F388159

General Info

Members Datasets Scaffolds Average Seq Length
287 206 286 136

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0260560|Ga0466964_0260560_100_588
Length 162
Sequence MSYFRLAAACGRAYLRLVGYRLILRLDSMPARQQDASARIPRSLHEPEDCRAISEVLSRVGDKWTVLVVATLGDGPKRFNEVRKALGSISQRMLTLTLRALERDGLVTRTVFPTIPPRVDYELTKLGRSLLDPVNELSAWARRNRAAMADARLKFDRGEKTR

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
74 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
75 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
76 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
78 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
79 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
82 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
98 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
99 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
122 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
194 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
195 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
196 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
197 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
198 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
199 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
200 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
201 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
202 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
203 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.45
Nodule 0
Rhizoplane 3.83
Rhizosphere 85.02
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10433637 3300005327 Bacteria 1131
2 Ga0070658_10749637 3300005327 Bacteria 848
3 Ga0070680_100066947 3300005336 Bacteria 2946
4 Ga0070680_100092095 3300005336 Bacteria 2510
5 Ga0070660_100153484 3300005339 Bacteria 1853
6 Ga0070668_101384781 3300005347 Bacteria 641
7 Ga0070709_10073334 3300005434 Bacteria 2216
8 Ga0070714_100270159 3300005435 Bacteria 1576
9 Ga0070713_100032405 3300005436 Bacteria 4174
10 Ga0070713_101307466 3300005436 Bacteria 703
11 Ga0070710_10028676 3300005437 Bacteria 2979
12 Ga0070711_100164658 3300005439 Bacteria 1684
13 Ga0070694_100025166 3300005444 Bacteria 3850
14 Ga0070708_101476911 3300005445 Bacteria 634
15 Ga0070681_10036186 3300005458 Bacteria 4959
16 Ga0070681_10304620 3300005458 Bacteria 1503
17 Ga0070681_10786254 3300005458 Bacteria 869
18 Ga0070681_11833558 3300005458 Bacteria 534
19 Ga0070706_101546458 3300005467 Bacteria 606
20 Ga0070707_100923544 3300005468 Bacteria 837
21 Ga0070699_100015542 3300005518 Bacteria 6541
22 Ga0070699_101539351 3300005518 Bacteria 609
23 Ga0070679_100079978 3300005530 Bacteria 3258
24 Ga0070697_100901896 3300005536 Bacteria 784
25 Ga0070695_100001822 3300005545 Bacteria 12010
26 Ga0070696_100150895 3300005546 Bacteria 1706
27 Ga0068857_100832617 3300005577 Bacteria 882
28 Ga0070702_100172976 3300005615 Bacteria 1406
29 Ga0068861_100139669 3300005719 Bacteria 1976
30 Ga0068863_101267395 3300005841 Bacteria 744
31 Ga0081455_10000226 3300005937 Bacteria 72690
32 Ga0081455_10023039 3300005937 Bacteria 5804
33 Ga0081455_10107474 3300005937 Bacteria 2224
34 Ga0081540_1014888 3300005983 Bacteria 4948
35 Ga0081540_1021257 3300005983 Bacteria 3872
36 Ga0081540_1111022 3300005983 Bacteria 1159
37 Ga0070717_10039972 3300006028 Bacteria 3818
38 Ga0070717_11001641 3300006028 Bacteria 761
39 Ga0075365_10375830 3300006038 Bacteria 1002
40 Ga0075363_100192821 3300006048 Bacteria 1162
41 Ga0075364_10436606 3300006051 Bacteria 894
42 Ga0070712_100276929 3300006175 Bacteria 1350
43 Ga0075362_10063887 3300006177 Bacteria 1670
44 Ga0075369_10009394 3300006186 Bacteria 3797
45 Ga0075366_10650591 3300006195 Bacteria 654
46 Ga0075366_10934939 3300006195 Bacteria 540
47 Ga0068871_100367326 3300006358 Bacteria 1276
48 Ga0075428_100730447 3300006844 Bacteria 1054
49 Ga0075428_101034761 3300006844 Bacteria 869
50 Ga0075430_100240393 3300006846 Bacteria 1501
51 Ga0075430_101402212 3300006846 Unclassified 574
52 Ga0075431_100008899 3300006847 Bacteria 10058
53 Ga0075431_100055629 3300006847 Bacteria 4082
54 Ga0075431_100062963 3300006847 Bacteria 3827
55 Ga0075431_101016803 3300006847 Bacteria 795
56 Ga0075433_10214332 3300006852 Bacteria 1711
57 Ga0075434_100360629 3300006871 Bacteria 1474
58 Ga0075429_100090857 3300006880 Bacteria 2663
