F384481

General Info

Members Datasets Scaffolds Average Seq Length
281 198 562 100

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0476311|Ga0466961_0476311_211_555
Length 114
Sequence MAARLTLSYECGNRRLSLIPIMTRPAIHPGEILGEELAELAVTPSELARQLRVPVNRITQILQGKRAITGDTALRLGHWFGTTAQFWLNLQSAYEIRLAEKTVGAEIKRLPRRA

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
128 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
129 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
130 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
191 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
192 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
193 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
194 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 1.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.9
Nodule 0
Rhizoplane 6.76
Rhizosphere 79.72
Stem 0
Stem Tuber 0
Unclassified 19.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0476311 3300044693 Unclassified 755
2 JGI25406J46586_10005617 3300003203 Bacteria 5805
3 Ga0070683_101680220 3300005329 Bacteria 611
4 Ga0070690_100607210 3300005330 Bacteria 831
5 Ga0070690_100812432 3300005330 Bacteria 726
6 Ga0070670_101777538 3300005331 Bacteria 567
7 Ga0068869_101470187 3300005334 Bacteria 604
8 Ga0070666_10482822 3300005335 Bacteria 897
9 Ga0068868_100465422 3300005338 Bacteria 1102
10 Ga0070689_100635691 3300005340 Unclassified 927
11 Ga0070668_101726308 3300005347 Bacteria 575
12 Ga0070669_101508082 3300005353 Bacteria 584
13 Ga0070671_100043880 3300005355 Bacteria 3716
14 Ga0070674_100767017 3300005356 Bacteria 830
15 Ga0070673_101916764 3300005364 Unclassified 562
16 Ga0070673_102071777 3300005364 Unclassified 540
17 Ga0070701_10657125 3300005438 Bacteria 700
18 Ga0070705_100500204 3300005440 Bacteria 922
19 Ga0070678_100062349 3300005456 Bacteria 2753
20 Ga0070685_11214180 3300005466 Bacteria 573
21 Ga0070707_100055159 3300005468 Unclassified 3810
22 Ga0070707_100239340 3300005468 Bacteria 1767
23 Ga0070707_100907260 3300005468 Unclassified 846
24 Ga0070699_100007272 3300005518 Bacteria 9637
25 Ga0070699_100402517 3300005518 Bacteria 1238
26 Ga0070697_100216535 3300005536 Bacteria 1631
27 Ga0068853_101240419 3300005539 Bacteria 720
28 Ga0070672_100532982 3300005543 Bacteria 1018
29 Ga0070686_100942005 3300005544 Bacteria 705
30 Ga0070665_100324207 3300005548 Bacteria 1544
31 Ga0070704_100437741 3300005549 Bacteria 1123
32 Ga0068855_101333132 3300005563 Bacteria 742
33 Ga0068855_101922390 3300005563 Bacteria 599
34 Ga0068854_100388380 3300005578 Bacteria 1152
35 Ga0068864_102422113 3300005618 Bacteria 531
36 Ga0068866_10576040 3300005718 Bacteria 756
37 Ga0068863_100159620 3300005841 Bacteria 2160
38 Ga0068860_101419798 3300005843 Bacteria 715
39 Ga0081455_10001165 3300005937 Bacteria 32867
