F379155

General Info

Members Datasets Scaffolds Average Seq Length
273 159 546 335

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0054854|Ga0316584_0054854_1700_2752
Length 350
Sequence MSFQRLWVIFKARNREYFRDRAAFGWNFLFPFLIIAGFGLIFGGKELSEYKVGVFPLATQSPAGENLRIAAAFGETRYLQFVPIASLEEGLTKLNRHKIDFLVKNDPASRDYWVNDASPKGYMIERLFNDSLRASAGLPAPGRKNAIQGARIRYIDWLFPGILGMNMMFSALWGVGYVVVRYRKNGVLKRLKATPLTALEYLGAQVLSRVFLLMFSLVVVWVGCDLIFHFQVAGRYLDLLLTFLVGGLSLTAVGVLMASRGVSEEFTSGVLNFITWPMMFLSEVWFSLEGSPRWVWGLAQVFPLTHLISAVRKIMNDGADLMAVRLELAVMLAISAVCLALGARLFSWNR

Samples

Sample ID Description Type Environment
1 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
86 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
87 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
88 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
89 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
90 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
91 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
92 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
93 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
104 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
105 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
106 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
151 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
152 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
153 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
154 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
155 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
157 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
158 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
159 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 0.73
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0
Rhizoplane 5.49
Rhizosphere 79.85
Stem 0
Stem Tuber 0
Unclassified 4.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316584_0054854 3300036712 Bacteria 2984
2 rootL2_10066149 3300003322 Bacteria 2357
3 Ga0065707_10083048 3300005295 Bacteria 10697
4 Ga0070690_100014646 3300005330 Bacteria 4654
5 Ga0068869_100051192 3300005334 Bacteria 2996
6 Ga0070666_10009329 3300005335 Bacteria 6113
7 Ga0070666_10016322 3300005335 Bacteria 4749
8 Ga0070680_100005101 3300005336 Bacteria 9914
9 Ga0070680_100007063 3300005336 Bacteria 8559
10 Ga0070680_100015164 3300005336 Bacteria 6036
11 Ga0070692_10254980 3300005345 Bacteria 1052
12 Ga0070671_100001184 3300005355 Bacteria 19515
13 Ga0070671_100045024 3300005355 Bacteria 3668
14 Ga0070671_100095679 3300005355 Bacteria 2489
15 Ga0070667_100000028 3300005367 Bacteria 180376
16 Ga0070667_100002165 3300005367 Bacteria 17301
17 Ga0070667_100008740 3300005367 Bacteria 8395
18 Ga0070667_100253676 3300005367 Bacteria 1573
19 Ga0070714_100103401 3300005435 Bacteria 2513
20 Ga0070713_100021160 3300005436 Bacteria 4997
21 Ga0070713_100126594 3300005436 Bacteria 2248
22 Ga0070713_100193113 3300005436 Bacteria 1836
23 Ga0070710_10117432 3300005437 Bacteria 1606
24 Ga0070711_100012179 3300005439 Bacteria 5368
25 Ga0070678_100002485 3300005456 Bacteria 10104
26 Ga0070681_10003612 3300005458 Bacteria 14508
27 Ga0070681_10005366 3300005458 Bacteria 12376
