F383096

General Info

Members Datasets Scaffolds Average Seq Length
279 180 558 91

Family's Representative Sequence

Representative Sequence 3300020080|Ga0206350_11450027|Ga0206350_114500272
Length 100
Sequence MAHKKGVGSSRNGRDSKPKMRGIKRYGGEVVKPGTIIVRQCGTKVHPGKNVGLGRDYTIYSLIDGQVKFEPMDRRRKRVSVYPVAVVAPVVEVETTAAAD

Samples

Sample ID Description Type Environment
1 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
61 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
115 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
119 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
120 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
121 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
132 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
147 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
148 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
160 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
161 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
162 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
163 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
164 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
165 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
166 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 66.31
Metatranscriptomes 33.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0
Rhizoplane 1.43
Rhizosphere 92.47
Stem 0
Stem Tuber 0
Unclassified 16.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206350_11450027 3300020080 Bacteria 1259
2 rootL2_10353546 3300003322 Unclassified 1916
3 rootH1_10023460 3300003323 Bacteria 9640
4 Ga0058859_11770912 3300004798 Bacteria 1146
5 Ga0058863_11370647 3300004799 Bacteria 801
6 Ga0058861_10007387 3300004800 Bacteria 891
7 Ga0058861_11596261 3300004800 Bacteria 734
8 Ga0058860_11962984 3300004801 Bacteria 593
9 Ga0058860_12216824 3300004801 Bacteria 1125
10 Ga0058862_12692043 3300004803 Unclassified 1373
11 Ga0070683_101166749 3300005329 Bacteria 740
12 Ga0068869_101149008 3300005334 Bacteria 681
13 Ga0070689_101817636 3300005340 Bacteria 556
14 Ga0070692_10925102 3300005345 Unclassified 605
15 Ga0070692_11064626 3300005345 Bacteria 569
16 Ga0070668_100939744 3300005347 Bacteria 775
17 Ga0070669_100759355 3300005353 Bacteria 822
18 Ga0070674_101029330 3300005356 Bacteria 724
19 Ga0070674_101717005 3300005356 Bacteria 568
20 Ga0070667_102007817 3300005367 Bacteria 545
21 Ga0070701_10285242 3300005438 Bacteria 1010
22 Ga0070705_100837108 3300005440 Bacteria 735
23 Ga0070705_101889078 3300005440 Bacteria 508
24 Ga0070700_100346254 3300005441 Unclassified 1100
25 Ga0070681_10104847 3300005458 Bacteria 2769
26 Ga0070681_10118990 3300005458 Bacteria 2578
27 Ga0070685_10072466 3300005466 Bacteria 2045
28 Ga0070698_100831959 3300005471 Bacteria 868
29 Ga0070679_100607201 3300005530 Bacteria 1037
30 Ga0070684_100546697 3300005535 Unclassified 1075
31 Ga0068853_100225233 3300005539 Bacteria 1714
32 Ga0070686_100318443 3300005544 Bacteria 1159
33 Ga0070665_101149573 3300005548 Bacteria 787
34 Ga0070704_100511801 3300005549 Bacteria 1043
35 Ga0068855_100269209 3300005563 Bacteria 1895
36 Ga0068855_100338118 3300005563 Bacteria 1661
37 Ga0068856_102393428 3300005614 Bacteria 535