40 Ga0081539_10000848 3300005985 Bacteria 58499
41 Ga0081539_10132337 3300005985 Unclassified 1223
42 Ga0081539_10337344 3300005985 Bacteria 637
43 Ga0075365_10084233 3300006038 Bacteria 2157
44 Ga0075365_10486769 3300006038 Bacteria 872
45 Ga0070716_100020310 3300006173 Bacteria 3486
46 Ga0070716_100830290 3300006173 Bacteria 718
47 Ga0075362_10099663 3300006177 Bacteria 1357
48 Ga0075367_10095205 3300006178 Bacteria 1816
49 Ga0075367_10276329 3300006178 Bacteria 1055
50 Ga0075369_10083011 3300006186 Bacteria 1423
51 Ga0075366_10029851 3300006195 Bacteria 3204
52 Ga0075366_10086551 3300006195 Bacteria 1875
53 Ga0075366_10511718 3300006195 Bacteria 742
54 Ga0075370_10239964 3300006353 Bacteria 1073
55 Ga0075428_100199525 3300006844 Bacteria 2163
56 Ga0075428_100307356 3300006844 Bacteria 1704
57 Ga0075428_101212001 3300006844 Bacteria 795
58 Ga0075428_102758319 3300006844 Bacteria 500
59 Ga0075430_100111567 3300006846 Bacteria 2280
60 Ga0075430_100205089 3300006846 Bacteria 1636
61 Ga0075431_100059349 3300006847 Bacteria 3948
62 Ga0075431_100121895 3300006847 Bacteria 2690
63 Ga0075431_100273742 3300006847 Bacteria 1710
64 Ga0075431_101457235 3300006847 Unclassified 643
65 Ga0075433_11973449 3300006852 Unclassified 500
66 Ga0075434_100167925 3300006871 Unclassified 2214
67 Ga0075434_101510969 3300006871 Unclassified 681
68 Ga0075434_102489618 3300006871 Bacteria 519
69 Ga0075434_102655912 3300006871 Unclassified 501
70 Ga0075429_100082226 3300006880 Bacteria 2807
71 Ga0075429_100244799 3300006880 Bacteria 1570
72 Ga0099794_10073541 3300007265 Bacteria 1677
73 Ga0099794_10452860 3300007265 Bacteria 673
74 Ga0099795_10050180 3300007788 Bacteria 1516
75 Ga0105240_10374623 3300009093 Bacteria 1609
76 Ga0111539_10226838 3300009094 Bacteria 2176
77 Ga0111539_12556402 3300009094 Bacteria 592
78 Ga0111539_13507864 3300009094 Unclassified 503
79 Ga0105245_10099438 3300009098 Bacteria 2689
80 Ga0105245_11015208 3300009098 Bacteria 874
81 Ga0114129_10821224 3300009147 Bacteria 1184
82 Ga0114129_11045522 3300009147 Bacteria 1025
83 Ga0114129_11123404 3300009147 Bacteria 983
84 Ga0114129_11558247 3300009147 Bacteria 810
85 Ga0114129_11706452 3300009147 Bacteria 768
86 Ga0105243_11026351 3300009148 Bacteria 829
87 Ga0105241_11980394 3300009174 Unclassified 573
88 Ga0105248_11855556 3300009177 Bacteria 684
89 Ga0105238_10932255 3300009551 Bacteria 887
90 Ga0105249_11184754 3300009553 Bacteria 835
91 Ga0105035_126219 3300009988 Unclassified 563
92 Ga0099796_10122019 3300010159 Bacteria 1002
93 Ga0099796_10518954 3300010159 Bacteria 534
94 Ga0105246_10111008 3300011119 Bacteria 2014
95 Ga0105246_10498992 3300011119 Bacteria 1033
96 Ga0157320_1033981 3300012481 Bacteria 527
97 Ga0157370_10749503 3300013104 Bacteria 890
98 Ga0157374_10160926 3300013296 Bacteria 2187
99 Ga0157374_10729804 3300013296 Bacteria 1005