28 Ga0070681_10008421 3300005458 Bacteria 10101
29 Ga0070681_10025269 3300005458 Bacteria 5974
30 Ga0070681_10027388 3300005458 Bacteria 5731
31 Ga0070681_10117994 3300005458 Bacteria 2590
32 Ga0070681_10234167 3300005458 Bacteria 1751
33 Ga0070681_10434311 3300005458 Bacteria 1225
34 Ga0070699_100037340 3300005518 Bacteria 4203
35 Ga0070699_100124096 3300005518 Bacteria 2272
36 Ga0070679_100022196 3300005530 Bacteria 6203
37 Ga0070679_100054393 3300005530 Bacteria 3985
38 Ga0070679_100091087 3300005530 Bacteria 3037
39 Ga0070684_100032978 3300005535 Bacteria 4419
40 Ga0070697_100297120 3300005536 Bacteria 1388
41 Ga0068853_100173792 3300005539 Bacteria 1950
42 Ga0070686_100202903 3300005544 Bacteria 1422
43 Ga0070695_100039255 3300005545 Bacteria 2992
44 Ga0070695_100073745 3300005545 Bacteria 2241
45 Ga0070665_100000660 3300005548 Bacteria 46496
46 Ga0070665_100014441 3300005548 Bacteria 7923
47 Ga0070665_100015969 3300005548 Bacteria 7537
48 Ga0070665_100071478 3300005548 Bacteria 3476
49 Ga0070665_100073721 3300005548 Bacteria 3419
50 Ga0068855_100006446 3300005563 Bacteria 14291
51 Ga0068855_100116731 3300005563 Bacteria 3059
52 Ga0068856_100009122 3300005614 Bacteria 9644
53 Ga0068859_100000500 3300005617 Bacteria 38692
54 Ga0068859_100072369 3300005617 Bacteria 3484
55 Ga0068863_100011526 3300005841 Bacteria 8552
56 Ga0068858_100000540 3300005842 Bacteria 39342
57 Ga0068858_100000794 3300005842 Bacteria 32985
58 Ga0068858_100074578 3300005842 Bacteria 3150
59 Ga0068860_100127230 3300005843 Bacteria 2442
60 Ga0081455_10000016 3300005937 Bacteria 176679
61 Ga0081539_10000060 3300005985 Bacteria 252799
62 Ga0070716_100000366 3300006173 Bacteria 18560
63 Ga0097620_100000500 3300006931 Bacteria 38692
64 Ga0097620_100072368 3300006931 Bacteria 3484
65 Ga0099795_10018797 3300007788 Bacteria 2227
66 Ga0105250_10025707 3300009092 Bacteria 2372
67 Ga0105240_10001472 3300009093 Bacteria 40169
68 Ga0105240_10002587 3300009093 Bacteria 28971
69 Ga0105240_10014598 3300009093 Bacteria 10717
70 Ga0105240_10061322 3300009093 Bacteria 4687
71 Ga0105240_10072492 3300009093 Bacteria 4256
72 Ga0105240_10202903 3300009093 Bacteria 2323
73 Ga0105240_10343044 3300009093 Bacteria 1696
74 Ga0105240_10374495 3300009093 Bacteria 1609
75 Ga0105247_10000226 3300009101 Bacteria 53777
76 Ga0105241_10026920 3300009174 Bacteria 4280
77 Ga0105248_10010376 3300009177 Bacteria 10256
78 Ga0105237_10018118 3300009545 Bacteria 7291
79 Ga0105237_10054770 3300009545 Bacteria 3996
80 Ga0105237_10078643 3300009545 Bacteria 3288
81 Ga0105237_10258106 3300009545 Bacteria 1745
82 Ga0105238_10107275 3300009551 Bacteria 2774
83 Ga0105249_10025886 3300009553 Bacteria 5285
84 Ga0105249_10029496 3300009553 Bacteria 4955
85 Ga0105249_10181064 3300009553 Bacteria 2050
86 Ga0105239_10031182 3300010375 Bacteria 5864
87 Ga0105239_10143695 3300010375 Bacteria 2660
88 Ga0105239_10167327 3300010375 Bacteria 2458
89 Ga0157369_10050248 3300013105 Bacteria 4517
90 Ga0157369_10069720 3300013105 Bacteria 3777
91 Ga0157369_10093948 3300013105 Bacteria 3202
92 Ga0157374_10010528 3300013296 Bacteria 7958
93 Ga0157374_10044324 3300013296 Bacteria 4112
94 Ga0157378_10017851 3300013297 Bacteria 6227
95 Ga0163162_10063840 3300013306 Bacteria 3727