59 Ga0075429_100850137 3300006880 Bacteria 799
60 Ga0075435_100024989 3300007076 Bacteria 4644
61 Ga0075435_100243937 3300007076 Bacteria 1528
62 Ga0075435_100755605 3300007076 Bacteria 846
63 Ga0099795_10142136 3300007788 Bacteria 977
64 Ga0111539_10038499 3300009094 Bacteria 5767
65 Ga0111539_10056667 3300009094 Bacteria 4656
66 Ga0111539_10673413 3300009094 Bacteria 1205
67 Ga0114129_10496340 3300009147 Bacteria 1595
68 Ga0105241_11678466 3300009174 Bacteria 617
69 Ga0157373_10757661 3300013100 Bacteria 714
70 Ga0157371_10135663 3300013102 Bacteria 1752
71 Ga0157370_10153588 3300013104 Bacteria 2142
72 Ga0157378_10385926 3300013297 Bacteria 1376
73 Ga0157376_10568139 3300014969 Bacteria 1125
74 Ga0163161_11100424 3300017792 Bacteria 683
75 Ga0213872_10010406 3300021361 Bacteria 4430
76 Ga0207705_10196716 3300025909 Bacteria 1526
77 Ga0207684_10033044 3300025910 Bacteria 4400
78 Ga0207684_10542042 3300025910 Bacteria 996
79 Ga0207693_10505325 3300025915 Bacteria 943
80 Ga0207660_10036976 3300025917 Bacteria 3398
81 Ga0207657_10203467 3300025919 Bacteria 1592
82 Ga0207652_10029595 3300025921 Bacteria 4581
83 Ga0207652_10188298 3300025921 Bacteria 1856
84 Ga0207694_10556784 3300025924 Bacteria 963
85 Ga0207708_10165896 3300026075 Bacteria 1746
86 Ga0207641_10284390 3300026088 Bacteria 1557
87 Ga0209179_1087625 3300027512 Bacteria 689
88 Ga0209813_10007235 3300027866 Bacteria 2761
89 Ga0265325_10293162 3300031241 Bacteria 727
90 Ga0265340_10092560 3300031247 Bacteria 1412
91 Ga0265316_10289566 3300031344 Bacteria 1195
92 Ga0265314_10002456 3300031711 Bacteria 18941
93 Ga0265342_10387126 3300031712 Bacteria 724
94 Ga0307405_11475965 3300031731 Bacteria 597
95 Ga0307416_102303792 3300032002 Bacteria 639
96 Ga0307411_12066964 3300032005 Bacteria 533
97 Ga0373950_0002998 3300034818 Bacteria 2382
98 Ga0373926_0175690 3300035083 Bacteria 820
99 Ga0373944_0004193 3300035089 Bacteria 3747
100 Ga0373923_0058927 3300035111 Bacteria 1627
101 Ga0373939_0002238 3300035114 Bacteria 4585
102 Ga0373956_0493578 3300035119 Bacteria 584
103 Ga0373960_0167944 3300035121 Bacteria 759
104 Ga0373943_0280786 3300035170 Bacteria 941
105 Ga0373946_0032031 3300035171 Bacteria 2109
106 Ga0373955_0297000 3300035172 Bacteria 974
107 Ga0373935_0022408 3300035692 Bacteria 3873
108 Ga0373927_0015419 3300035695 Bacteria 5051
109 Ga0373927_0037794 3300035695 Bacteria 3136
110 Ga0373927_0144273 3300035695 Bacteria 1558
111 Ga0373927_0300415 3300035695 Bacteria 1057
112 Ga0373933_0013173 3300035724 Bacteria 4581
113 Ga0373947_0254343 3300035725 Bacteria 1162
114 Ga0373947_0284250 3300035725 Bacteria 1100
115 Ga0373937_0320313 3300036401 Bacteria 1467
116 Ga0373925_0232829 3300037068 Bacteria 1473
117 Ga0395899_0006618 3300037312 Bacteria 8980
118 Ga0395899_0472731 3300037312 Bacteria 817
119 Ga0395900_0001978 3300037418 Bacteria 23133
120 Ga0395900_0051435 3300037418 Bacteria 4244
121 Ga0395900_1860303 3300037418 Bacteria 512
122 Ga0395898_0004768 3300037466 Bacteria 14762
123 Ga0395905_1026343 3300037471 Bacteria 728
124 Ga0395901_0054825 3300038443 Bacteria 4144
125 Ga0395901_0198974 3300038443 Bacteria 2100
126 Ga0436360_0214396 3300039438 Bacteria 944
127 Ga0436361_1024186 3300039447 Bacteria 12342
128 Ga0451853_1587142 3300041512 Bacteria 1299
129 Ga0439441_034639 3300042001 Bacteria 992
130 Ga0450923_079432 3300042125 Bacteria 736
131 Ga0466965_0344004 3300044683 Bacteria 816
132 Ga0466963_0160003 3300044694 Bacteria 1567
133 Ga0466963_0227571 3300044694 Bacteria 1306
134 Ga0466963_0327900 3300044694 Bacteria 1077
135 Ga0466964_0118360 3300044706 Bacteria 1191
136 Ga0466964_0260560 3300044706 Bacteria 859
137 Ga0466957_0180309 3300044842 Bacteria 1379
138 Ga0466957_0251820 3300044842 Bacteria 1174
139 Ga0466959_0171445 3300045049 Bacteria 1522
140 Ga0466959_0626569 3300045049 Bacteria 723
141 Ga0466958_0036284 3300045836 Bacteria 2950
142 Ga0466958_0143158 3300045836 Bacteria 1506
143 Ga0466967_1062563 3300045976 Bacteria 806
144 Ga0466967_1149942 3300045976 Bacteria 773
145 Ga0495603_0073800 3300046455 Bacteria 2004
146 Ga0495603_0084640 3300046455 Bacteria 1857
147 Ga0495629_0017563 3300046459 Bacteria 5128
148 Ga0495638_0046102 3300046460 Bacteria 2740
149 Ga0495662_0022737 3300046476 Bacteria 3027
150 Ga0495664_0004394 3300046477 Bacteria 7713
151 Ga0495584_0209339 3300046491 Bacteria 991