100 Ga0157378_10207253 3300013297 Bacteria 1857
101 Ga0157378_10556740 3300013297 Bacteria 1153
102 Ga0157378_10615614 3300013297 Bacteria 1098
103 Ga0163162_12660963 3300013306 Bacteria 576
104 Ga0157375_10075977 3300013308 Bacteria 3385
105 Ga0157375_11510888 3300013308 Bacteria 793
106 Ga0163163_12505029 3300014325 Bacteria 574
107 Ga0157379_10493920 3300014968 Bacteria 1134
108 Ga0157379_11994803 3300014968 Unclassified 573
109 Ga0163161_11238794 3300017792 Unclassified 646
110 Ga0213872_10456859 3300021361 Unclassified 513
111 Ga0213874_10014479 3300021377 Bacteria 2063
112 Ga0213874_10023552 3300021377 Bacteria 1719
113 Ga0213876_10001376 3300021384 Bacteria 15206
114 Ga0213875_10287670 3300021388 Bacteria 776
115 Ga0213871_10063827 3300021441 Bacteria 1030
116 Ga0213871_10321950 3300021441 Bacteria 502
117 Ga0207684_10498978 3300025910 Bacteria 1043
118 Ga0207684_10740297 3300025910 Bacteria 834
119 Ga0207646_10059419 3300025922 Unclassified 3415
120 Ga0207646_10465758 3300025922 Bacteria 1140
121 Ga0207646_10655535 3300025922 Bacteria 940
122 Ga0207681_11411911 3300025923 Bacteria 584
123 Ga0207694_11259218 3300025924 Unclassified 626
124 Ga0207650_11575829 3300025925 Bacteria 558
125 Ga0207687_11244555 3300025927 Unclassified 640
126 Ga0207644_10021643 3300025931 Bacteria 4385
127 Ga0207670_11710154 3300025936 Unclassified 535
128 Ga0207704_10316667 3300025938 Bacteria 1202
129 Ga0207665_11078203 3300025939 Bacteria 640
130 Ga0207665_11440001 3300025939 Unclassified 548
131 Ga0207691_11487750 3300025940 Bacteria 554
132 Ga0207667_10480573 3300025949 Bacteria 1261
133 Ga0207667_10963550 3300025949 Bacteria 842
134 Ga0207651_10758644 3300025960 Bacteria 858
135 Ga0207668_10972688 3300025972 Bacteria 758
136 Ga0207640_11000587 3300025981 Bacteria 735
137 Ga0207677_11070785 3300026023 Bacteria 734
138 Ga0207677_11458341 3300026023 Unclassified 631
139 Ga0207703_10582812 3300026035 Bacteria 1057
140 Ga0207641_10252760 3300026088 Bacteria 1647
141 Ga0207676_12319717 3300026095 Unclassified 534
142 Ga0207683_10120872 3300026121 Bacteria 2351
143 Ga0209588_1105965 3300027671 Bacteria 904
144 Ga0268266_10335283 3300028379 Unclassified 1418
145 Ga0265338_10015152 3300028800 Bacteria 8504
146 Ga0265770_1070524 3300030878 Bacteria 666
147 Ga0265760_10006217 3300031090 Bacteria 3415
148 Ga0265760_10117875 3300031090 Unclassified 850
149 Ga0265325_10003354 3300031241 Bacteria 10512
150 Ga0265325_10071870 3300031241 Bacteria 1735
151 Ga0265340_10046600 3300031247 Bacteria 2114
152 Ga0265340_10062930 3300031247 Bacteria 1771
153 Ga0265339_10000051 3300031249 Bacteria 101716
154 Ga0265339_10591819 3300031249 Bacteria 509
155 Ga0265316_10326272 3300031344 Bacteria 1114
156 Ga0265316_10833332 3300031344 Unclassified 646
157 Ga0307513_10036151 3300031456 Bacteria 5516