38 Ga0068859_101333559 3300005617 Bacteria 791
39 Ga0068861_101513894 3300005719 Unclassified 659
40 Ga0068858_101178962 3300005842 Bacteria 753
41 Ga0068858_102571559 3300005842 Unclassified 503
42 Ga0075364_10193376 3300006051 Bacteria 1378
43 Ga0075431_100015750 3300006847 Bacteria 7666
44 Ga0075436_100755292 3300006914 Bacteria 722
45 Ga0097620_101333713 3300006931 Bacteria 791
46 Ga0105240_10000009 3300009093 Bacteria 591332
47 Ga0105240_10024683 3300009093 Bacteria 7918
48 Ga0111539_12828397 3300009094 Unclassified 562
49 Ga0105245_11096163 3300009098 Bacteria 842
50 Ga0114129_10158557 3300009147 Bacteria 3093
51 Ga0105243_10328202 3300009148 Unclassified 1397
52 Ga0105243_10442677 3300009148 Bacteria 1217
53 Ga0105243_10563943 3300009148 Bacteria 1090
54 Ga0105243_10753602 3300009148 Unclassified 955
55 Ga0105242_10707931 3300009176 Unclassified 986
56 Ga0105248_11084057 3300009177 Bacteria 905
57 Ga0105248_11405538 3300009177 Bacteria 790
58 Ga0105248_11411485 3300009177 Bacteria 788
59 Ga0105238_11251520 3300009551 Bacteria 767
60 Ga0105249_10086232 3300009553 Bacteria 2928
61 Ga0105249_10551747 3300009553 Bacteria 1203
62 Ga0105249_11116327 3300009553 Bacteria 859
63 Ga0105249_12139331 3300009553 Bacteria 632
64 Ga0105249_13136237 3300009553 Bacteria 531
65 Ga0105239_10097384 3300010375 Bacteria 3251
66 Ga0105239_10438906 3300010375 Bacteria 1480
67 Ga0105246_10803037 3300011119 Bacteria 835
68 Ga0105246_11491241 3300011119 Unclassified 635
69 Ga0157370_10835982 3300013104 Bacteria 837
70 Ga0157374_11658685 3300013296 Bacteria 664
71 Ga0157378_10413550 3300013297 Unclassified 1332
72 Ga0157378_11622757 3300013297 Bacteria 693
73 Ga0163162_10133399 3300013306 Bacteria 2593
74 Ga0163162_11366483 3300013306 Bacteria 806
75 Ga0157375_11826135 3300013308 Unclassified 721
76 Ga0163163_10870113 3300014325 Bacteria 964
77 Ga0157380_10085844 3300014326 Bacteria 2584
78 Ga0163161_11059460 3300017792 Bacteria 695
79 Ga0197907_10112934 3300020069 Bacteria 503
80 Ga0197907_10411901 3300020069 Bacteria 506
81 Ga0197907_10440064 3300020069 Bacteria 860
82 Ga0197907_10465780 3300020069 Bacteria 607
83 Ga0197907_10518121 3300020069 Bacteria 1281
84 Ga0197907_11336753 3300020069 Unclassified 1314
85 Ga0206356_10284334 3300020070 Bacteria 706
86 Ga0206356_10612469 3300020070 Unclassified 1516
87 Ga0206356_10707407 3300020070 Unclassified 640
88 Ga0206356_10758853 3300020070 Bacteria 1189
89 Ga0206356_10811105 3300020070 Unclassified 740
90 Ga0206356_11065055 3300020070 Unclassified 506
91 Ga0206356_11309104 3300020070 Bacteria 1098
92 Ga0206356_11334071 3300020070 Bacteria 925
93 Ga0206356_11366945 3300020070 Bacteria 560
94 Ga0206356_11714466 3300020070 Bacteria 815
95 Ga0206349_1077593 3300020075 Unclassified 503
96 Ga0206349_1109076 3300020075 Bacteria 570
97 Ga0206349_1154840 3300020075 Bacteria 878
98 Ga0206349_1363540 3300020075 Unclassified 947
99 Ga0206349_1658332 3300020075 Bacteria 947
100 Ga0206349_1746229 3300020075 Bacteria 1399
101 Ga0206349_1819955 3300020075 Bacteria 904
102 Ga0206349_1898979 3300020075 Bacteria 952
103 Ga0206355_1231025 3300020076 Bacteria 1411
104 Ga0206355_1254555 3300020076 Bacteria 950
105 Ga0206355_1468091 3300020076 Bacteria 796