152 Ga0495585_0309544 3300046492 Bacteria 775
153 Ga0495594_0178838 3300046499 Bacteria 1207
154 Ga0495608_0163941 3300046511 Bacteria 1412
155 Ga0495630_0185647 3300046517 Bacteria 1586
156 Ga0495666_0059211 3300046526 Bacteria 1832
157 Ga0495665_0132090 3300046531 Bacteria 1307
158 Ga0495640_0025243 3300046533 Bacteria 4313
159 Ga0495586_0284729 3300046535 Bacteria 946
160 Ga0495645_0209152 3300046543 Bacteria 1318
161 Ga0495622_0211061 3300046557 Bacteria 863
162 Ga0495633_0295512 3300046558 Bacteria 736
163 Ga0495634_0074411 3300046642 Bacteria 2232
164 Ga0495635_0045824 3300046663 Bacteria 3017
165 Ga0495588_0237728 3300046674 Bacteria 961
166 Ga0495646_0036707 3300046680 Bacteria 3035
167 Ga0495613_0186558 3300046689 Bacteria 1467
168 Ga0495600_0336669 3300046809 Bacteria 947
169 Ga0495581_0198837 3300047315 Bacteria 1172
170 Ga0495604_0205337 3300047317 Bacteria 1364
171 Ga0495674_0002071 3300047319 Bacteria 19667
172 Ga0495676_0445647 3300047321 Bacteria 854
173 Ga0495676_0630751 3300047321 Bacteria 696
174 Ga0495680_0053618 3300047322 Bacteria 3137
175 Ga0495684_0332637 3300047471 Bacteria 1083
176 Ga0495593_0018037 3300047673 Bacteria 3970
177 Ga0496100_0424514 3300048903 Bacteria 1016
178 Ga0496100_1656643 3300048903 Bacteria 506
179 Ga0496101_0127579 3300048904 Bacteria 1929
180 Ga0496103_0944073 3300048906 Bacteria 539
181 Ga0496104_0138715 3300048907 Bacteria 2337
182 Ga0496104_1390096 3300048907 Bacteria 605
183 Ga0496105_1047714 3300048908 Bacteria 608
184 Ga0496109_2008246 3300048912 Bacteria 510
185 Ga0496110_1002394 3300048913 Bacteria 743
186 Ga0496115_0326826 3300048918 Bacteria 1254
187 Ga0496115_1041883 3300048918 Bacteria 623
188 Ga0501031_0011435 3300049568 Bacteria 5781
189 Ga0501031_0862354 3300049568 Bacteria 580
190 Ga0501032_0106352 3300049569 Bacteria 1858
191 Ga0501033_0165576 3300049570 Bacteria 1589
192 Ga0501034_0077142 3300049571 Bacteria 3337
193 Ga0501034_0495102 3300049571 Bacteria 1136
194 Ga0501034_0553736 3300049571 Bacteria 1059
195 Ga0501036_0006085 3300049572 Bacteria 9789
196 Ga0501037_0017825 3300049573 Bacteria 5227
197 Ga0501037_0187552 3300049573 Bacteria 1465
198 Ga0501038_0018260 3300049574 Bacteria 6331
199 Ga0501038_0396652 3300049574 Bacteria 1068
200 Ga0501039_0085085 3300049575 Bacteria 2463
201 Ga0501039_1264365 3300049575 Bacteria 570
202 Ga0501042_0099138 3300049578 Bacteria 2095
203 Ga0501043_0176068 3300049579 Bacteria 1667
204 Ga0501043_0774445 3300049579 Bacteria 696
205 Ga0501046_0008583 3300049580 Bacteria 8890
206 Ga0501046_0422921 3300049580 Bacteria 960
207 Ga0501047_0164361 3300049581 Bacteria 2091
208 Ga0501048_0017748 3300049582 Bacteria 5236
209 Ga0501067_0032437 3300049583 Bacteria 2899
210 Ga0501067_0180773 3300049583 Bacteria 1175
211 Ga0501068_0060487 3300049584 Bacteria 2300
212 Ga0501068_0287460 3300049584 Bacteria 1051
213 Ga0501069_0000924 3300049585 Bacteria 14008
214 Ga0501069_0153978 3300049585 Bacteria 1322
215 Ga0501070_0009684 3300049586 Bacteria 8148
216 Ga0501070_0268886 3300049586 Bacteria 1392
217 Ga0501071_0019503 3300049587 Bacteria 4706
218 Ga0501071_0021112 3300049587 Bacteria 4535
219 Ga0501071_0962299 3300049587 Bacteria 659
220 Ga0501073_0031134 3300049589 Bacteria 3807
221 Ga0501073_0318971 3300049589 Bacteria 1072
222 Ga0501074_0001513 3300049590 Bacteria 15700
223 Ga0501075_0526582 3300049591 Bacteria 902
224 Ga0501076_0526823 3300049592 Bacteria 974
225 Ga0501079_0319468 3300049741 Bacteria 1215
226 Ga0501080_0236781 3300049742 Bacteria 1667
227 Ga0501080_0246936 3300049742 Bacteria 1628
228 Ga0501081_0676699 3300049743 Bacteria 774
229 Ga0501083_0031160 3300049744 Bacteria 3660
230 Ga0501083_0293547 3300049744 Bacteria 1057
231 Ga0501083_0773832 3300049744 Bacteria 624
232 Ga0501035_1207867 3300049822 Bacteria 586
233 Ga0501044_0005986 3300049823 Bacteria 13449
234 Ga0501044_0158735 3300049823 Bacteria 2239
235 Ga0501044_0334411 3300049823 Bacteria 1436
236 Ga0501044_0533909 3300049823 Bacteria 1072
237 Ga0501045_0079158 3300049824 Bacteria 2423
238 nmdc:mga03n38_46179_c1 3300050490 Bacteria 1922
239 nmdc:mga00v17_106889_c1 3300050491 Bacteria 1772
240 nmdc:mga0yw44_114001_c1 3300050492 Bacteria 1735
241 nmdc:mga06z11_398009_c1 3300050494 Bacteria 829
242 nmdc:mga06z11_588619_c1 3300050494 Bacteria 677
243 nmdc:mga04h51_3760_c1 3300050495 Bacteria 3720