158 Ga0265313_10000011 3300031595 Bacteria 166182
159 Ga0265342_10056534 3300031712 Bacteria 2325
160 Ga0265342_10434106 3300031712 Bacteria 675
161 Ga0307415_101134196 3300032126 Unclassified 734
162 Ga0373956_0466899 3300035119 Bacteria 602
163 Ga0373927_0960964 3300035695 Bacteria 564
164 Ga0373933_0030039 3300035724 Bacteria 3145
165 Ga0373947_0840702 3300035725 Bacteria 627
166 Ga0373937_0008137 3300036401 Bacteria 9104
167 Ga0373937_0309310 3300036401 Bacteria 1494
168 Ga0373937_0558733 3300036401 Bacteria 1087
169 Ga0373925_0611337 3300037068 Bacteria 898
170 Ga0395899_0004462 3300037312 Bacteria 10913
171 Ga0395900_0034782 3300037418 Bacteria 5189
172 Ga0395898_0003503 3300037466 Bacteria 17513
173 Ga0395905_0515426 3300037471 Bacteria 1096
174 Ga0436364_0924976 3300037853 Bacteria 671
175 Ga0436364_1388677 3300037853 Unclassified 2308
176 Ga0395901_0002092 3300038443 Bacteria 20487
177 Ga0436365_0625212 3300039437 Bacteria 996
178 Ga0436365_0929096 3300039437 Bacteria 27643
179 Ga0436365_1158351 3300039437 Unclassified 771
180 Ga0436360_0182810 3300039438 Bacteria 2288
181 Ga0436360_0251093 3300039438 Bacteria 513
182 Ga0436360_1115109 3300039438 Bacteria 17128
183 Ga0436361_0106812 3300039447 Unclassified 2365
184 Ga0436361_0568894 3300039447 Bacteria 1103
185 Ga0436361_0756142 3300039447 Bacteria 2954
186 Ga0436363_0281916 3300039450 Unclassified 583
187 Ga0436363_1223973 3300039450 Bacteria 25443
188 Ga0436362_0483523 3300039453 Bacteria 1089
189 Ga0451807_1952443 3300041486 Bacteria 541
190 Ga0451849_0665973 3300041505 Bacteria 732
191 Ga0439441_011289 3300042001 Bacteria 1513
192 Ga0439454_115446 3300042011 Bacteria 516
193 Ga0466969_0225065 3300044656 Unclassified 853
194 Ga0466966_0104302 3300044684 Bacteria 1751
195 Ga0466963_0115782 3300044694 Bacteria 1842
196 Ga0466971_0175381 3300044719 Unclassified 1007
197 Ga0466957_0014995 3300044842 Bacteria 4522
198 Ga0466959_0079163 3300045049 Bacteria 2370
199 Ga0466967_1383291 3300045976 Unclassified 701
200 Ga0495638_0148223 3300046460 Bacteria 1363
201 Ga0495608_0433253 3300046511 Unclassified 801
202 Ga0495628_0118758 3300046516 Bacteria 2030
203 Ga0495630_0659820 3300046517 Bacteria 801
204 Ga0495667_0349467 3300046559 Unclassified 934
205 Ga0495581_0598422 3300047315 Bacteria 639
206 Ga0495674_0906494 3300047319 Bacteria 680
207 Ga0495672_0038042 3300047320 Bacteria 2938
208 Ga0495686_0202734 3300047472 Bacteria 1138
209 Ga0496102_0230809 3300048905 Bacteria 1745
210 Ga0496104_0105313 3300048907 Unclassified 2703
211 Ga0496105_0063383 3300048908 Unclassified 3050
212 Ga0496106_0768474 3300048909 Bacteria 765
213 Ga0496107_1053520 3300048910 Bacteria 589
214 Ga0496108_0571191 3300048911 Bacteria 986
215 Ga0496109_0106301 3300048912 Bacteria 2607
216 Ga0496109_0913393 3300048912 Unclassified 816
