F383234

General Info

Members Datasets Scaffolds Average Seq Length
279 171 558 139

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0603766|Ga0451576_0603766_88_588
Length 166
Sequence VSERCRPASGLFKKPNRTIKKYQPTKGDVIMAIEPYLFFNGRCEEAIEFYKKALGAEVLMLMRYKEIPEPTPPGMVPPGWENKIMHATLRIGNANVMASDGCSEGTNFQGFSLSLTAANETDANRKFAALAEGGQVQMPLGKTFWSPCFGMVADRFGVGWMVTVAP

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
50 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
98 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
126 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
171 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.77
Metatranscriptomes 2.87
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 0.36
Rhizosphere 97.85
Stem 0
Stem Tuber 0
Unclassified 6.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0603766 3300045051 Bacteria 1153
2 Ga0006778J45830_1074608 3300003162 Bacteria 867
3 JGI25405J52794_10007129 3300003911 Bacteria 2056
4 JGI25405J52794_10018062 3300003911 Bacteria 1406
5 JGI25405J52794_10030026 3300003911 Bacteria 1126
6 Ga0065716_1011276 3300005277 Unclassified 630
7 Ga0065707_10617498 3300005295 Bacteria 681
8 Ga0070658_10061801 3300005327 Bacteria 3052
9 Ga0070680_100736063 3300005336 Bacteria 849
10 Ga0070689_100604926 3300005340 Bacteria 950
11 Ga0070668_100610020 3300005347 Bacteria 955
12 Ga0070669_100399076 3300005353 Bacteria 1125
13 Ga0070669_100906355 3300005353 Unclassified 753
14 Ga0070675_100630916 3300005354 Unclassified 973
15 Ga0070694_100177581 3300005444 Bacteria 1573
16 Ga0070699_101942889 3300005518 Bacteria 538
17 Ga0070679_100551223 3300005530 Bacteria 1097
18 Ga0070697_100210771 3300005536 Unclassified 1654
19 Ga0070686_100703614 3300005544 Bacteria 806
20 Ga0070695_101232629 3300005545 Bacteria 616
21 Ga0070696_101801874 3300005546 Bacteria 529
22 Ga0068855_100627776 3300005563 Bacteria 1156
23 Ga0068859_100271769 3300005617 Bacteria 1787
24 Ga0068864_100569985 3300005618 Bacteria 1096
25 Ga0068861_100446517 3300005719 Bacteria 1158
26 Ga0068870_10295021 3300005840 Bacteria 1021
27 Ga0068863_100569295 3300005841 Bacteria 1120
28 Ga0068858_100096072 3300005842 Bacteria 2761
29 Ga0068858_100129415 3300005842 Bacteria 2366
30 Ga0068860_100989072 3300005843 Bacteria 859
31 Ga0081455_10014057 3300005937 Bacteria 7868
32 Ga0081455_10046938 3300005937 Bacteria 3744
33 Ga0081455_10626572 3300005937 Unclassified 697
34 Ga0081538_10006404 3300005981 Bacteria 10375
35 Ga0081538_10052833 3300005981 Bacteria 2423
36 Ga0081538_10271636 3300005981 Bacteria 634
37 Ga0081540_1011001 3300005983 Bacteria 6075
38 Ga0081540_1136646 3300005983 Bacteria 991
39 Ga0075432_10546511 3300006058 Bacteria 523
40 Ga0075427_10036551 3300006194 Bacteria 819
41 Ga0075370_10001451 3300006353 Bacteria 10301
42 Ga0075428_100002056 3300006844 Bacteria 21702
43 Ga0075428_100091365 3300006844 Bacteria 3320
44 Ga0075428_100112508 3300006844 Bacteria 2965
45 Ga0075428_100130107 3300006844 Bacteria 2738
46 Ga0075428_100199183 3300006844 Bacteria 2165
47 Ga0075428_100804244 3300006844 Bacteria 999
48 Ga0075430_100001066 3300006846 Bacteria 21739
49 Ga0075430_100277980 3300006846 Bacteria 1385