106 Ga0206355_1567161 3300020076 Bacteria 709
107 Ga0206355_1624133 3300020076 Bacteria 951
108 Ga0206351_10029455 3300020077 Unclassified 1317
109 Ga0206351_10581926 3300020077 Bacteria 1046
110 Ga0206352_10555916 3300020078 Bacteria 1354
111 Ga0206352_10654752 3300020078 Bacteria 907
112 Ga0206352_10705283 3300020078 Unclassified 508
113 Ga0206352_10825501 3300020078 Bacteria 622
114 Ga0206352_10902437 3300020078 Unclassified 741
115 Ga0206352_11357438 3300020078 Bacteria 536
116 Ga0206350_10170472 3300020080 Bacteria 1973
117 Ga0206350_10480088 3300020080 Bacteria 936
118 Ga0206350_10832589 3300020080 Bacteria 2171
119 Ga0206350_11365073 3300020080 Bacteria 781
120 Ga0206350_11613342 3300020080 Bacteria 810
121 Ga0206354_10502481 3300020081 Bacteria 1219
122 Ga0206354_11073949 3300020081 Unclassified 610
123 Ga0206354_11196265 3300020081 Bacteria 728
124 Ga0206354_11418241 3300020081 Bacteria 886
125 Ga0206354_11491984 3300020081 Unclassified 769
126 Ga0206354_11541007 3300020081 Unclassified 831
127 Ga0206353_10096371 3300020082 Unclassified 672
128 Ga0206353_10567004 3300020082 Bacteria 894
129 Ga0206353_10702954 3300020082 Bacteria 835
130 Ga0206353_10756791 3300020082 Bacteria 725
131 Ga0206353_11142155 3300020082 Bacteria 760
132 Ga0206353_11626226 3300020082 Bacteria 1248
133 Ga0206353_11838994 3300020082 Bacteria 1369
134 Ga0206353_12033663 3300020082 Bacteria 995
135 Ga0154015_1076121 3300020610 Bacteria 928
136 Ga0224712_10030923 3300022467 Bacteria 1937
137 Ga0224712_10171346 3300022467 Bacteria 974
138 Ga0224712_10279984 3300022467 Bacteria 776
139 Ga0224712_10310633 3300022467 Bacteria 739
140 Ga0224712_10653973 3300022467 Unclassified 515
141 Ga0224712_10669089 3300022467 Bacteria 510
142 Ga0224712_10686842 3300022467 Bacteria 503
143 Ga0207707_10128531 3300025912 Bacteria 2215
144 Ga0207707_10601614 3300025912 Bacteria 930
145 Ga0207695_10234305 3300025913 Bacteria 1739
146 Ga0207660_10098350 3300025917 Bacteria 2182
147 Ga0207652_10067368 3300025921 Bacteria 3104
148 Ga0207652_10173439 3300025921 Bacteria 1936
149 Ga0207646_11719944 3300025922 Unclassified 538
150 Ga0207681_10449055 3300025923 Bacteria 1049
151 Ga0207669_10423692 3300025937 Bacteria 1048
152 Ga0207704_10153000 3300025938 Bacteria 1630
153 Ga0207691_10536859 3300025940 Bacteria 992
154 Ga0207689_10996861 3300025942 Bacteria 707
155 Ga0207667_10117813 3300025949 Bacteria 2737
156 Ga0207667_10314469 3300025949 Bacteria 1599
157 Ga0207712_10651402 3300025961 Bacteria 915
158 Ga0207712_10938591 3300025961 Bacteria 766
159 Ga0207658_10369464 3300025986 Unclassified 1254
160 Ga0207677_11005129 3300026023 Bacteria 756
161 Ga0207703_11826166 3300026035 Unclassified 584
162 Ga0207639_12086504 3300026041 Bacteria 528
163 Ga0207678_10570578 3300026067 Bacteria 991
164 Ga0207708_10247235 3300026075 Bacteria 1436
165 Ga0207641_10232329 3300026088 Bacteria 1715
166 Ga0207641_10485713 3300026088 Bacteria 1198
167 Ga0207674_10568396 3300026116 Bacteria 1095
168 Ga0207675_100310069 3300026118 Bacteria 1539
169 Ga0209974_10254744 3300027876 Bacteria 661
170 Ga0268266_11637685 3300028379 Bacteria 619
171 Ga0307515_10484066 3300028794 Bacteria 849
172 Ga0265331_10120115 3300031250 Bacteria 1202