96 Ga0163162_10134701 3300013306 Bacteria 2581
97 Ga0157372_10497314 3300013307 Bacteria 1422
98 Ga0157375_10012200 3300013308 Bacteria 7617
99 Ga0163163_10016130 3300014325 Bacteria 6931
100 Ga0163163_10031596 3300014325 Bacteria 5111
101 Ga0163163_10087418 3300014325 Bacteria 3127
102 Ga0163163_10379672 3300014325 Bacteria 1471
103 Ga0157379_10014183 3300014968 Bacteria 6988
104 Ga0157379_10112153 3300014968 Bacteria 2450
105 Ga0157379_10253559 3300014968 Bacteria 1598
106 Ga0207696_1054541 3300025711 Bacteria 1136
107 Ga0207710_10000186 3300025900 Bacteria 60552
108 Ga0207680_10016426 3300025903 Bacteria 3885
109 Ga0207699_10011565 3300025906 Bacteria 4463
110 Ga0207699_10100592 3300025906 Bacteria 1834
111 Ga0207707_10000195 3300025912 Bacteria 64061
112 Ga0207707_10004672 3300025912 Bacteria 12026
113 Ga0207707_10012072 3300025912 Bacteria 7514
114 Ga0207707_10022015 3300025912 Bacteria 5571
115 Ga0207707_10041186 3300025912 Bacteria 4034
116 Ga0207707_10046736 3300025912 Bacteria 3771
117 Ga0207707_10077062 3300025912 Bacteria 2910
118 Ga0207695_10031228 3300025913 Bacteria 5847
119 Ga0207695_10082559 3300025913 Bacteria 3248
120 Ga0207671_10026525 3300025914 Bacteria 4340
121 Ga0207693_10000081 3300025915 Bacteria 86034
122 Ga0207663_10013944 3300025916 Bacteria 4385
123 Ga0207660_10005963 3300025917 Bacteria 7910
124 Ga0207660_10007921 3300025917 Bacteria 6873
125 Ga0207652_10020332 3300025921 Bacteria 5465
126 Ga0207694_10055159 3300025924 Bacteria 3085
127 Ga0207700_10054545 3300025928 Bacteria 3001
128 Ga0207664_10133783 3300025929 Bacteria 2090
129 Ga0207644_10002414 3300025931 Bacteria 12039
130 Ga0207644_10052760 3300025931 Bacteria 2924
131 Ga0207644_10084449 3300025931 Bacteria 2353
132 Ga0207706_10264921 3300025933 Bacteria 1500
133 Ga0207686_10014878 3300025934 Bacteria 4343
134 Ga0207704_10029119 3300025938 Bacteria 3074
135 Ga0207667_10095539 3300025949 Bacteria 3068
136 Ga0207667_10161438 3300025949 Bacteria 2305
137 Ga0207658_10000054 3300025986 Bacteria 125062
138 Ga0207677_10007995 3300026023 Bacteria 5883
139 Ga0207703_10000852 3300026035 Bacteria 29895
140 Ga0207703_10002025 3300026035 Bacteria 17894
141 Ga0207702_10115937 3300026078 Bacteria 2390
142 Ga0207641_10002306 3300026088 Bacteria 17726
143 Ga0207641_10015849 3300026088 Bacteria 6172
144 Ga0207683_10003886 3300026121 Bacteria 12957
145 Ga0268266_10000630 3300028379 Bacteria 47949
146 Ga0268266_10054895 3300028379 Bacteria 3424
147 Ga0268266_10241922 3300028379 Bacteria 1666
148 Ga0268266_10317016 3300028379 Bacteria 1458
149 Ga0268264_10005754 3300028381 Bacteria 10511
150 Ga0307515_10017113 3300028794 Bacteria 13233
151 Ga0307511_10000952 3300030521 Bacteria 30677
152 Ga0307513_10062745 3300031456 Bacteria 3926
153 Ga0307509_10000001 3300031507 Bacteria 629324
154 Ga0307509_10120244 3300031507 Bacteria 2606
155 Ga0265313_10026664 3300031595 Bacteria 3039
156 Ga0316575_10001460 3300031665 Bacteria 7630
157 Ga0316575_10002931 3300031665 Bacteria 5807
158 Ga0316579_10049322 3300031691 Bacteria 1967
159 Ga0316579_10074583 3300031691 Bacteria 1611
160 Ga0316576_10023681 3300031727 Bacteria 4280
161 Ga0316576_10035504 3300031727 Bacteria 3558