50 Ga0075430_100292938 3300006846 Bacteria 1346
51 Ga0075431_100002077 3300006847 Bacteria 19121
52 Ga0075431_100008357 3300006847 Bacteria 10354
53 Ga0075431_100137020 3300006847 Bacteria 2524
54 Ga0075431_100144785 3300006847 Bacteria 2449
55 Ga0075431_100160290 3300006847 Bacteria 2313
56 Ga0075431_100441636 3300006847 Bacteria 1298
57 Ga0075431_100486889 3300006847 Bacteria 1226
58 Ga0075431_100776435 3300006847 Bacteria 932
59 Ga0075433_10599810 3300006852 Bacteria 967
60 Ga0075434_100028217 3300006871 Bacteria 5514
61 Ga0075434_100694986 3300006871 Bacteria 1035
62 Ga0075434_101637860 3300006871 Bacteria 652
63 Ga0075429_100012253 3300006880 Bacteria 7437
64 Ga0075429_100026476 3300006880 Bacteria 5036
65 Ga0075429_100285364 3300006880 Bacteria 1445
66 Ga0075429_100402401 3300006880 Bacteria 1199
67 Ga0075429_100525922 3300006880 Bacteria 1036
68 Ga0075436_100029439 3300006914 Bacteria 3777
69 Ga0097620_100271776 3300006931 Bacteria 1787
70 Ga0075435_100154009 3300007076 Bacteria 1934
71 Ga0075435_100803528 3300007076 Bacteria 819
72 Ga0099794_10065100 3300007265 Bacteria 1777
73 Ga0111539_10001638 3300009094 Bacteria 29905
74 Ga0111539_10174584 3300009094 Bacteria 2510
75 Ga0111539_10274855 3300009094 Bacteria 1960
76 Ga0114129_10005978 3300009147 Bacteria 17237
77 Ga0114129_10038687 3300009147 Bacteria 6727
78 Ga0114129_10065725 3300009147 Bacteria 5061
79 Ga0114129_10340562 3300009147 Bacteria 1989
80 Ga0114129_10719027 3300009147 Bacteria 1282
81 Ga0105242_10995014 3300009176 Unclassified 846
82 Ga0105249_10081725 3300009553 Bacteria 3004
83 Ga0105249_10096771 3300009553 Bacteria 2770
84 Ga0105249_10271106 3300009553 Bacteria 1691
85 Ga0105239_11170063 3300010375 Bacteria 886
86 Ga0105246_10642285 3300011119 Bacteria 923
87 Ga0157322_1027395 3300012490 Unclassified 588
88 Ga0157338_1033813 3300012515 Bacteria 665
89 Ga0157370_10756082 3300013104 Bacteria 885
90 Ga0157374_11053210 3300013296 Bacteria 833
91 Ga0157378_10078468 3300013297 Bacteria 2979
92 Ga0157378_11668238 3300013297 Bacteria 684
93 Ga0163162_10087947 3300013306 Bacteria 3186
94 Ga0163162_10248988 3300013306 Bacteria 1909
95 Ga0157375_10149950 3300013308 Bacteria 2466
96 Ga0163163_10032929 3300014325 Bacteria 5009
97 Ga0157379_10020188 3300014968 Bacteria 5889
98 Ga0157379_10041876 3300014968 Bacteria 4088
99 Ga0157379_10370374 3300014968 Bacteria 1313
100 Ga0163161_10918432 3300017792 Bacteria 743
101 Ga0197907_10479829 3300020069 Bacteria 696
102 Ga0206349_1005970 3300020075 Bacteria 597
103 Ga0206350_10218696 3300020080 Bacteria 686
104 Ga0206354_10585572 3300020081 Bacteria 599
105 Ga0213873_10000981 3300021358 Bacteria 4633
106 Ga0213872_10024202 3300021361 Bacteria 2792
107 Ga0224712_10118290 3300022467 Bacteria 1144
108 Ga0207705_10214897 3300025909 Unclassified 1459
109 Ga0207654_11043014 3300025911 Unclassified 595
110 Ga0207652_10427437 3300025921 Bacteria 1194
111 Ga0207644_10879349 3300025931 Bacteria 751
112 Ga0207686_10224749 3300025934 Bacteria 1358
113 Ga0207689_10040160 3300025942 Unclassified 3874
114 Ga0207667_10252381 3300025949 Bacteria 1805
115 Ga0207712_10199724 3300025961 Bacteria 1585