244 nmdc:mga07m45_30674_c1 3300050496 Bacteria 2979
245 nmdc:mga05p37_16927_c1 3300050507 Bacteria 8790
246 nmdc:mga05p37_4905_c1 3300050507 Bacteria 15664
247 nmdc:mga09592_152002_c1 3300050508 Bacteria 1997
248 nmdc:mga0qj67_1127986_c1 3300050509 Unclassified 612
249 nmdc:mga0qj67_397749_c1 3300050509 Bacteria 1112
250 nmdc:mga06r32_15631_c1 3300050510 Bacteria 6896
251 nmdc:mga06r32_5143_c1 3300050510 Bacteria 11767
252 nmdc:mga08y16_102773_c1 3300050511 Bacteria 2975
253 nmdc:mga08y16_46642_c1 3300050511 Bacteria 4536
254 nmdc:mga08y16_738637_c1 3300050511 Bacteria 981
255 nmdc:mga0n895_1030154_c1 3300050512 Bacteria 803
256 nmdc:mga0n895_28493_c1 3300050512 Bacteria 5312
257 nmdc:mga0n895_326961_c1 3300050512 Bacteria 1553
258 nmdc:mga0rr50_48889_c1 3300050513 Bacteria 3128
259 nmdc:mga08x19_205723_c1 3300050514 Bacteria 1350
260 nmdc:mga0a205_170655_c1 3300050515 Bacteria 2071
261 nmdc:mga0a205_357850_c1 3300050515 Bacteria 1326
262 nmdc:mga0a205_83553_c1 3300050515 Bacteria 3084
263 nmdc:mga0sz30_307625_c1 3300050516 Bacteria 707
264 nmdc:mga0sz30_7754_c1 3300050516 Bacteria 2408
265 Ga0495601_0092393 3300053077 Bacteria 1949
266 Ga0495601_0199266 3300053077 Bacteria 1308
267 Ga0495612_0000159 3300053078 Bacteria 28394
268 Ga0495595_0173055 3300053084 Bacteria 1069
269 Ga0495595_0257895 3300053084 Bacteria 874
270 Ga0495619_0003909 3300053085 Bacteria 9571
271 Ga0500643_010723 3300053087 Bacteria 3390
272 Ga0500644_0000244 3300053088 Bacteria 30838
273 Ga0500646_0138477 3300053090 Bacteria 797
274 Ga0500651_0029966 3300053093 Bacteria 3422
275 Ga0500566_0081038 3300053094 Bacteria 1806
276 Ga0500641_0011165 3300053096 Bacteria 3258
277 Ga0500650_0134598 3300053098 Bacteria 1148
278 Ga0500650_0473524 3300053098 Bacteria 535
279 Ga0500594_0090201 3300053118 Bacteria 930
280 Ga0500595_000002 3300053119 Bacteria 1074388
281 Ga0500655_021586 3300053133 Bacteria 1208
282 Ga0500573_0242808 3300053140 Bacteria 933
283 Ga0500616_0000002 3300053153 Bacteria 1611257
284 Ga0501082_0094845 3300060353 Bacteria 2578
285 Ga0466962_0044065 3300061719 Bacteria 2135
286 Ga0466962_0056911 3300061719 Bacteria 1867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221547 2643757096 129
2 3300049744 Ga0501083_0773832 Ga0501083_0773832_210_602 130
3 3300009094 Ga0111539_10673413 Ga0111539_106734132 131
4 3300044683 Ga0466965_0344004 Ga0466965_0344004_274_678 131
5 3300044694 Ga0466963_0227571 Ga0466963_0227571_440_844 131
6 3300044842 Ga0466957_0251820 Ga0466957_0251820_13_417 131
7 3300045049 Ga0466959_0171445 Ga0466959_0171445_28_432 131
8 3300045836 Ga0466958_0036284 Ga0466958_0036284_1423_1827 131
9 3300045976 Ga0466967_1149942 Ga0466967_1149942_275_679 131
10 3300048903 Ga0496100_0424514 Ga0496100_0424514_74_472 131
11 3300048904 Ga0496101_0127579 Ga0496101_0127579_1204_1602 131
12 3300048907 Ga0496104_1390096 Ga0496104_1390096_145_543 131
13 3300048913 Ga0496110_1002394 Ga0496110_1002394_120_518 131
14 3300050511 nmdc:mga08y16_738637_c1 nmdc:mga08y16_738637_c1_111_509 131
15 3300050514 nmdc:mga08x19_205723_c1 nmdc:mga08x19_205723_c1_20_418 131
16 3300050515 nmdc:mga0a205_170655_c1 nmdc:mga0a205_170655_c1_1216_1617 131
17 3300061719 Ga0466962_0044065 Ga0466962_0044065_781_1185 131
18 3300005436 Ga0070713_101307466 Ga0070713_1013074662 132
19 3300005458 Ga0070681_11833558 Ga0070681_118335581 132
20 3300006028 Ga0070717_11001641 Ga0070717_110016412 132
21 3300006175 Ga0070712_100276929 Ga0070712_1002769292 132
22 3300025915 Ga0207693_10505325 Ga0207693_105053251 132
23 3300035083 Ga0373926_0175690 Ga0373926_0175690_35_433 132
24 3300035089 Ga0373944_0004193 Ga0373944_0004193_1905_2303 132
25 3300035111 Ga0373923_0058927 Ga0373923_0058927_134_532 132
26 3300035170 Ga0373943_0280786 Ga0373943_0280786_458_856 132
27 3300035171 Ga0373946_0032031 Ga0373946_0032031_1221_1619 132
28 3300035172 Ga0373955_0297000 Ga0373955_0297000_458_856 132
29 3300035692 Ga0373935_0022408 Ga0373935_0022408_618_1016 132
30 3300035695 Ga0373927_0037794 Ga0373927_0037794_1617_2015 132
31 3300035725 Ga0373947_0254343 Ga0373947_0254343_30_428 132
32 3300037068 Ga0373925_0232829 Ga0373925_0232829_186_584 132
33 3300044694 Ga0466963_0160003 Ga0466963_0160003_1144_1548 132
34 3300044706 Ga0466964_0260560 Ga0466964_0260560_100_588 132
35 3300044842 Ga0466957_0180309 Ga0466957_0180309_67_471 132
36 3300045049 Ga0466959_0626569 Ga0466959_0626569_34_438 132