217 Ga0496109_1375978 3300048912 Bacteria 641
218 Ga0496110_0193555 3300048913 Bacteria 1846
219 Ga0496110_0305947 3300048913 Unclassified 1448
220 Ga0496110_1417787 3300048913 Unclassified 604
221 Ga0496111_1255178 3300048914 Unclassified 523
222 Ga0496112_1003803 3300048915 Bacteria 754
223 Ga0496113_0228962 3300048916 Bacteria 1482
224 Ga0496113_0452931 3300048916 Bacteria 1031
225 Ga0496113_1489018 3300048916 Unclassified 523
226 Ga0496115_0185070 3300048918 Unclassified 1721
227 Ga0501037_0256929 3300049573 Bacteria 1221
228 Ga0501038_0538898 3300049574 Bacteria 889
229 Ga0501039_0145334 3300049575 Bacteria 1864
230 Ga0501039_0602882 3300049575 Bacteria 861
231 Ga0501040_0422024 3300049576 Bacteria 959
232 Ga0501040_0941951 3300049576 Unclassified 626
233 Ga0501041_0077648 3300049577 Bacteria 2043
234 Ga0501043_1125361 3300049579 Bacteria 554
235 Ga0501068_0470220 3300049584 Unclassified 814
236 Ga0501071_0126240 3300049587 Bacteria 1899
237 Ga0501071_0410963 3300049587 Bacteria 1034
238 Ga0501075_0073198 3300049591 Bacteria 2591
239 Ga0501077_0033238 3300049593 Bacteria 3283
240 Ga0501079_1566792 3300049741 Bacteria 518
241 Ga0501081_0843027 3300049743 Unclassified 690
242 Ga0501083_1017994 3300049744 Unclassified 539
243 Ga0501035_0212874 3300049822 Bacteria 1653
244 Ga0501044_0103475 3300049823 Bacteria 2862
245 nmdc:mga0yw44_18685_c1 3300050492 Bacteria 3803
246 nmdc:mga0k408_14160_c1 3300050493 Bacteria 4389
247 nmdc:mga0k408_635329_c1 3300050493 Bacteria 628
248 nmdc:mga06z11_28386_c1 3300050494 Bacteria 2684
249 nmdc:mga07m45_193646_c1 3300050496 Unclassified 1182
250 nmdc:mga05p37_1362068_c1 3300050507 Bacteria 718
251 nmdc:mga05p37_1385980_c1 3300050507 Bacteria 709
252 nmdc:mga05p37_660119_c1 3300050507 Bacteria 1169
253 nmdc:mga09592_61254_c1 3300050508 Bacteria 3183
254 nmdc:mga09592_62281_c1 3300050508 Bacteria 3156
255 nmdc:mga0qj67_52984_c1 3300050509 Bacteria 3212
256 nmdc:mga0qj67_87274_c1 3300050509 Bacteria 2504
257 nmdc:mga06r32_18642_c1 3300050510 Bacteria 6357
258 nmdc:mga06r32_21981_c1 3300050510 Bacteria 5891
259 nmdc:mga06r32_23093_c1 3300050510 Bacteria 5755
260 nmdc:mga06r32_394751_c1 3300050510 Unclassified 1366
261 nmdc:mga08y16_194243_c1 3300050511 Bacteria 2104
262 nmdc:mga0n895_1302632_c1 3300050512 Unclassified 697
263 nmdc:mga0n895_182782_c1 3300050512 Bacteria 2128
264 nmdc:mga0n895_837651_c1 3300050512 Bacteria 908
265 nmdc:mga0rr50_98956_c1 3300050513 Unclassified 2287
266 nmdc:mga0a205_1239701_c1 3300050515 Unclassified 593
267 nmdc:mga0sz30_40573_c1 3300050516 Bacteria 1956
268 Ga0495601_0040407 3300053077 Bacteria 2921
269 Ga0495595_0734233 3300053084 Bacteria 506
270 Ga0500644_0053051 3300053088 Bacteria 1398
271 Ga0500651_0000030 3300053093 Bacteria 112247
272 Ga0500566_0485633 3300053094 Unclassified 534