162 Ga0316578_10001832 3300031728 Bacteria 8945
163 Ga0316577_10030246 3300031733 Unclassified 3023
164 Ga0316577_10106186 3300031733 Unclassified 1575
165 Ga0316583_10002844 3300032133 Bacteria 6069
166 Ga0316583_10024785 3300032133 Bacteria 2142
167 Ga0316585_10000941 3300032137 Bacteria 7456
168 Ga0316585_10001081 3300032137 Bacteria 7082
169 Ga0316580_10006015 3300032139 Unclassified 3561
170 Ga0316593_10012439 3300032168 Unclassified 2498
171 Ga0316593_10058987 3300032168 Bacteria 1309
172 Ga0307510_10000015 3300033180 Bacteria 258937
173 Ga0307510_10005296 3300033180 Bacteria 15344
174 Ga0373955_0024782 3300035172 Bacteria 3072
175 Ga0373955_0048014 3300035172 Bacteria 2313
176 Ga0316574_0011826 3300035398 Bacteria 4972
177 Ga0373927_0028371 3300035695 Bacteria 3650
178 Ga0373933_0090416 3300035724 Bacteria 1888
179 Ga0373947_0270904 3300035725 Bacteria 1127
180 Ga0373937_0006442 3300036401 Bacteria 10130
181 Ga0316582_0007591 3300036647 Bacteria 5780
182 Ga0316582_0007846 3300036647 Bacteria 5704
183 Ga0316582_0018224 3300036647 Bacteria 4081
184 Ga0316582_0106090 3300036647 Unclassified 1865
185 Ga0316582_0229707 3300036647 Unclassified 1270
186 Ga0316584_0003671 3300036712 Bacteria 10044
187 Ga0316584_0003730 3300036712 Bacteria 9976
188 Ga0316584_0006312 3300036712 Bacteria 8027
189 Ga0316584_0024172 3300036712 Unclassified 4445
190 Ga0316584_0056628 3300036712 Unclassified 2934
191 Ga0316584_0100003 3300036712 Bacteria 2171
192 Ga0316584_0134654 3300036712 Unclassified 1845
193 Ga0395898_0004289 3300037466 Bacteria 15625
194 Ga0395898_0020854 3300037466 Bacteria 6650
195 Ga0400490_40872 3300038726 Bacteria 4057
196 Ga0400491_09476 3300038727 Bacteria 2637
197 Ga0400485_07808 3300038735 Bacteria 5848
198 Ga0400487_36429 3300039110 Unclassified 2067
199 Ga0400487_47988 3300039110 Bacteria 5250
200 Ga0436365_0546016 3300039437 Bacteria 2496
201 Ga0436365_0669871 3300039437 Bacteria 4813
202 Ga0436360_0426106 3300039438 Bacteria 2900
203 Ga0436360_1318064 3300039438 Bacteria 2004
204 Ga0436361_0539216 3300039447 Bacteria 2049
205 Ga0436361_1083951 3300039447 Bacteria 1448
206 Ga0436363_1349119 3300039450 Bacteria 4610
207 Ga0436363_1371057 3300039450 Bacteria 5573
208 Ga0436362_0315452 3300039453 Bacteria 2539
209 Ga0451577_0001378 3300042876 Bacteria 32543
210 Ga0466969_0007447 3300044656 Bacteria 5814
211 Ga0466969_0023081 3300044656 Bacteria 3208
212 Ga0466966_0000227 3300044684 Bacteria 37516
213 Ga0466961_0001167 3300044693 Bacteria 16171
214 Ga0466964_0001836 3300044706 Bacteria 7393
215 Ga0453684_0003940 3300044712 Bacteria 32543
216 Ga0453684_0007231 3300044712 Bacteria 20583
217 Ga0466971_0000177 3300044719 Bacteria 23913
218 Ga0466970_0006633 3300044765 Bacteria 5787
219 Ga0466959_0001027 3300045049 Bacteria 16661
220 Ga0466959_0002223 3300045049 Bacteria 12358
221 Ga0466959_0029099 3300045049 Bacteria 4093
222 Ga0466959_0030715 3300045049 Bacteria 3978
223 Ga0466959_0176610 3300045049 Bacteria 1496
224 Ga0495651_0105794 3300046462 Bacteria 2087
225 Ga0495580_0000167 3300046472 Bacteria 48832
226 Ga0495580_0047220 3300046472 Bacteria 3052
227 Ga0495628_0088524 3300046516 Bacteria 2399
228 Ga0495587_0138448 3300046536 Unclassified 1390
229 Ga0495634_0081006 3300046642 Bacteria 2124