173 Ga0307408_100194678 3300031548 Bacteria 1636
174 Ga0307508_10189383 3300031616 Bacteria 1659
175 Ga0316575_10012646 3300031665 Bacteria 3143
176 Ga0316576_10340402 3300031727 Bacteria 1117
177 Ga0316576_10648393 3300031727 Bacteria 768
178 Ga0307405_11985787 3300031731 Bacteria 520
179 Ga0307406_11160947 3300031901 Bacteria 669
180 Ga0307407_11092916 3300031903 Bacteria 620
181 Ga0307416_101387106 3300032002 Bacteria 808
182 Ga0307414_11315357 3300032004 Bacteria 671
183 Ga0307411_11121074 3300032005 Bacteria 710
184 Ga0307415_101656229 3300032126 Bacteria 616
185 Ga0316588_1105747 3300033528 Bacteria 706
186 Ga0316587_1059159 3300033529 Unclassified 708
187 Ga0316587_1062841 3300033529 Unclassified 690
188 Ga0373953_0320637 3300035117 Bacteria 677
189 Ga0373943_0262878 3300035170 Bacteria 972
190 Ga0373931_1187411 3300035691 Unclassified 522
191 Ga0373933_0665513 3300035724 Bacteria 684
192 Ga0373947_0289944 3300035725 Bacteria 1090
193 Ga0373937_0001582 3300036401 Bacteria 19124
194 Ga0395900_1046135 3300037418 Unclassified 735
195 Ga0395905_0003613 3300037471 Bacteria 16439
196 Ga0395905_0031641 3300037471 Unclassified 4979
197 Ga0395905_0074140 3300037471 Bacteria 3189
198 Ga0395901_0049171 3300038443 Bacteria 4381
199 Ga0400484_02361 3300038725 Bacteria 5926
200 Ga0400490_37746 3300038726 Bacteria 1913
201 Ga0436365_1461687 3300039437 Bacteria 636
202 Ga0436361_1219905 3300039447 Bacteria 2298
203 Ga0439439_0108612 3300041406 Bacteria 767
204 Ga0450923_094951 3300042125 Bacteria 683
205 Ga0439446_0194985 3300042156 Bacteria 682
206 Ga0439434_0058185 3300042435 Bacteria 1206
207 Ga0451577_0245067 3300042876 Unclassified 1622
208 Ga0451577_0435207 3300042876 Bacteria 1191
209 Ga0451577_0598261 3300042876 Unclassified 1001
210 Ga0466972_0002074 3300044658 Bacteria 9810
211 Ga0466972_0558118 3300044658 Bacteria 540
212 Ga0466965_0409065 3300044683 Bacteria 750
213 Ga0453684_0010328 3300044712 Bacteria 15987
214 Ga0453684_0094736 3300044712 Bacteria 3672
215 Ga0453684_0245546 3300044712 Bacteria 2059
216 Ga0453684_0751557 3300044712 Bacteria 1055
217 Ga0466968_0001074 3300044735 Bacteria 9690
218 Ga0466957_0428326 3300044842 Unclassified 909
219 Ga0466960_0047262 3300044901 Bacteria 2063
220 Ga0451576_2151326 3300045051 Bacteria 573
221 Ga0495629_0694851 3300046459 Bacteria 676
222 Ga0495598_0017234 3300046537 Unclassified 1859
223 Ga0495621_0075377 3300046539 Bacteria 1250
224 Ga0495636_0006021 3300047318 Bacteria 4759
225 Ga0495593_0692294 3300047673 Bacteria 512
226 Ga0495615_0003010 3300048090 Bacteria 2779
227 Ga0496102_0638255 3300048905 Bacteria 988
228 Ga0496109_0539049 3300048912 Bacteria 1101
229 Ga0496109_0627793 3300048912 Bacteria 1011
230 Ga0496110_0491512 3300048913 Unclassified 1118
231 Ga0496116_0004973 3300048919 Bacteria 12525
232 Ga0496124_0600897 3300048927 Bacteria 716
233 Ga0496126_0109463 3300048929 Unclassified 2408
234 Ga0501308_004117 3300049128 Bacteria 1386
235 Ga0501309_080213 3300049129 Bacteria 546
236 Ga0501304_002362 3300049160 Bacteria 1304
237 Ga0501307_002230 3300049162 Bacteria 1778
238 Ga0501292_056020 3300049515 Bacteria 707
239 Ga0501299_061101 3300049522 Bacteria 798
240 Ga0501299_066298 3300049522 Bacteria 775