273 Ga0500557_202674 3300053105 Bacteria 637
274 Ga0500595_003051 3300053119 Bacteria 7958
275 Ga0500658_0000976 3300053134 Bacteria 11666
276 Ga0500561_0175916 3300053137 Bacteria 673
277 Ga0500568_0023330 3300053139 Bacteria 2632
278 Ga0500645_060834 3300053730 Bacteria 1092
279 Ga0501084_0083970 3300054114 Bacteria 2674
280 Ga0530510_0010314 3300061734 Bacteria 6548
281 Ga0530510_1123931 3300061734 Bacteria 602
282 Ga0466961_0476311
283 JGI25406J46586_10005617
284 Ga0070683_101680220
285 Ga0070690_100607210
286 Ga0070690_100812432
287 Ga0070670_101777538
288 Ga0068869_101470187
289 Ga0070666_10482822
290 Ga0068868_100465422
291 Ga0070689_100635691
292 Ga0070668_101726308
293 Ga0070669_101508082
294 Ga0070671_100043880
295 Ga0070674_100767017
296 Ga0070673_101916764
297 Ga0070673_102071777
298 Ga0070701_10657125
299 Ga0070705_100500204
300 Ga0070678_100062349
301 Ga0070685_11214180
302 Ga0070707_100055159
303 Ga0070707_100239340
304 Ga0070707_100907260
305 Ga0070699_100007272
306 Ga0070699_100402517
307 Ga0070697_100216535
308 Ga0068853_101240419
309 Ga0070672_100532982
310 Ga0070686_100942005
311 Ga0070665_100324207
312 Ga0070704_100437741
313 Ga0068855_101333132
314 Ga0068855_101922390
315 Ga0068854_100388380
316 Ga0068864_102422113
317 Ga0068866_10576040
318 Ga0068863_100159620
319 Ga0068860_101419798
320 Ga0081455_10001165
321 Ga0081539_10000848
322 Ga0081539_10132337
323 Ga0081539_10337344
324 Ga0075365_10084233
325 Ga0075365_10486769
326 Ga0070716_100020310
327 Ga0070716_100830290
328 Ga0075362_10099663
329 Ga0075367_10095205
330 Ga0075367_10276329
331 Ga0075369_10083011
332 Ga0075366_10029851
333 Ga0075366_10086551
334 Ga0075366_10511718
335 Ga0075370_10239964
336 Ga0075428_100199525
337 Ga0075428_100307356
338 Ga0075428_101212001
339 Ga0075428_102758319
340 Ga0075430_100111567
341 Ga0075430_100205089
342 Ga0075431_100059349
343 Ga0075431_100121895
344 Ga0075431_100273742
345 Ga0075431_101457235
346 Ga0075433_11973449
347 Ga0075434_100167925
348 Ga0075434_101510969
349 Ga0075434_102489618
350 Ga0075434_102655912
351 Ga0075429_100082226
352 Ga0075429_100244799
353 Ga0099794_10073541
354 Ga0099794_10452860
355 Ga0099795_10050180
356 Ga0105240_10374623
357 Ga0111539_10226838
358 Ga0111539_12556402
359 Ga0111539_13507864
360 Ga0105245_10099438
361 Ga0105245_11015208
362 Ga0114129_10821224
363 Ga0114129_11045522
364 Ga0114129_11123404
365 Ga0114129_11558247
366 Ga0114129_11706452
367 Ga0105243_11026351
368 Ga0105241_11980394
369 Ga0105248_11855556
370 Ga0105238_10932255
371 Ga0105249_11184754
372 Ga0105035_126219
373 Ga0099796_10122019
374 Ga0099796_10518954
375 Ga0105246_10111008
376 Ga0105246_10498992
377 Ga0157320_1033981
378 Ga0157370_10749503
379 Ga0157374_10160926
380 Ga0157374_10729804
381 Ga0157378_10207253
382 Ga0157378_10556740
383 Ga0157378_10615614
384 Ga0163162_12660963
