0075431_100017511 Ga0075431_1000175113 211
93 3300006871 Ga0075434_100132716 Ga0075434_1001327164 211
94 3300006880 Ga0075429_100058239 Ga0075429_1000582392 211
95 3300006880 Ga0075429_100201979 Ga0075429_1002019791 211
96 3300006931 Ga0097620_100097442 Ga0097620_1000974422 211
97 3300007076 Ga0075435_100092066 Ga0075435_1000920663 211
98 3300009094 Ga0111539_10038553 Ga0111539_100385534 211
99 3300009094 Ga0111539_10076126 Ga0111539_100761264 211
100 3300009147 Ga0114129_10058453 Ga0114129_100584532 211
101 3300009147 Ga0114129_10179655 Ga0114129_101796552 211
102 3300009147 Ga0114129_10671382 Ga0114129_106713822 211
103 3300013308 Ga0157375_10078893 Ga0157375_100788932 211
104 3300025910 Ga0207684_10047221 Ga0207684_100472214 211
105 3300025923 Ga0207681_10582655 Ga0207681_105826551 211
106 3300027907 Ga0207428_10011213 Ga0207428_100112136 211
107 3300027907 Ga0207428_10179106 Ga0207428_101791061 211
108 3300035115 Ga0373941_0180382 Ga0373941_0180382_98_739 211
109 3300042008 Ga0439450_029021 Ga0439450_029021_114_782 211
110 3300042461 Ga0439460_0037326 Ga0439460_0037326_142_810 211
111 3300042876 Ga0451577_0168086 Ga0451577_0168086_1169_1828 211
112 3300044673 Ga0453683_0146175 Ga0453683_0146175_580_1248 211
113 3300044712 Ga0453684_0010010 Ga0453684_0010010_12650_13285 211
114 3300044712 Ga0453684_0265891 Ga0453684_0265891_78_737 211
115 3300049592 Ga0501076_0160069 Ga0501076_0160069_23_691 211
116 3300050507 nmdc:mga05p37_442596_c1 nmdc:mga05p37_442596_c1_568_1236 211
117 3300050507 nmdc:mga05p37_64692_c1 nmdc:mga05p37_64692_c1_1007_1675 211
118 3300050508 nmdc:mga09592_18202_c1 nmdc:mga09592_18202_c1_2794_3462 211
119 3300050508 nmdc:mga09592_72605_c1 nmdc:mga09592_72605_c1_1398_2066 211
120 3300050511 nmdc:mga08y16_16066_c1 nmdc:mga08y16_16066_c1_2989_3657 211
121 3300050512 nmdc:mga0n895_136431_c1 nmdc:mga0n895_136431_c1_917_1633 211
122 3300050513 nmdc:mga0rr50_78370_c1 nmdc:mga0rr50_78370_c1_1139_1855 211
123 3300050515 nmdc:mga0a205_556443_c1 nmdc:mga0a205_556443_c1_281_967 211
124 3300061734 Ga0530510_0230350 Ga0530510_0230350_380_1048 211
125 3300061734 Ga0530510_0379829 Ga0530510_0379829_360_1007 211
126 3300005336 Ga0070680_100092459 Ga0070680_1000924592 212
127 3300005340 Ga0070689_100010463 Ga0070689_1000104633 212
128 3300005343 Ga0070687_100193860 Ga0070687_1001938602 212
129 3300005345 Ga0070692_10043667 Ga0070692_100436672 212
130 3300005365 Ga0070688_100008161 Ga0070688_1000081612 212
131 3300005440 Ga0070705_100036131 Ga0070705_1000361312 212
132 3300005441 Ga0070700_100001244 Ga0070700_1000012449 212
133 3300005459 Ga0068867_100000637 Ga0068867_10000063719 212
134 3300005466 Ga0070685_10218372 Ga0070685_102183722 212
135 3300005471 Ga0070698_100207737 Ga0070698_1002077372 212
136 3300005544 Ga0070686_100000404 Ga0070686_10000040415 212
137 3300005545 Ga0070695_100159064 Ga0070695_1001590642 212
138 3300005546 Ga0070696_100375324 Ga0070696_1003753242 212
139 3300005549 Ga0070704_100068524 Ga0070704_1000685242 212
140 3300005615 Ga0070702_100001906 Ga0070702_1000019063 212
141 3300005617 Ga0068859_100140276 Ga0068859_1001402762 212
142 3300005617 Ga0068859_100741629 Ga0068859_1007416292 212
143 3300005718 Ga0068866_10112160 Ga0068866_101121602 212
144 3300005719 Ga0068861_100000207 Ga0068861_1000002072 212
145 3300005842 Ga0068858_100005929 Ga0068858_1000059294 212
146 3300005843 Ga0068860_100082249 Ga0068860_1000822493 212
147 3300005844 Ga0068862_100002710 Ga0068862_10000271016 212
148 3300005844 Ga0068862_100127196 Ga0068862_1001271961 212
149 3300006358 Ga0068871_100794377 Ga0068871_1007943771 212
150 3300006844 Ga0075428_100158170 Ga0075428_1001581703 212
151 3300006847 Ga0075431_100003769 Ga0075431_1000037698 212
152 3300006847 Ga0075431_100161628 Ga0075431_1001616283 212
153 3300006880 Ga0075429_100065235 Ga0075429_1000652353 212
154 3300006881 Ga0068865_100001774 Ga0068865_1000017745 212
155 3300006931 Ga0097620_100140273 Ga0097620_1001402732 212
156 3300006931 Ga0097620_100741641 Ga0097620_1007416411 212
157 3300009098 Ga0105245_10040910 Ga0105245_100409104 212