116 Ga0207712_10208441 3300025961 Bacteria 1555
117 Ga0207712_10610107 3300025961 Bacteria 945
118 Ga0207668_10475357 3300025972 Bacteria 1071
119 Ga0207703_10130775 3300026035 Bacteria 2167
120 Ga0207708_10139118 3300026075 Bacteria 1903
121 Ga0207708_10514546 3300026075 Bacteria 1005
122 Ga0207641_11255863 3300026088 Bacteria 741
123 Ga0207676_10507429 3300026095 Bacteria 1146
124 Ga0207675_100473360 3300026118 Bacteria 1244
125 Ga0209588_1070344 3300027671 Bacteria 1130
126 Ga0207428_10007950 3300027907 Bacteria 9630
127 Ga0207428_10074548 3300027907 Bacteria 2661
128 Ga0207428_10261506 3300027907 Bacteria 1289
129 Ga0268264_11367312 3300028381 Bacteria 718
130 Ga0265318_10028485 3300028577 Bacteria 2184
131 Ga0265332_10002293 3300031238 Bacteria 9786
132 Ga0265340_10003648 3300031247 Bacteria 8655
133 Ga0265339_10013698 3300031249 Bacteria 4910
134 Ga0265331_10006890 3300031250 Bacteria 6638
135 Ga0265327_10136429 3300031251 Bacteria 1150
136 Ga0265316_10323753 3300031344 Bacteria 1119
137 Ga0307408_100830636 3300031548 Bacteria 841
138 Ga0265313_10026605 3300031595 Bacteria 3044
139 Ga0265342_10002113 3300031712 Bacteria 17530
140 Ga0316578_10009611 3300031728 Bacteria 4977
141 Ga0307409_100690646 3300031995 Bacteria 1019
142 Ga0307416_101449120 3300032002 Bacteria 792
143 Ga0307414_10201511 3300032004 Bacteria 1619
144 Ga0373926_0038012 3300035083 Bacteria 1714
145 Ga0373944_0148923 3300035089 Bacteria 824
146 Ga0373923_0232270 3300035111 Bacteria 860
147 Ga0373956_0555700 3300035119 Bacteria 548
148 Ga0373943_0367290 3300035170 Bacteria 827
149 Ga0373931_0511082 3300035691 Bacteria 776
150 Ga0373947_0321234 3300035725 Bacteria 1035
151 Ga0265778_015875 3300036457 Bacteria 899
152 Ga0316584_0909521 3300036712 Bacteria 592
153 Ga0395905_0094110 3300037471 Unclassified 2810
154 Ga0395905_0690124 3300037471 Bacteria 923
155 Ga0395901_0367219 3300038443 Bacteria 1483
156 Ga0436365_1389075 3300039437 Bacteria 1278
157 Ga0436360_0863045 3300039438 Bacteria 12720
158 Ga0436361_0383753 3300039447 Bacteria 4877
159 Ga0436362_0473252 3300039453 Bacteria 8132
160 Ga0439464_0154561 3300042439 Bacteria 719
161 Ga0451577_0236818 3300042876 Bacteria 1651
162 Ga0466963_1301470 3300044694 Bacteria 510
163 Ga0453684_1359567 3300044712 Bacteria 738
164 Ga0495580_0461572 3300046472 Bacteria 851
165 Ga0495585_0369215 3300046492 Bacteria 695
166 Ga0495608_0143677 3300046511 Bacteria 1522
167 Ga0495598_0431959 3300046537 Bacteria 519
168 Ga0495633_0276021 3300046558 Bacteria 765
169 Ga0495667_0097711 3300046559 Bacteria 1901
170 Ga0495604_0117761 3300047317 Bacteria 1926
171 Ga0495675_0178535 3300047444 Bacteria 1301
172 Ga0496113_0294819 3300048916 Unclassified 1298
173 Ga0501300_026423 3300049523 Unclassified 852
174 Ga0501321_023673 3300049537 Bacteria 781
175 Ga0501034_0164082 3300049571 Bacteria 2191
176 Ga0501036_0128075 3300049572 Bacteria 2143
177 Ga0501036_0196147 3300049572 Bacteria 1699
178 Ga0501036_0711680 3300049572 Bacteria 829
179 Ga0501037_0069693 3300049573 Bacteria 2559
180 Ga0501038_0069200 3300049574 Bacteria 2998
181 Ga0501038_0974624 3300049574 Bacteria 623
182 Ga0501039_1602558 3300049575 Bacteria 500