37 3300045836 Ga0466958_0143158 Ga0466958_0143158_556_1044 132
38 3300045976 Ga0466967_1062563 Ga0466967_1062563_139_537 132
39 3300046455 Ga0495603_0073800 Ga0495603_0073800_1255_1653 132
40 3300046459 Ga0495629_0017563 Ga0495629_0017563_2031_2429 132
41 3300046476 Ga0495662_0022737 Ga0495662_0022737_1559_1957 132
42 3300046477 Ga0495664_0004394 Ga0495664_0004394_3455_3853 132
43 3300046499 Ga0495594_0178838 Ga0495594_0178838_362_760 132
44 3300046511 Ga0495608_0163941 Ga0495608_0163941_768_1166 132
45 3300046517 Ga0495630_0185647 Ga0495630_0185647_691_1089 132
46 3300046526 Ga0495666_0059211 Ga0495666_0059211_248_646 132
47 3300046531 Ga0495665_0132090 Ga0495665_0132090_458_856 132
48 3300046533 Ga0495640_0025243 Ga0495640_0025243_2013_2411 132
49 3300046535 Ga0495586_0284729 Ga0495586_0284729_326_724 132
50 3300046543 Ga0495645_0209152 Ga0495645_0209152_647_1045 132
51 3300046557 Ga0495622_0211061 Ga0495622_0211061_70_468 132
52 3300046642 Ga0495634_0074411 Ga0495634_0074411_1232_1630 132
53 3300046663 Ga0495635_0045824 Ga0495635_0045824_1257_1655 132
54 3300046674 Ga0495588_0237728 Ga0495588_0237728_214_612 132
55 3300046680 Ga0495646_0036707 Ga0495646_0036707_824_1222 132
56 3300046689 Ga0495613_0186558 Ga0495613_0186558_508_906 132
57 3300046809 Ga0495600_0336669 Ga0495600_0336669_277_675 132
58 3300047315 Ga0495581_0198837 Ga0495581_0198837_401_799 132
59 3300047317 Ga0495604_0205337 Ga0495604_0205337_294_692 132
60 3300047319 Ga0495674_0002071 Ga0495674_0002071_14002_14400 132
61 3300047321 Ga0495676_0445647 Ga0495676_0445647_133_531 132
62 3300047322 Ga0495680_0053618 Ga0495680_0053618_1833_2231 132
63 3300047471 Ga0495684_0332637 Ga0495684_0332637_472_870 132
64 3300047673 Ga0495593_0018037 Ga0495593_0018037_2750_3148 132
65 3300048918 Ga0496115_0326826 Ga0496115_0326826_293_691 132
66 3300049568 Ga0501031_0862354 Ga0501031_0862354_92_511 132
67 3300050512 nmdc:mga0n895_28493_c1 nmdc:mga0n895_28493_c1_1161_1559 132
68 3300053077 Ga0495601_0199266 Ga0495601_0199266_459_857 132
69 3300053078 Ga0495612_0000159 Ga0495612_0000159_20110_20508 132
70 3300053085 Ga0495619_0003909 Ga0495619_0003909_8387_8785 132
71 3300061719 Ga0466962_0056911 Ga0466962_0056911_1127_1615 132
72 3300005327 Ga0070658_10433637 Ga0070658_104336372 133
73 3300005327 Ga0070658_10749637 Ga0070658_107496371 133
74 3300005336 Ga0070680_100066947 Ga0070680_1000669471 133
75 3300005336 Ga0070680_100092095 Ga0070680_1000920952 133
76 3300005339 Ga0070660_100153484 Ga0070660_1001534843 133
77 3300005347 Ga0070668_101384781 Ga0070668_1013847811 133
78 3300005434 Ga0070709_10073334 Ga0070709_100733342 133
79 3300005435 Ga0070714_100270159 Ga0070714_1002701592 133
80 3300005436 Ga0070713_100032405 Ga0070713_1000324052 133
81 3300005437 Ga0070710_10028676 Ga0070710_100286761 133
82 3300005439 Ga0070711_100164658 Ga0070711_1001646581 133
83 3300005444 Ga0070694_100025166 Ga0070694_1000251664 133
84 3300005445 Ga0070708_101476911 Ga0070708_1014769111 133
85 3300005458 Ga0070681_10036186 Ga0070681_100361865 133
86 3300005458 Ga0070681_10304620 Ga0070681_103046203 133
87 3300005458 Ga0070681_10786254 Ga0070681_107862541 133
88 3300005467 Ga0070706_101546458 Ga0070706_1015464581 133
89 3300005468 Ga0070707_100923544 Ga0070707_1009235441 133
90 3300005518 Ga0070699_100015542 Ga0070699_1000155424 133
91 3300005518 Ga0070699_101539351 Ga0070699_1015393511 133
92 3300005530 Ga0070679_100079978 Ga0070679_1000799783 133
93 3300005536 Ga0070697_100901896 Ga0070697_1009018962 133
94 3300005545 Ga0070695_100001822 Ga0070695_1000018224 133
95 3300005546 Ga0070696_100150895 Ga0070696_1001508952 133
96 3300005577 Ga0068857_100832617 Ga0068857_1008326171 133
97 3300005615 Ga0070702_100172976 Ga0070702_1001729763 133
98 3300005719 Ga0068861_100139669 Ga0068861_1001396692 133
99 3300005841 Ga0068863_101267395 Ga0068863_1012673951 133
100 3300005937 Ga0081455_10000226 Ga0081455_1000022667 133
101 3300005937 Ga0081455_10023039 Ga0081455_100230398 133
102 3300005937 Ga0081455_10107474 Ga0081455_101074743 133
103 3300005983 Ga0081540_1014888 Ga0081540_10148882 133
104 3300005983 Ga0081540_1021257 Ga0081540_10212572 133
105 3300005983 Ga0081540_1111022 Ga0081540_11110221 133
106 3300006028 Ga0070717_10039972 Ga0070717_100399723 133
107 3300006038 Ga0075365_10375830 Ga0075365_103758301 133