158 3300009147 Ga0114129_10097783 Ga0114129_100977832 212
159 3300009148 Ga0105243_10008323 Ga0105243_100083236 212
160 3300009177 Ga0105248_10288593 Ga0105248_102885932 212
161 3300009177 Ga0105248_10791674 Ga0105248_107916741 212
162 3300009553 Ga0105249_10060542 Ga0105249_100605421 212
163 3300013297 Ga0157378_10004592 Ga0157378_100045924 212
164 3300013306 Ga0163162_10063469 Ga0163162_100634693 212
165 3300013308 Ga0157375_10035533 Ga0157375_100355335 212
166 3300014326 Ga0157380_10010411 Ga0157380_100104114 212
167 3300014968 Ga0157379_10214128 Ga0157379_102141281 212
168 3300014969 Ga0157376_10050950 Ga0157376_100509501 212
169 3300025899 Ga0207642_10007100 Ga0207642_100071003 212
170 3300025917 Ga0207660_10031175 Ga0207660_100311754 212
171 3300025918 Ga0207662_10049236 Ga0207662_100492363 212
172 3300025927 Ga0207687_10003681 Ga0207687_1000368111 212
173 3300025934 Ga0207686_10003040 Ga0207686_100030404 212
174 3300025935 Ga0207709_10003196 Ga0207709_100031962 212
175 3300025936 Ga0207670_10006140 Ga0207670_100061405 212
176 3300025936 Ga0207670_10201149 Ga0207670_102011493 212
177 3300025938 Ga0207704_10001670 Ga0207704_100016708 212
178 3300025942 Ga0207689_10000465 Ga0207689_1000046534 212
179 3300026035 Ga0207703_10018735 Ga0207703_100187356 212
180 3300026075 Ga0207708_10000376 Ga0207708_100003763 212
181 3300026089 Ga0207648_10000092 Ga0207648_1000009243 212
182 3300026118 Ga0207675_100000181 Ga0207675_1000001813 212
183 3300028380 Ga0268265_10085754 Ga0268265_100857543 212
184 3300028380 Ga0268265_10108236 Ga0268265_101082363 212
185 3300028381 Ga0268264_10049300 Ga0268264_100493002 212
186 3300028573 Ga0265334_10015928 Ga0265334_100159283 212
187 3300028577 Ga0265318_10005632 Ga0265318_100056325 212
188 3300028800 Ga0265338_10193722 Ga0265338_101937222 212
189 3300031247 Ga0265340_10033875 Ga0265340_100338752 212
190 3300031691 Ga0316579_10022557 Ga0316579_100225573 212
191 3300032168 Ga0316593_10148735 Ga0316593_101487352 212
192 3300041512 Ga0451853_1657958 Ga0451853_1657958_285_935 212
193 3300042876 Ga0451577_0000864 Ga0451577_0000864_32224_32883 212
194 3300042876 Ga0451577_0010286 Ga0451577_0010286_4744_5394 212
195 3300042876 Ga0451577_0125552 Ga0451577_0125552_402_1052 212
196 3300042876 Ga0451577_0329185 Ga0451577_0329185_571_1221 212
197 3300044712 Ga0453684_0000318 Ga0453684_0000318_125145_125795 212
198 3300044712 Ga0453684_0005793 Ga0453684_0005793_2340_2990 212
199 3300044712 Ga0453684_0039213 Ga0453684_0039213_2720_3361 212
200 3300044712 Ga0453684_0068600 Ga0453684_0068600_2642_3292 212
201 3300044712 Ga0453684_0394906 Ga0453684_0394906_689_1357 212
202 3300044712 Ga0453684_0818544 Ga0453684_0818544_55_705 212
203 3300050507 nmdc:mga05p37_604894_c1 nmdc:mga05p37_604894_c1_268_912 212
204 3300050508 nmdc:mga09592_461972_c1 nmdc:mga09592_461972_c1_161_805 212
205 3300005293 Ga0065715_10531079 Ga0065715_105310791 213
206 3300005364 Ga0070673_100340305 Ga0070673_1003403052 213
207 3300005518 Ga0070699_100485969 Ga0070699_1004859692 213
208 3300005544 Ga0070686_100345924 Ga0070686_1003459241 213
209 3300005617 Ga0068859_100213269 Ga0068859_1002132692 213
210 3300005843 Ga0068860_100119548 Ga0068860_1001195482 213
211 3300006844 Ga0075428_100025039 Ga0075428_1000250394 213
212 3300006846 Ga0075430_100440696 Ga0075430_1004406962 213
213 3300006931 Ga0097620_100213287 Ga0097620_1002132872 213
214 3300009553 Ga0105249_10073848 Ga0105249_100738482 213
215 3300013306 Ga0163162_10588986 Ga0163162_105889862 213
216 3300025961 Ga0207712_10074516 Ga0207712_100745162 213
217 3300045051 Ga0451576_0110172 Ga0451576_0110172_83_727 213
218 3300049571 Ga0501034_0031455 Ga0501034_0031455_2465_3106 213
219 3300050509 nmdc:mga0qj67_406661_c1 nmdc:mga0qj67_406661_c1_90_731 213
220 3300050511 nmdc:mga08y16_535661_c1 nmdc:mga08y16_535661_c1_343_984 213
221 3300003203 JGI25406J46586_10009887 JGI25406J46586_100098873 214
222 3300005330 Ga0070690_100704530 Ga0070690_1007045301 214
223 3300005340 Ga0070689_100701568 Ga0070689_1007015681 214