183 Ga0501040_0211409 3300049576 Bacteria 1379
184 Ga0501041_0066272 3300049577 Bacteria 2212
185 Ga0501041_0134102 3300049577 Bacteria 1543
186 Ga0501041_0539623 3300049577 Bacteria 743
187 Ga0501042_0137599 3300049578 Bacteria 1760
188 Ga0501042_0509940 3300049578 Bacteria 873
189 Ga0501043_0021451 3300049579 Bacteria 5064
190 Ga0501043_1055222 3300049579 Bacteria 576
191 Ga0501046_0047990 3300049580 Bacteria 3383
192 Ga0501046_0208242 3300049580 Unclassified 1452
193 Ga0501046_0353343 3300049580 Bacteria 1067
194 Ga0501047_0308397 3300049581 Bacteria 1424
195 Ga0501048_1283621 3300049582 Bacteria 526
196 Ga0501068_0188854 3300049584 Bacteria 1304
197 Ga0501069_0006872 3300049585 Bacteria 5951
198 Ga0501070_0057049 3300049586 Bacteria 3237
199 Ga0501070_0067009 3300049586 Bacteria 2973
200 Ga0501070_1226363 3300049586 Bacteria 575
201 Ga0501071_0061786 3300049587 Bacteria 2713
202 Ga0501071_0129159 3300049587 Bacteria 1877
203 Ga0501071_0952623 3300049587 Bacteria 663
204 Ga0501071_1443800 3300049587 Bacteria 531
205 Ga0501072_0303252 3300049588 Bacteria 1270
206 Ga0501072_0600263 3300049588 Bacteria 868
207 Ga0501072_0746242 3300049588 Bacteria 768
208 Ga0501072_0835319 3300049588 Bacteria 720
209 Ga0501072_1318361 3300049588 Bacteria 559
210 Ga0501072_1614343 3300049588 Bacteria 500
211 Ga0501073_0117794 3300049589 Bacteria 1840
212 Ga0501074_0015783 3300049590 Bacteria 5490
213 Ga0501075_0433633 3300049591 Bacteria 1002
214 Ga0501075_0505763 3300049591 Bacteria 922
215 Ga0501075_0907668 3300049591 Bacteria 670
216 Ga0501076_0431476 3300049592 Unclassified 1084
217 Ga0501076_0443115 3300049592 Bacteria 1069
218 Ga0501076_0741205 3300049592 Bacteria 811
219 Ga0501077_0066492 3300049593 Bacteria 2287
220 Ga0501077_0093619 3300049593 Bacteria 1904
221 Ga0501077_0855819 3300049593 Bacteria 585
222 Ga0501227_000637 3300049665 Bacteria 7621
223 Ga0501079_0095938 3300049741 Bacteria 2299
224 Ga0501079_0859378 3300049741 Bacteria 714
225 Ga0501080_0012878 3300049742 Bacteria 7674
226 Ga0501080_0026919 3300049742 Bacteria 5347
227 Ga0501080_0146988 3300049742 Bacteria 2179
228 Ga0501081_0128013 3300049743 Bacteria 1812
229 Ga0501081_0312661 3300049743 Bacteria 1154
230 Ga0501083_0770678 3300049744 Bacteria 626
231 Ga0501035_0104446 3300049822 Bacteria 2484
232 Ga0501035_1521655 3300049822 Unclassified 510
233 Ga0501044_0419416 3300049823 Unclassified 1249
234 Ga0501044_0866026 3300049823 Bacteria 780
235 Ga0501044_1216651 3300049823 Bacteria 621
236 Ga0501045_0159011 3300049824 Bacteria 1681
237 nmdc:mga07m45_5593_c1 3300050496 Bacteria 6276
238 nmdc:mga05p37_197333_c1 3300050507 Bacteria 2440
239 nmdc:mga05p37_27631_c1 3300050507 Bacteria 6911
240 nmdc:mga05p37_590461_c1 3300050507 Bacteria 1256
241 nmdc:mga05p37_63206_c1 3300050507 Bacteria 4556
242 nmdc:mga05p37_635_c1 3300050507 Bacteria 38849
243 nmdc:mga09592_374864_c1 3300050508 Bacteria 1231
244 nmdc:mga09592_45751_c1 3300050508 Bacteria 3687
245 nmdc:mga09592_5882_c1 3300050508 Bacteria 10011
246 nmdc:mga09592_865090_c1 3300050508 Bacteria 762
247 nmdc:mga0qj67_392878_c1 3300050509 Bacteria 1120
248 nmdc:mga0qj67_3999_c1 3300050509 Bacteria 10675