241 Ga0501311_010051 3300049527 Bacteria 1142
242 Ga0501314_008849 3300049530 Bacteria 916
243 Ga0501315_009498 3300049531 Bacteria 1151
244 Ga0501319_005780 3300049535 Bacteria 896
245 Ga0501321_010869 3300049537 Bacteria 1006
246 Ga0501323_013810 3300049539 Bacteria 1003
247 Ga0501325_023515 3300049541 Unclassified 665
248 Ga0501334_12477 3300049550 Bacteria 631
249 Ga0501034_0000239 3300049571 Bacteria 101725
250 Ga0501034_1339562 3300049571 Bacteria 592
251 Ga0501038_0193382 3300049574 Bacteria 1636
252 Ga0501039_1409136 3300049575 Unclassified 536
253 Ga0501227_191583 3300049665 Bacteria 577
254 Ga0501233_065856 3300049668 Bacteria 909
255 Ga0501249_070373 3300049679 Bacteria 817
256 Ga0501257_041878 3300049686 Bacteria 1126
257 Ga0501257_046572 3300049686 Bacteria 1074
258 Ga0501259_111404 3300049688 Bacteria 640
259 Ga0501268_036288 3300049765 Bacteria 913
260 Ga0501270_052172 3300049767 Bacteria 744
261 Ga0501274_027390 3300049771 Bacteria 626
262 Ga0501044_0668175 3300049823 Bacteria 927
263 nmdc:mga05p37_1056902_c1 3300050507 Bacteria 855
264 nmdc:mga05p37_71893_c1 3300050507 Bacteria 4256
265 nmdc:mga09592_1436525_c1 3300050508 Bacteria 563
266 nmdc:mga06r32_13593_c1 3300050510 Bacteria 7379
267 nmdc:mga08x19_654901_c1 3300050514 Bacteria 745
268 Ga0500643_000442 3300053087 Bacteria 31035
269 Ga0500616_0000077 3300053153 Bacteria 208506
270 Ga0500616_0000186 3300053153 Bacteria 102009
271 Ga0587083_0046105 3300059505 Bacteria 933
272 Ga0587083_0198286 3300059505 Bacteria 572
273 Ga0587090_057499 3300059510 Bacteria 729
274 Ga0587109_104825 3300059624 Bacteria 654
275 Ga0587113_032309 3300059625 Bacteria 598
276 Ga0587114_053985 3300059655 Bacteria 688
277 Ga0587111_0102975 3300060346 Bacteria 714
278 Ga0530510_0506023 3300061734 Bacteria 916
279 Ga0530510_0867422 3300061734 Bacteria 689
280 Ga0206350_11450027
281 rootL2_10353546
282 rootH1_10023460
283 Ga0058859_11770912
284 Ga0058863_11370647
285 Ga0058861_10007387
286 Ga0058861_11596261
287 Ga0058860_11962984
288 Ga0058860_12216824
289 Ga0058862_12692043
290 Ga0070683_101166749
291 Ga0068869_101149008
292 Ga0070689_101817636
293 Ga0070692_10925102
294 Ga0070692_11064626
295 Ga0070668_100939744
296 Ga0070669_100759355
297 Ga0070674_101029330
298 Ga0070674_101717005
299 Ga0070667_102007817
300 Ga0070701_10285242
301 Ga0070705_100837108
302 Ga0070705_101889078
303 Ga0070700_100346254
304 Ga0070681_10104847
305 Ga0070681_10118990
306 Ga0070685_10072466
307 Ga0070698_100831959
308 Ga0070679_100607201
309 Ga0070684_100546697
310 Ga0068853_100225233
311 Ga0070686_100318443
312 Ga0070665_101149573
313 Ga0070704_100511801
314 Ga0068855_100269209
315 Ga0068855_100338118
316 Ga0068856_102393428
317 Ga0068859_101333559
318 Ga0068861_101513894
319 Ga0068858_101178962
320 Ga0068858_102571559
321 Ga0075364_10193376
322 Ga0075431_100015750
323 Ga0075436_100755292
324 Ga0097620_101333713
325 Ga0105240_10000009
326 Ga0105240_10024683
327 Ga0111539_12828397
328 Ga0105245_11096163
329 Ga0114129_10158557
330 Ga0105243_10328202
331 Ga0105243_10442677
332 Ga0105243_10563943
333 Ga0105243_10753602
334 Ga0105242_10707931
335 Ga0105248_11084057
336 Ga0105248_11405538
337 Ga0105248_11411485