385 Ga0157375_10075977
386 Ga0157375_11510888
387 Ga0163163_12505029
388 Ga0157379_10493920
389 Ga0157379_11994803
390 Ga0163161_11238794
391 Ga0213872_10456859
392 Ga0213874_10014479
393 Ga0213874_10023552
394 Ga0213876_10001376
395 Ga0213875_10287670
396 Ga0213871_10063827
397 Ga0213871_10321950
398 Ga0207684_10498978
399 Ga0207684_10740297
400 Ga0207646_10059419
401 Ga0207646_10465758
402 Ga0207646_10655535
403 Ga0207681_11411911
404 Ga0207694_11259218
405 Ga0207650_11575829
406 Ga0207687_11244555
407 Ga0207644_10021643
408 Ga0207670_11710154
409 Ga0207704_10316667
410 Ga0207665_11078203
411 Ga0207665_11440001
412 Ga0207691_11487750
413 Ga0207667_10480573
414 Ga0207667_10963550
415 Ga0207651_10758644
416 Ga0207668_10972688
417 Ga0207640_11000587
418 Ga0207677_11070785
419 Ga0207677_11458341
420 Ga0207703_10582812
421 Ga0207641_10252760
422 Ga0207676_12319717
423 Ga0207683_10120872
424 Ga0209588_1105965
425 Ga0268266_10335283
426 Ga0265338_10015152
427 Ga0265770_1070524
428 Ga0265760_10006217
429 Ga0265760_10117875
430 Ga0265325_10003354
431 Ga0265325_10071870
432 Ga0265340_10046600
433 Ga0265340_10062930
434 Ga0265339_10000051
435 Ga0265339_10591819
436 Ga0265316_10326272
437 Ga0265316_10833332
438 Ga0307513_10036151
439 Ga0265313_10000011
440 Ga0265342_10056534
441 Ga0265342_10434106
442 Ga0307415_101134196
443 Ga0373956_0466899
444 Ga0373927_0960964
445 Ga0373933_0030039
446 Ga0373947_0840702
447 Ga0373937_0008137
448 Ga0373937_0309310
449 Ga0373937_0558733
450 Ga0373925_0611337
451 Ga0395899_0004462
452 Ga0395900_0034782
453 Ga0395898_0003503
454 Ga0395905_0515426
455 Ga0436364_0924976
456 Ga0436364_1388677
457 Ga0395901_0002092
458 Ga0436365_0625212
459 Ga0436365_0929096
460 Ga0436365_1158351
461 Ga0436360_0182810
462 Ga0436360_0251093
463 Ga0436360_1115109
464 Ga0436361_0106812
465 Ga0436361_0568894
466 Ga0436361_0756142
467 Ga0436363_0281916
468 Ga0436363_1223973
469 Ga0436362_0483523
470 Ga0451807_1952443
471 Ga0451849_0665973
472 Ga0439441_011289
473 Ga0439454_115446
474 Ga0466969_0225065
475 Ga0466966_0104302
476 Ga0466963_0115782
477 Ga0466971_0175381
478 Ga0466957_0014995
479 Ga0466959_0079163
480 Ga0466967_1383291
481 Ga0495638_0148223
482 Ga0495608_0433253
483 Ga0495628_0118758
484 Ga0495630_0659820
485 Ga0495667_0349467
486 Ga0495581_0598422
487 Ga0495674_0906494
488 Ga0495672_0038042
489 Ga0495686_0202734
490 Ga0496102_0230809
491 Ga0496104_0105313
492 Ga0496105_0063383
493 Ga0496106_0768474
494 Ga0496107_1053520
495 Ga0496108_0571191
496 Ga0496109_0106301
497 Ga0496109_0913393
498 Ga0496109_1375978
499 Ga0496110_0193555
500 Ga0496110_0305947
501 Ga0496110_1417787
502 Ga0496111_1255178
503 Ga0496112_1003803
504 Ga0496113_0228962
505 Ga0496113_0452931
506 Ga0496113_1489018
507 Ga0496115_0185070
508 Ga0501037_0256929
509 Ga0501038_0538898