224 3300005364 Ga0070673_100689866 Ga0070673_1006898662 214
225 3300005441 Ga0070700_100051370 Ga0070700_1000513702 214
226 3300005445 Ga0070708_100355280 Ga0070708_1003552802 214
227 3300005456 Ga0070678_100312167 Ga0070678_1003121672 214
228 3300005457 Ga0070662_100434902 Ga0070662_1004349022 214
229 3300005457 Ga0070662_100739361 Ga0070662_1007393611 214
230 3300005467 Ga0070706_100496281 Ga0070706_1004962812 214
231 3300005471 Ga0070698_100009505 Ga0070698_1000095056 214
232 3300005543 Ga0070672_100255335 Ga0070672_1002553351 214
233 3300005548 Ga0070665_100190801 Ga0070665_1001908013 214
234 3300005985 Ga0081539_10001995 Ga0081539_1000199520 214
235 3300006881 Ga0068865_100501956 Ga0068865_1005019562 214
236 3300013297 Ga0157378_10212241 Ga0157378_102122412 214
237 3300013307 Ga0157372_10475866 Ga0157372_104758661 214
238 3300013308 Ga0157375_10244511 Ga0157375_102445112 214
239 3300014968 Ga0157379_10606231 Ga0157379_106062312 214
240 3300025910 Ga0207684_10173489 Ga0207684_101734892 214
241 3300025933 Ga0207706_10476488 Ga0207706_104764882 214
242 3300025960 Ga0207651_10480484 Ga0207651_104804842 214
243 3300026023 Ga0207677_10238300 Ga0207677_102383002 214
244 3300026075 Ga0207708_10065158 Ga0207708_100651583 214
245 3300026121 Ga0207683_10337009 Ga0207683_103370092 214
246 3300028379 Ga0268266_10590137 Ga0268266_105901372 214
247 3300031691 Ga0316579_10083249 Ga0316579_100832492 214
248 3300031691 Ga0316579_10161571 Ga0316579_101615712 214
249 3300031727 Ga0316576_10009485 Ga0316576_100094854 214
250 3300031733 Ga0316577_10156607 Ga0316577_101566071 214
251 3300032137 Ga0316585_10066481 Ga0316585_100664811 214
252 3300035090 Ga0373949_0072602 Ga0373949_0072602_146_853 214
253 3300036647 Ga0316582_0186006 Ga0316582_0186006_542_1321 214
254 3300036712 Ga0316584_0010110 Ga0316584_0010110_1569_2228 214
255 3300036712 Ga0316584_0059109 Ga0316584_0059109_1427_2092 214
256 3300042876 Ga0451577_0941606 Ga0451577_0941606_25_699 214
257 3300044712 Ga0453684_0053058 Ga0453684_0053058_3580_4254 214
258 3300049582 Ga0501048_0693740 Ga0501048_0693740_26_670 214
259 3300005444 Ga0070694_100108535 Ga0070694_1001085351 215
260 3300005549 Ga0070704_100007839 Ga0070704_1000078392 215
261 3300005937 Ga0081455_10034138 Ga0081455_100341383 215
262 3300006846 Ga0075430_100004361 Ga0075430_1000043612 215
263 3300006847 Ga0075431_100000440 Ga0075431_10000044024 215
264 3300025917 Ga0207660_10102035 Ga0207660_101020353 215
265 3300031240 Ga0265320_10025312 Ga0265320_100253124 215
266 3300031731 Ga0307405_10119372 Ga0307405_101193721 215
267 3300031852 Ga0307410_10481336 Ga0307410_104813362 215
268 3300032002 Ga0307416_100177740 Ga0307416_1001777402 215
269 3300032004 Ga0307414_10434364 Ga0307414_104343642 215
270 3300049588 Ga0501072_0005412 Ga0501072_0005412_6628_7275 215
271 3300049675 Ga0501243_000854 Ga0501243_000854_1733_2410 215
272 3300050508 nmdc:mga09592_669134_c1 nmdc:mga09592_669134_c1_160_813 215
273 3300050509 nmdc:mga0qj67_12917_c1 nmdc:mga0qj67_12917_c1_5559_6212 215
274 3300050510 nmdc:mga06r32_116455_c1 nmdc:mga06r32_116455_c1_263_916 215
275 2162886012 MBSR1b_contig_8621803 MBSR1b_0781.00000260 216
276 2162886012 MBSR1b_contig_9875890 MBSR1b_0714.00007020 216
277 3300005293 Ga0065715_10041072 Ga0065715_100410721 216
278 3300005468 Ga0070707_100179294 Ga0070707_1001792942 216
279 3300007076 Ga0075435_100698762 Ga0075435_1006987622 216
280 3300025922 Ga0207646_10123036 Ga0207646_101230363 216
281 3300031731 Ga0307405_10220126 Ga0307405_102201261 216
282 3300032002 Ga0307416_100130804 Ga0307416_1001308042 216
283 3300032126 Ga0307415_100217831 Ga0307415_1002178312 216
284 3300045051 Ga0451576_0000054 Ga0451576_0000054_176127_176801 216
285 3300049582 Ga0501048_0152970 Ga0501048_0152970_812_1498 216
286 3300049591 Ga0501075_0043157 Ga0501075_0043157_345_1031 216
287 3300049592 Ga0501076_0010705 Ga0501076_0010705_266_952 216
288 3300049824 Ga0501045_0023085 Ga0501045_0023085_165_851 216
289 3300054114 Ga0501084_0341721 Ga0501084_0341721_157_843 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09335