338 Ga0105238_11251520
339 Ga0105249_10086232
340 Ga0105249_10551747
341 Ga0105249_11116327
342 Ga0105249_12139331
343 Ga0105249_13136237
344 Ga0105239_10097384
345 Ga0105239_10438906
346 Ga0105246_10803037
347 Ga0105246_11491241
348 Ga0157370_10835982
349 Ga0157374_11658685
350 Ga0157378_10413550
351 Ga0157378_11622757
352 Ga0163162_10133399
353 Ga0163162_11366483
354 Ga0157375_11826135
355 Ga0163163_10870113
356 Ga0157380_10085844
357 Ga0163161_11059460
358 Ga0197907_10112934
359 Ga0197907_10411901
360 Ga0197907_10440064
361 Ga0197907_10465780
362 Ga0197907_10518121
363 Ga0197907_11336753
364 Ga0206356_10284334
365 Ga0206356_10612469
366 Ga0206356_10707407
367 Ga0206356_10758853
368 Ga0206356_10811105
369 Ga0206356_11065055
370 Ga0206356_11309104
371 Ga0206356_11334071
372 Ga0206356_11366945
373 Ga0206356_11714466
374 Ga0206349_1077593
375 Ga0206349_1109076
376 Ga0206349_1154840
377 Ga0206349_1363540
378 Ga0206349_1658332
379 Ga0206349_1746229
380 Ga0206349_1819955
381 Ga0206349_1898979
382 Ga0206355_1231025
383 Ga0206355_1254555
384 Ga0206355_1468091
385 Ga0206355_1567161
386 Ga0206355_1624133
387 Ga0206351_10029455
388 Ga0206351_10581926
389 Ga0206352_10555916
390 Ga0206352_10654752
391 Ga0206352_10705283
392 Ga0206352_10825501
393 Ga0206352_10902437
394 Ga0206352_11357438
395 Ga0206350_10170472
396 Ga0206350_10480088
397 Ga0206350_10832589
398 Ga0206350_11365073
399 Ga0206350_11613342
400 Ga0206354_10502481
401 Ga0206354_11073949
402 Ga0206354_11196265
403 Ga0206354_11418241
404 Ga0206354_11491984
405 Ga0206354_11541007
406 Ga0206353_10096371
407 Ga0206353_10567004
408 Ga0206353_10702954
409 Ga0206353_10756791
410 Ga0206353_11142155
411 Ga0206353_11626226
412 Ga0206353_11838994
413 Ga0206353_12033663
414 Ga0154015_1076121
415 Ga0224712_10030923
416 Ga0224712_10171346
417 Ga0224712_10279984
418 Ga0224712_10310633
419 Ga0224712_10653973
420 Ga0224712_10669089
421 Ga0224712_10686842
422 Ga0207707_10128531
423 Ga0207707_10601614
424 Ga0207695_10234305
425 Ga0207660_10098350
426 Ga0207652_10067368
427 Ga0207652_10173439
428 Ga0207646_11719944
429 Ga0207681_10449055
430 Ga0207669_10423692
431 Ga0207704_10153000
432 Ga0207691_10536859
433 Ga0207689_10996861
434 Ga0207667_10117813
435 Ga0207667_10314469
436 Ga0207712_10651402
437 Ga0207712_10938591
438 Ga0207658_10369464
439 Ga0207677_11005129
440 Ga0207703_11826166
441 Ga0207639_12086504
442 Ga0207678_10570578
443 Ga0207708_10247235
444 Ga0207641_10232329
445 Ga0207641_10485713
446 Ga0207674_10568396
447 Ga0207675_100310069
448 Ga0209974_10254744
449 Ga0268266_11637685
450 Ga0307515_10484066
451 Ga0265331_10120115
452 Ga0307408_100194678
453 Ga0307508_10189383
454 Ga0316575_10012646
455 Ga0316576_10340402
456 Ga0316576_10648393
457 Ga0307405_11985787
458 Ga0307406_11160947
459 Ga0307407_11092916
460 Ga0307416_101387106
461 Ga0307414_11315357
462 Ga0307411_11121074
463 Ga0307415_101656229
464 Ga0316588_1105747
465 Ga0316587_1059159
466 Ga0316587_1062841
467 Ga0373953_0320637
468 Ga0373943_0262878
469 Ga0373931_1187411
470 Ga0373933_0665513
471 Ga0373947_0289944
472 Ga0373937_0001582
473 Ga0395900_1046135
474 Ga0395905_0003613
475 Ga0395905_0031641
476 Ga0395905_0074140
477 Ga0395901_0049171
478 Ga0400484_02361