108 3300006048 Ga0075363_100192821 Ga0075363_1001928212 133
109 3300006051 Ga0075364_10436606 Ga0075364_104366062 133
110 3300006177 Ga0075362_10063887 Ga0075362_100638872 133
111 3300006186 Ga0075369_10009394 Ga0075369_100093942 133
112 3300006195 Ga0075366_10650591 Ga0075366_106505911 133
113 3300006195 Ga0075366_10934939 Ga0075366_109349391 133
114 3300006358 Ga0068871_100367326 Ga0068871_1003673263 133
115 3300006844 Ga0075428_100730447 Ga0075428_1007304472 133
116 3300006844 Ga0075428_101034761 Ga0075428_1010347612 133
117 3300006846 Ga0075430_100240393 Ga0075430_1002403931 133
118 3300006846 Ga0075430_101402212 Ga0075430_1014022121 133
119 3300006847 Ga0075431_100008899 Ga0075431_1000088995 133
120 3300006847 Ga0075431_100055629 Ga0075431_1000556293 133
121 3300006847 Ga0075431_100062963 Ga0075431_1000629632 133
122 3300006847 Ga0075431_101016803 Ga0075431_1010168031 133
123 3300006852 Ga0075433_10214332 Ga0075433_102143323 133
124 3300006871 Ga0075434_100360629 Ga0075434_1003606291 133
125 3300006880 Ga0075429_100090857 Ga0075429_1000908574 133
126 3300006880 Ga0075429_100850137 Ga0075429_1008501371 133
127 3300007076 Ga0075435_100024989 Ga0075435_1000249895 133
128 3300007076 Ga0075435_100243937 Ga0075435_1002439372 133
129 3300007076 Ga0075435_100755605 Ga0075435_1007556052 133
130 3300007788 Ga0099795_10142136 Ga0099795_101421361 133
131 3300009094 Ga0111539_10038499 Ga0111539_100384994 133
132 3300009094 Ga0111539_10056667 Ga0111539_100566672 133
133 3300009147 Ga0114129_10496340 Ga0114129_104963403 133
134 3300009174 Ga0105241_11678466 Ga0105241_116784662 133
135 3300013100 Ga0157373_10757661 Ga0157373_107576612 133
136 3300013102 Ga0157371_10135663 Ga0157371_101356631 133
137 3300013104 Ga0157370_10153588 Ga0157370_101535884 133
138 3300013297 Ga0157378_10385926 Ga0157378_103859262 133
139 3300014969 Ga0157376_10568139 Ga0157376_105681392 133
140 3300017792 Ga0163161_11100424 Ga0163161_111004241 133
141 3300021361 Ga0213872_10010406 Ga0213872_100104062 133
142 3300025909 Ga0207705_10196716 Ga0207705_101967163 133
143 3300025910 Ga0207684_10033044 Ga0207684_100330444 133
144 3300025910 Ga0207684_10542042 Ga0207684_105420422 133
145 3300025917 Ga0207660_10036976 Ga0207660_100369764 133
146 3300025919 Ga0207657_10203467 Ga0207657_102034672 133
147 3300025921 Ga0207652_10029595 Ga0207652_100295954 133
148 3300025921 Ga0207652_10188298 Ga0207652_101882981 133
149 3300025924 Ga0207694_10556784 Ga0207694_105567842 133
150 3300026075 Ga0207708_10165896 Ga0207708_101658962 133
151 3300026088 Ga0207641_10284390 Ga0207641_102843902 133
152 3300027512 Ga0209179_1087625 Ga0209179_10876251 133
153 3300027866 Ga0209813_10007235 Ga0209813_100072353 133
154 3300031241 Ga0265325_10293162 Ga0265325_102931621 133
155 3300031247 Ga0265340_10092560 Ga0265340_100925602 133
156 3300031344 Ga0265316_10289566 Ga0265316_102895662 133
157 3300031711 Ga0265314_10002456 Ga0265314_1000245610 133
158 3300031712 Ga0265342_10387126 Ga0265342_103871262 133
159 3300031731 Ga0307405_11475965 Ga0307405_114759652 133
160 3300032002 Ga0307416_102303792 Ga0307416_1023037921 133
161 3300032005 Ga0307411_12066964 Ga0307411_120669641 133
162 3300034818 Ga0373950_0002998 Ga0373950_0002998_1777_2181 133
163 3300035114 Ga0373939_0002238 Ga0373939_0002238_3421_3840 133
164 3300035119 Ga0373956_0493578 Ga0373956_0493578_42_449 133
165 3300035121 Ga0373960_0167944 Ga0373960_0167944_177_584 133
166 3300035695 Ga0373927_0015419 Ga0373927_0015419_4113_4520 133
167 3300035695 Ga0373927_0144273 Ga0373927_0144273_438_845 133
168 3300035695 Ga0373927_0300415 Ga0373927_0300415_622_1029 133
169 3300035724 Ga0373933_0013173 Ga0373933_0013173_967_1374 133
170 3300035725 Ga0373947_0284250 Ga0373947_0284250_229_636 133
171 3300036401 Ga0373937_0320313 Ga0373937_0320313_282_689 133
172 3300037312 Ga0395899_0006618 Ga0395899_0006618_6906_7307 133
173 3300037312 Ga0395899_0472731 Ga0395899_0472731_389_793 133
174 3300037418 Ga0395900_0001978 Ga0395900_0001978_16209_16613 133
175 3300037418 Ga0395900_0051435 Ga0395900_0051435_1418_1819 133
176 3300037418 Ga0395900_1860303 Ga0395900_1860303_20_421 133
177 3300037466 Ga0395898_0004768 Ga0395898_0004768_4816_5217 133
178 3300037471 Ga0395905_1026343 Ga0395905_1026343_176_583 133
179 3300038443 Ga0395901_0054825 Ga0395901_0054825_2217_2621 133
180 3300038443 Ga0395901_0198974 Ga0395901_0198974_582_983 133