510 Ga0501039_0145334
511 Ga0501039_0602882
512 Ga0501040_0422024
513 Ga0501040_0941951
514 Ga0501041_0077648
515 Ga0501043_1125361
516 Ga0501068_0470220
517 Ga0501071_0126240
518 Ga0501071_0410963
519 Ga0501075_0073198
520 Ga0501077_0033238
521 Ga0501079_1566792
522 Ga0501081_0843027
523 Ga0501083_1017994
524 Ga0501035_0212874
525 Ga0501044_0103475
526 nmdc:mga0yw44_18685_c1
527 nmdc:mga0k408_14160_c1
528 nmdc:mga0k408_635329_c1
529 nmdc:mga06z11_28386_c1
530 nmdc:mga07m45_193646_c1
531 nmdc:mga05p37_1362068_c1
532 nmdc:mga05p37_1385980_c1
533 nmdc:mga05p37_660119_c1
534 nmdc:mga09592_61254_c1
535 nmdc:mga09592_62281_c1
536 nmdc:mga0qj67_52984_c1
537 nmdc:mga0qj67_87274_c1
538 nmdc:mga06r32_18642_c1
539 nmdc:mga06r32_21981_c1
540 nmdc:mga06r32_23093_c1
541 nmdc:mga06r32_394751_c1
542 nmdc:mga08y16_194243_c1
543 nmdc:mga0n895_1302632_c1
544 nmdc:mga0n895_182782_c1
545 nmdc:mga0n895_837651_c1
546 nmdc:mga0rr50_98956_c1
547 nmdc:mga0a205_1239701_c1
548 nmdc:mga0sz30_40573_c1
549 Ga0495601_0040407
550 Ga0495595_0734233
551 Ga0500644_0053051
552 Ga0500651_0000030
553 Ga0500566_0485633
554 Ga0500557_202674
555 Ga0500595_003051
556 Ga0500658_0000976
557 Ga0500561_0175916
558 Ga0500568_0023330
559 Ga0500645_060834
560 Ga0501084_0083970
561 Ga0530510_0010314
562 Ga0530510_1123931

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3trb-assembly1.cif.gz_A structure of an addiction module antidote protein of a higa (higa) family from coxiella burnetii 0.965 5 91
6lb3-assembly2.cif.gz_B crystal structure of pa4674 in complex with its operator dna (18bp) from pseudomonas aeruginosa 0.9571 6 91
6lb3-assembly2.cif.gz_H crystal structure of pa4674 in complex with its operator dna (18bp) from pseudomonas aeruginosa 0.9566 6 91
6jpi-assembly1.cif.gz_C crystal structure of pa4674 in complex with its operator dna (28bp) from pseudomonas aeruginosa 0.9532 5 91
6cf1-assembly1.cif.gz_B proteus vulgaris higa antitoxin structure 0.9527 6 81
ID Description Score Start End Superfamily
2ebyA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9637 6 80 1.10.260.40
3trbA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9584 5 91 1.10.260.40
6chvA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9547 6 80 1.10.260.40
4mcxE01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9409 1 76 1.10.260.40
2icpA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9335 8 80 1.10.260.40
ID Description Score Start End GO Terms
AF-T1ACZ3-F1-model_v4 Addiction module antidote protein, HigA 0.9959 12 91 GO:0003677
AF-A0A2J7VSB4-F1-model_v4 Antitoxin HigA 0.9946 1 91 GO:0003677
AF-A0A1V4CHT3-F1-model_v4 Addiction module antidote protein, HigA family 0.9939 1 92 GO:0003677
AF-A0A7W0XKK6-F1-model_v4 HigA family addiction module antidote protein 0.9934 5 92 GO:0003677
AF-A0A3R9PZW5-F1-model_v4 deleted 0.9893 1 94

Map