479 Ga0400490_37746
480 Ga0436365_1461687
481 Ga0436361_1219905
482 Ga0439439_0108612
483 Ga0450923_094951
484 Ga0439446_0194985
485 Ga0439434_0058185
486 Ga0451577_0245067
487 Ga0451577_0435207
488 Ga0451577_0598261
489 Ga0466972_0002074
490 Ga0466972_0558118
491 Ga0466965_0409065
492 Ga0453684_0010328
493 Ga0453684_0094736
494 Ga0453684_0245546
495 Ga0453684_0751557
496 Ga0466968_0001074
497 Ga0466957_0428326
498 Ga0466960_0047262
499 Ga0451576_2151326
500 Ga0495629_0694851
501 Ga0495598_0017234
502 Ga0495621_0075377
503 Ga0495636_0006021
504 Ga0495593_0692294
505 Ga0495615_0003010
506 Ga0496102_0638255
507 Ga0496109_0539049
508 Ga0496109_0627793
509 Ga0496110_0491512
510 Ga0496116_0004973
511 Ga0496124_0600897
512 Ga0496126_0109463
513 Ga0501308_004117
514 Ga0501309_080213
515 Ga0501304_002362
516 Ga0501307_002230
517 Ga0501292_056020
518 Ga0501299_061101
519 Ga0501299_066298
520 Ga0501311_010051
521 Ga0501314_008849
522 Ga0501315_009498
523 Ga0501319_005780
524 Ga0501321_010869
525 Ga0501323_013810
526 Ga0501325_023515
527 Ga0501334_12477
528 Ga0501034_0000239
529 Ga0501034_1339562
530 Ga0501038_0193382
531 Ga0501039_1409136
532 Ga0501227_191583
533 Ga0501233_065856
534 Ga0501249_070373
535 Ga0501257_041878
536 Ga0501257_046572
537 Ga0501259_111404
538 Ga0501268_036288
539 Ga0501270_052172
540 Ga0501274_027390
541 Ga0501044_0668175
542 nmdc:mga05p37_1056902_c1
543 nmdc:mga05p37_71893_c1
544 nmdc:mga09592_1436525_c1
545 nmdc:mga06r32_13593_c1
546 nmdc:mga08x19_654901_c1
547 Ga0500643_000442
548 Ga0500616_0000077
549 Ga0500616_0000186
550 Ga0587083_0046105
551 Ga0587083_0198286
552 Ga0587090_057499
553 Ga0587109_104825
554 Ga0587113_032309
555 Ga0587114_053985
556 Ga0587111_0102975
557 Ga0530510_0506023
558 Ga0530510_0867422

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

81

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9538 19 83
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9518 21 85
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9488 19 83
7pkt-assembly1.cif.gz_u large subunit of the chlamydomonas reinhardtii mitoribosome 0.9396 18 83
8c95-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9306 19 83
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9518 21 85 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9242 21 85 2.40.50.100
af_Q9NDU6_129_252_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8826 20 87 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8692 29 82 2.40.50.100
af_P0A7L8_6_84_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8441 6 82 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A7X7P7E9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9937 27 85 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A328ESH9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9892 20 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A660TPI7-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9805 19 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A7X7P7E9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9773 27 85 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A356W924-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.974 23 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map