VTT_dom

VTT domain

88

216

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w7r-assembly2.cif.gz_D-3 high resolution structure of a fish aquaporin reveals a novel extracellular fold. 0.2925 30 186
5w93-assembly3.cif.gz_C p130cas complex with paxillin ld1 0.2906 33 179
6iww-assembly1.cif.gz_E cryo-em structure of the s. typhimurium oxaloacetate decarboxylase beta-gamma sub-complex 0.29 32 194
5w93-assembly3.cif.gz_C p130cas complex with paxillin ld1 0.2836 33 179
7ldg-assembly1.cif.gz_A-2 crystal structure of the meilb2-brca2 complex 0.2801 16 171
ID Description Score Start End Superfamily
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7998 50 173 1.10.1760.20
af_P0ADR0_21_135_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7751 50 173 1.10.1760.20
af_Q2G1V0_12_273_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.443 9 185 1.20.1080.10
af_Q2G1V0_12_273_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.3867 9 185 1.20.1080.10
af_Q2G1N0_215_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.319 38 209 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A6N6S0L9-F1-model_v4 VTT domain-containing protein 0.9559 31 205 GO:0005886
AF-A0A2G4H630-F1-model_v4 VTT domain-containing protein 0.936 21 213 GO:0005886
AF-W6SH76-F1-model_v4 Protein DedA 0.9305 5 215 GO:0005886
AF-A0A7C3ZAD0-F1-model_v4 VTT domain-containing protein 0.9187 1 208 GO:0005886
AF-A0A4Q5XB06-F1-model_v4 VTT domain-containing protein 0.9177 24 215 GO:0005886

Feature Viewer

pLDDT pTM Quality
75.93 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map