249 nmdc:mga0qj67_63980_c1 3300050509 Bacteria 2925
250 nmdc:mga06r32_1530770_c1 3300050510 Bacteria 607
251 nmdc:mga06r32_225422_c1 3300050510 Bacteria 1863
252 nmdc:mga06r32_225861_c1 3300050510 Bacteria 1861
253 nmdc:mga06r32_2776_c1 3300050510 Bacteria 15677
254 nmdc:mga06r32_2820_c1 3300050510 Bacteria 15587
255 nmdc:mga06r32_410116_c1 3300050510 Bacteria 1336
256 nmdc:mga06r32_421947_c1 3300050510 Bacteria 1315
257 nmdc:mga06r32_466737_c1 3300050510 Bacteria 1241
258 nmdc:mga08y16_156175_c1 3300050511 Bacteria 2371
259 nmdc:mga08y16_243268_c1 3300050511 Bacteria 1860
260 nmdc:mga08y16_809_c1 3300050511 Bacteria 29909
261 nmdc:mga0n895_1782_c1 3300050512 Bacteria 16333
262 nmdc:mga0n895_367004_c1 3300050512 Bacteria 1457
263 nmdc:mga0n895_978596_c1 3300050512 Bacteria 828
264 nmdc:mga0rr50_26470_c1 3300050513 Bacteria 4047
265 nmdc:mga0rr50_568246_c1 3300050513 Bacteria 966
266 nmdc:mga08x19_28911_c1 3300050514 Bacteria 3475
267 nmdc:mga0a205_70892_c1 3300050515 Bacteria 3365
268 nmdc:mga0a205_914283_c1 3300050515 Bacteria 724
269 Ga0500616_0021560 3300053153 Unclassified 3609
270 Ga0501084_0247672 3300054114 Bacteria 1504
271 Ga0501084_1635119 3300054114 Bacteria 538
272 Ga0501082_0135470 3300060353 Bacteria 2137
273 Ga0501082_0786400 3300060353 Bacteria 832
274 Ga0530510_0087701 3300061734 Bacteria 2267
275 Ga0530510_0295568 3300061734 Unclassified 1211
276 Ga0530510_0387712 3300061734 Bacteria 1052
277 Ga0530510_0467079 3300061734 Bacteria 955
278 Ga0530510_1341905 3300061734 Bacteria 549
279 8002060771 8002060224 Bacteria 4026565
280 Ga0451576_0603766
281 Ga0006778J45830_1074608
282 JGI25405J52794_10007129
283 JGI25405J52794_10018062
284 JGI25405J52794_10030026
285 Ga0065716_1011276
286 Ga0065707_10617498
287 Ga0070658_10061801
288 Ga0070680_100736063
289 Ga0070689_100604926
290 Ga0070668_100610020
291 Ga0070669_100399076
292 Ga0070669_100906355
293 Ga0070675_100630916
294 Ga0070694_100177581
295 Ga0070699_101942889
296 Ga0070679_100551223
297 Ga0070697_100210771
298 Ga0070686_100703614
299 Ga0070695_101232629
300 Ga0070696_101801874
301 Ga0068855_100627776
302 Ga0068859_100271769
303 Ga0068864_100569985
304 Ga0068861_100446517
305 Ga0068870_10295021
306 Ga0068863_100569295
307 Ga0068858_100096072
308 Ga0068858_100129415
309 Ga0068860_100989072
310 Ga0081455_10014057
311 Ga0081455_10046938
312 Ga0081455_10626572
313 Ga0081538_10006404
314 Ga0081538_10052833
315 Ga0081538_10271636
316 Ga0081540_1011001
317 Ga0081540_1136646
318 Ga0075432_10546511
319 Ga0075427_10036551
320 Ga0075370_10001451
321 Ga0075428_100002056
322 Ga0075428_100091365
323 Ga0075428_100112508
324 Ga0075428_100130107
325 Ga0075428_100199183
326 Ga0075428_100804244
327 Ga0075430_100001066
328 Ga0075430_100277980
329 Ga0075430_100292938
330 Ga0075431_100002077
331 Ga0075431_100008357
332 Ga0075431_100137020
333 Ga0075431_100144785
334 Ga0075431_100160290
335 Ga0075431_100441636
336 Ga0075431_100486889
337 Ga0075431_100776435
338 Ga0075433_10599810
339 Ga0075434_100028217
340 Ga0075434_100694986
341 Ga0075434_101637860
342 Ga0075429_100012253
343 Ga0075429_100026476
344 Ga0075429_100285364
345 Ga0075429_100402401