181 3300039438 Ga0436360_0214396 Ga0436360_0214396_498_905 133
182 3300039447 Ga0436361_1024186 Ga0436361_1024186_113_523 133
183 3300041512 Ga0451853_1587142 Ga0451853_1587142_714_1121 133
184 3300042001 Ga0439441_034639 Ga0439441_034639_214_624 133
185 3300042125 Ga0450923_079432 Ga0450923_079432_168_569 133
186 3300044694 Ga0466963_0327900 Ga0466963_0327900_361_777 133
187 3300044706 Ga0466964_0118360 Ga0466964_0118360_602_1009 133
188 3300046455 Ga0495603_0084640 Ga0495603_0084640_1388_1795 133
189 3300046460 Ga0495638_0046102 Ga0495638_0046102_1647_2048 133
190 3300046491 Ga0495584_0209339 Ga0495584_0209339_179_586 133
191 3300046492 Ga0495585_0309544 Ga0495585_0309544_36_443 133
192 3300046558 Ga0495633_0295512 Ga0495633_0295512_119_526 133
193 3300047321 Ga0495676_0630751 Ga0495676_0630751_67_474 133
194 3300048903 Ga0496100_1656643 Ga0496100_1656643_63_470 133
195 3300048906 Ga0496103_0944073 Ga0496103_0944073_53_460 133
196 3300048907 Ga0496104_0138715 Ga0496104_0138715_1590_1997 133
197 3300048908 Ga0496105_1047714 Ga0496105_1047714_118_525 133
198 3300048912 Ga0496109_2008246 Ga0496109_2008246_26_433 133
199 3300048918 Ga0496115_1041883 Ga0496115_1041883_179_586 133
200 3300049568 Ga0501031_0011435 Ga0501031_0011435_5229_5642 133
201 3300049569 Ga0501032_0106352 Ga0501032_0106352_549_962 133
202 3300049570 Ga0501033_0165576 Ga0501033_0165576_503_916 133
203 3300049571 Ga0501034_0077142 Ga0501034_0077142_1482_1895 133
204 3300049571 Ga0501034_0495102 Ga0501034_0495102_691_1104 133
205 3300049571 Ga0501034_0553736 Ga0501034_0553736_514_924 133
206 3300049572 Ga0501036_0006085 Ga0501036_0006085_5148_5561 133
207 3300049573 Ga0501037_0017825 Ga0501037_0017825_3918_4331 133
208 3300049573 Ga0501037_0187552 Ga0501037_0187552_104_517 133
209 3300049574 Ga0501038_0018260 Ga0501038_0018260_5680_6093 133
210 3300049574 Ga0501038_0396652 Ga0501038_0396652_359_775 133
211 3300049575 Ga0501039_0085085 Ga0501039_0085085_191_604 133
212 3300049575 Ga0501039_1264365 Ga0501039_1264365_27_437 133
213 3300049578 Ga0501042_0099138 Ga0501042_0099138_955_1368 133
214 3300049579 Ga0501043_0176068 Ga0501043_0176068_325_738 133
215 3300049579 Ga0501043_0774445 Ga0501043_0774445_262_678 133
216 3300049580 Ga0501046_0008583 Ga0501046_0008583_211_624 133
217 3300049580 Ga0501046_0422921 Ga0501046_0422921_405_842 133
218 3300049581 Ga0501047_0164361 Ga0501047_0164361_736_1152 133
219 3300049582 Ga0501048_0017748 Ga0501048_0017748_1484_1897 133
220 3300049583 Ga0501067_0032437 Ga0501067_0032437_607_1020 133
221 3300049583 Ga0501067_0180773 Ga0501067_0180773_225_638 133
222 3300049584 Ga0501068_0060487 Ga0501068_0060487_1727_2140 133
223 3300049584 Ga0501068_0287460 Ga0501068_0287460_188_625 133
224 3300049585 Ga0501069_0000924 Ga0501069_0000924_4647_5060 133
225 3300049585 Ga0501069_0153978 Ga0501069_0153978_832_1269 133
226 3300049586 Ga0501070_0009684 Ga0501070_0009684_5874_6311 133
227 3300049586 Ga0501070_0268886 Ga0501070_0268886_655_1068 133
228 3300049587 Ga0501071_0019503 Ga0501071_0019503_2474_2911 133
229 3300049587 Ga0501071_0021112 Ga0501071_0021112_780_1193 133
230 3300049587 Ga0501071_0962299 Ga0501071_0962299_222_632 133
231 3300049589 Ga0501073_0031134 Ga0501073_0031134_1336_1749 133
232 3300049589 Ga0501073_0318971 Ga0501073_0318971_383_796 133
233 3300049590 Ga0501074_0001513 Ga0501074_0001513_14358_14771 133
234 3300049591 Ga0501075_0526582 Ga0501075_0526582_16_429 133
235 3300049592 Ga0501076_0526823 Ga0501076_0526823_11_424 133
236 3300049741 Ga0501079_0319468 Ga0501079_0319468_643_1056 133
237 3300049742 Ga0501080_0236781 Ga0501080_0236781_325_738 133
238 3300049742 Ga0501080_0246936 Ga0501080_0246936_325_738 133
239 3300049743 Ga0501081_0676699 Ga0501081_0676699_307_729 133
240 3300049744 Ga0501083_0031160 Ga0501083_0031160_359_772 133
241 3300049744 Ga0501083_0293547 Ga0501083_0293547_469_882 133
242 3300049822 Ga0501035_1207867 Ga0501035_1207867_162_575 133
243 3300049823 Ga0501044_0005986 Ga0501044_0005986_355_771 133
244 3300049823 Ga0501044_0158735 Ga0501044_0158735_897_1310 133
245 3300049823 Ga0501044_0334411 Ga0501044_0334411_798_1235 133
246 3300049823 Ga0501044_0533909 Ga0501044_0533909_39_452 133
247 3300049824 Ga0501045_0079158 Ga0501045_0079158_140_553 133
248 3300050490 nmdc:mga03n38_46179_c1 nmdc:mga03n38_46179_c1_284_691 133