346 Ga0075429_100525922
347 Ga0075436_100029439
348 Ga0097620_100271776
349 Ga0075435_100154009
350 Ga0075435_100803528
351 Ga0099794_10065100
352 Ga0111539_10001638
353 Ga0111539_10174584
354 Ga0111539_10274855
355 Ga0114129_10005978
356 Ga0114129_10038687
357 Ga0114129_10065725
358 Ga0114129_10340562
359 Ga0114129_10719027
360 Ga0105242_10995014
361 Ga0105249_10081725
362 Ga0105249_10096771
363 Ga0105249_10271106
364 Ga0105239_11170063
365 Ga0105246_10642285
366 Ga0157322_1027395
367 Ga0157338_1033813
368 Ga0157370_10756082
369 Ga0157374_11053210
370 Ga0157378_10078468
371 Ga0157378_11668238
372 Ga0163162_10087947
373 Ga0163162_10248988
374 Ga0157375_10149950
375 Ga0163163_10032929
376 Ga0157379_10020188
377 Ga0157379_10041876
378 Ga0157379_10370374
379 Ga0163161_10918432
380 Ga0197907_10479829
381 Ga0206349_1005970
382 Ga0206350_10218696
383 Ga0206354_10585572
384 Ga0213873_10000981
385 Ga0213872_10024202
386 Ga0224712_10118290
387 Ga0207705_10214897
388 Ga0207654_11043014
389 Ga0207652_10427437
390 Ga0207644_10879349
391 Ga0207686_10224749
392 Ga0207689_10040160
393 Ga0207667_10252381
394 Ga0207712_10199724
395 Ga0207712_10208441
396 Ga0207712_10610107
397 Ga0207668_10475357
398 Ga0207703_10130775
399 Ga0207708_10139118
400 Ga0207708_10514546
401 Ga0207641_11255863
402 Ga0207676_10507429
403 Ga0207675_100473360
404 Ga0209588_1070344
405 Ga0207428_10007950
406 Ga0207428_10074548
407 Ga0207428_10261506
408 Ga0268264_11367312
409 Ga0265318_10028485
410 Ga0265332_10002293
411 Ga0265340_10003648
412 Ga0265339_10013698
413 Ga0265331_10006890
414 Ga0265327_10136429
415 Ga0265316_10323753
416 Ga0307408_100830636
417 Ga0265313_10026605
418 Ga0265342_10002113
419 Ga0316578_10009611
420 Ga0307409_100690646
421 Ga0307416_101449120
422 Ga0307414_10201511
423 Ga0373926_0038012
424 Ga0373944_0148923
425 Ga0373923_0232270
426 Ga0373956_0555700
427 Ga0373943_0367290
428 Ga0373931_0511082
429 Ga0373947_0321234
430 Ga0265778_015875
431 Ga0316584_0909521
432 Ga0395905_0094110
433 Ga0395905_0690124
434 Ga0395901_0367219
435 Ga0436365_1389075
436 Ga0436360_0863045
437 Ga0436361_0383753
438 Ga0436362_0473252
439 Ga0439464_0154561
440 Ga0451577_0236818
441 Ga0466963_1301470
442 Ga0453684_1359567
443 Ga0495580_0461572
444 Ga0495585_0369215
445 Ga0495608_0143677
446 Ga0495598_0431959
447 Ga0495633_0276021
448 Ga0495667_0097711
449 Ga0495604_0117761
450 Ga0495675_0178535
451 Ga0496113_0294819
452 Ga0501300_026423
453 Ga0501321_023673
454 Ga0501034_0164082
455 Ga0501036_0128075
456 Ga0501036_0196147
457 Ga0501036_0711680
458 Ga0501037_0069693
459 Ga0501038_0069200
460 Ga0501038_0974624
461 Ga0501039_1602558
462 Ga0501040_0211409
463 Ga0501041_0066272
464 Ga0501041_0134102
465 Ga0501041_0539623
466 Ga0501042_0137599
467 Ga0501042_0509940
468 Ga0501043_0021451
469 Ga0501043_1055222
470 Ga0501046_0047990
471 Ga0501046_0208242
472 Ga0501046_0353343
473 Ga0501047_0308397
474 Ga0501048_1283621
475 Ga0501068_0188854
476 Ga0501069_0006872
477 Ga0501070_0057049
478 Ga0501070_0067009
479 Ga0501070_1226363
480 Ga0501071_0061786
481 Ga0501071_0129159
482 Ga0501071_0952623
483 Ga0501071_1443800
484 Ga0501072_0303252