249 3300050491 nmdc:mga00v17_106889_c1 nmdc:mga00v17_106889_c1_362_769 133
250 3300050492 nmdc:mga0yw44_114001_c1 nmdc:mga0yw44_114001_c1_914_1321 133
251 3300050494 nmdc:mga06z11_398009_c1 nmdc:mga06z11_398009_c1_347_796 133
252 3300050494 nmdc:mga06z11_588619_c1 nmdc:mga06z11_588619_c1_114_521 133
253 3300050495 nmdc:mga04h51_3760_c1 nmdc:mga04h51_3760_c1_170_577 133
254 3300050496 nmdc:mga07m45_30674_c1 nmdc:mga07m45_30674_c1_2339_2746 133
255 3300050507 nmdc:mga05p37_16927_c1 nmdc:mga05p37_16927_c1_6851_7258 133
256 3300050507 nmdc:mga05p37_4905_c1 nmdc:mga05p37_4905_c1_12401_12808 133
257 3300050508 nmdc:mga09592_152002_c1 nmdc:mga09592_152002_c1_942_1349 133
258 3300050509 nmdc:mga0qj67_1127986_c1 nmdc:mga0qj67_1127986_c1_102_509 133
259 3300050509 nmdc:mga0qj67_397749_c1 nmdc:mga0qj67_397749_c1_103_510 133
260 3300050510 nmdc:mga06r32_15631_c1 nmdc:mga06r32_15631_c1_1041_1448 133
261 3300050510 nmdc:mga06r32_5143_c1 nmdc:mga06r32_5143_c1_6353_6760 133
262 3300050511 nmdc:mga08y16_102773_c1 nmdc:mga08y16_102773_c1_1834_2241 133
263 3300050511 nmdc:mga08y16_46642_c1 nmdc:mga08y16_46642_c1_1046_1450 133
264 3300050512 nmdc:mga0n895_1030154_c1 nmdc:mga0n895_1030154_c1_317_730 133
265 3300050512 nmdc:mga0n895_326961_c1 nmdc:mga0n895_326961_c1_688_1098 133
266 3300050513 nmdc:mga0rr50_48889_c1 nmdc:mga0rr50_48889_c1_485_892 133
267 3300050515 nmdc:mga0a205_357850_c1 nmdc:mga0a205_357850_c1_496_906 133
268 3300050515 nmdc:mga0a205_83553_c1 nmdc:mga0a205_83553_c1_366_773 133
269 3300050516 nmdc:mga0sz30_307625_c1 nmdc:mga0sz30_307625_c1_68_517 133
270 3300050516 nmdc:mga0sz30_7754_c1 nmdc:mga0sz30_7754_c1_1622_2029 133
271 3300053077 Ga0495601_0092393 Ga0495601_0092393_1280_1690 133
272 3300053084 Ga0495595_0173055 Ga0495595_0173055_328_738 133
273 3300053084 Ga0495595_0257895 Ga0495595_0257895_412_828 133
274 3300053087 Ga0500643_010723 Ga0500643_010723_2547_2948 133
275 3300053088 Ga0500644_0000244 Ga0500644_0000244_7743_8144 133
276 3300053090 Ga0500646_0138477 Ga0500646_0138477_203_610 133
277 3300053093 Ga0500651_0029966 Ga0500651_0029966_1006_1407 133
278 3300053094 Ga0500566_0081038 Ga0500566_0081038_157_558 133
279 3300053096 Ga0500641_0011165 Ga0500641_0011165_1445_1858 133
280 3300053098 Ga0500650_0134598 Ga0500650_0134598_698_1099 133
281 3300053098 Ga0500650_0473524 Ga0500650_0473524_124_525 133
282 3300053118 Ga0500594_0090201 Ga0500594_0090201_486_887 133
283 3300053119 Ga0500595_000002 Ga0500595_000002_640500_640901 133
284 3300053133 Ga0500655_021586 Ga0500655_021586_215_616 133
285 3300053140 Ga0500573_0242808 Ga0500573_0242808_138_578 133
286 3300053153 Ga0500616_0000002 Ga0500616_0000002_686813_687214 133
287 3300060353 Ga0501082_0094845 Ga0501082_0094845_1390_1803 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

59

149

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bzg-assembly3.cif.gz_J structure of bacillus subtilis hxlr, wild type in complex with formaldehyde and dna 0.9288 26 122
2fsw-assembly1.cif.gz_A crystal structure of the putative transcriptional regualator, marr family from porphyromonas gingivalis w83 0.9218 26 115
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.918 40 97
5hs9-assembly1.cif.gz_A crystal structure of the quinone-bound yodb from b. subtilis 0.9145 23 116
4a5n-assembly2.cif.gz_D redoxregulator hypr in its reduced form 0.9143 25 123
ID Description Score Start End Superfamily
5hs7B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9208 23 116 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.918 40 97 1.10.10.10
5hs9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9145 23 116 1.10.10.10
5hs9B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9111 23 116 1.10.10.10
3l9fD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9086 39 106 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A368K813-F1-model_v4 Transcriptional regulator 0.9545 26 131 GO:0003677
AF-A0A1K2HUS6-F1-model_v4 Transcriptional regulator, HxlR family 0.9523 26 133 GO:0003677
AF-A0A1V4DNX9-F1-model_v4 Transcriptional regulator 0.9519 26 131 GO:0003677
AF-A0A4P6FMP7-F1-model_v4 Transcriptional regulator 0.9496 20 129 GO:0003677
AF-A0A3N2DBQ9-F1-model_v4 HxlR family transcriptional regulator 0.9492 20 131 GO:0003677

Feature Viewer

pLDDT pTM Quality
85.43 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map