485 Ga0501072_0600263
486 Ga0501072_0746242
487 Ga0501072_0835319
488 Ga0501072_1318361
489 Ga0501072_1614343
490 Ga0501073_0117794
491 Ga0501074_0015783
492 Ga0501075_0433633
493 Ga0501075_0505763
494 Ga0501075_0907668
495 Ga0501076_0431476
496 Ga0501076_0443115
497 Ga0501076_0741205
498 Ga0501077_0066492
499 Ga0501077_0093619
500 Ga0501077_0855819
501 Ga0501227_000637
502 Ga0501079_0095938
503 Ga0501079_0859378
504 Ga0501080_0012878
505 Ga0501080_0026919
506 Ga0501080_0146988
507 Ga0501081_0128013
508 Ga0501081_0312661
509 Ga0501083_0770678
510 Ga0501035_0104446
511 Ga0501035_1521655
512 Ga0501044_0419416
513 Ga0501044_0866026
514 Ga0501044_1216651
515 Ga0501045_0159011
516 nmdc:mga07m45_5593_c1
517 nmdc:mga05p37_197333_c1
518 nmdc:mga05p37_27631_c1
519 nmdc:mga05p37_590461_c1
520 nmdc:mga05p37_63206_c1
521 nmdc:mga05p37_635_c1
522 nmdc:mga09592_374864_c1
523 nmdc:mga09592_45751_c1
524 nmdc:mga09592_5882_c1
525 nmdc:mga09592_865090_c1
526 nmdc:mga0qj67_392878_c1
527 nmdc:mga0qj67_3999_c1
528 nmdc:mga0qj67_63980_c1
529 nmdc:mga06r32_1530770_c1
530 nmdc:mga06r32_225422_c1
531 nmdc:mga06r32_225861_c1
532 nmdc:mga06r32_2776_c1
533 nmdc:mga06r32_2820_c1
534 nmdc:mga06r32_410116_c1
535 nmdc:mga06r32_421947_c1
536 nmdc:mga06r32_466737_c1
537 nmdc:mga08y16_156175_c1
538 nmdc:mga08y16_243268_c1
539 nmdc:mga08y16_809_c1
540 nmdc:mga0n895_1782_c1
541 nmdc:mga0n895_367004_c1
542 nmdc:mga0n895_978596_c1
543 nmdc:mga0rr50_26470_c1
544 nmdc:mga0rr50_568246_c1
545 nmdc:mga08x19_28911_c1
546 nmdc:mga0a205_70892_c1
547 nmdc:mga0a205_914283_c1
548 Ga0500616_0021560
549 Ga0501084_0247672
550 Ga0501084_1635119
551 Ga0501082_0135470
552 Ga0501082_0786400
553 Ga0530510_0087701
554 Ga0530510_0295568
555 Ga0530510_0387712
556 Ga0530510_0467079
557 Ga0530510_1341905
558 8002060771

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

32

162

0.93

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

31

163

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.895 1 136
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8698 1 136
1u7i-assembly1.cif.gz_B crystal structure of protein of unknown function pa1358 from pseudomonas aeruginosa 0.8362 1 137
1u7i-assembly1.cif.gz_B crystal structure of protein of unknown function pa1358 from pseudomonas aeruginosa 0.819 1 137
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8055 1 135
ID Description Score Start End Superfamily
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9454 83 135 3.30.720.110
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9159 76 136 3.30.720.110
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9018 76 136 3.30.720.110
af_P16681_7_147_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9012 8 139 3.10.180.10
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8794 8 136 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A4Q3N8G3-F1-model_v4 VOC family protein 0.9787 76 137
AF-A0A645H805-F1-model_v4 PhnB-like domain-containing protein 0.9771 55 138
AF-A0A257Z3W3-F1-model_v4 Uncharacterized protein 0.9767 76 139
AF-A0A3C0BKM2-F1-model_v4 PhnB-like domain-containing protein 0.9755 82 139
AF-A0A2A9RJP0-F1-model_v4 deleted 0.9753 82 138

Map