230 Ga0495674_0042154 3300047319 Bacteria 4073
231 Ga0495687_027544 3300047443 Bacteria 2658
232 Ga0495687_033930 3300047443 Bacteria 2311
233 Ga0495602_0044882 3300048088 Bacteria 4005
234 Ga0496101_0034619 3300048904 Bacteria 3568
235 Ga0496102_0029944 3300048905 Bacteria 4871
236 Ga0496102_0034625 3300048905 Bacteria 4543
237 Ga0496102_0064611 3300048905 Bacteria 3352
238 Ga0496103_0029268 3300048906 Bacteria 3347
239 Ga0496104_0184574 3300048907 Bacteria 1996
240 Ga0496105_0069918 3300048908 Bacteria 2901
241 Ga0496106_0205446 3300048909 Bacteria 1568
242 Ga0496107_0035358 3300048910 Bacteria 3582
243 Ga0496108_0346023 3300048911 Bacteria 1297
244 Ga0496108_0482179 3300048911 Bacteria 1083
245 Ga0496109_0015033 3300048912 Bacteria 6736
246 Ga0496110_0024987 3300048913 Bacteria 5099
247 Ga0496112_0251442 3300048915 Bacteria 1718
248 Ga0496114_0019617 3300048917 Bacteria 5478
249 Ga0496116_0014529 3300048919 Bacteria 6281
250 Ga0496117_0000208 3300048920 Bacteria 113931
251 Ga0496118_0000005 3300048921 Bacteria 697350
252 Ga0496119_0002326 3300048922 Bacteria 20939
253 Ga0496119_0103656 3300048922 Bacteria 1593
254 Ga0496120_0000199 3300048923 Bacteria 103142
255 Ga0496121_0000903 3300048924 Bacteria 53531
256 Ga0496121_0044812 3300048924 Bacteria 3809
257 Ga0496124_0027132 3300048927 Bacteria 5147
258 Ga0496125_0002552 3300048928 Bacteria 23455
259 Ga0496125_0018491 3300048928 Bacteria 6619
260 Ga0496125_0089223 3300048928 Bacteria 2320
261 Ga0496126_0002578 3300048929 Bacteria 24191
262 Ga0496126_0055349 3300048929 Bacteria 3589
263 Ga0500583_0012749 3300053092 Bacteria 3220
264 Ga0500556_0001052 3300053104 Bacteria 14249
265 Ga0500617_064251 3300053124 Bacteria 1619
266 Ga0500658_0021200 3300053134 Bacteria 2459
267 Ga0500588_0001426 3300053146 Bacteria 4536
268 Ga0500616_0000016 3300053153 Bacteria 627087
269 Ga0500616_0012225 3300053153 Bacteria 5028
270 Ga0466962_0005390 3300061719 Bacteria 6153
271 2919494080 2919493220 Bacteria 4598500
272 2919543707 2919543075 Bacteria 4728703
273 2923529445 2923525760 Bacteria 4472324
274 Ga0316584_0054854
275 rootL2_10066149
276 Ga0065707_10083048
277 Ga0070690_100014646
278 Ga0068869_100051192
279 Ga0070666_10009329
280 Ga0070666_10016322
281 Ga0070680_100005101
282 Ga0070680_100007063
283 Ga0070680_100015164
284 Ga0070692_10254980
285 Ga0070671_100001184
286 Ga0070671_100045024
287 Ga0070671_100095679
288 Ga0070667_100000028
289 Ga0070667_100002165
290 Ga0070667_100008740
291 Ga0070667_100253676
292 Ga0070714_100103401
293 Ga0070713_100021160
294 Ga0070713_100126594
295 Ga0070713_100193113
296 Ga0070710_10117432
297 Ga0070711_100012179
298 Ga0070678_100002485
299 Ga0070681_10003612
300 Ga0070681_10005366
301 Ga0070681_10008421
302 Ga0070681_10025269
303 Ga0070681_10027388
304 Ga0070681_10117994
305 Ga0070681_10234167
306 Ga0070681_10434311
307 Ga0070699_100037340
308 Ga0070699_100124096
309 Ga0070679_100022196
310 Ga0070679_100054393
311 Ga0070679_100091087
312 Ga0070684_100032978
313 Ga0070697_100297120
314 Ga0068853_100173792
315 Ga0070686_100202903
316 Ga0070695_100039255
317 Ga0070695_100073745
318 Ga0070665_100000660
319 Ga0070665_100014441
320 Ga0070665_100015969
321 Ga0070665_100071478
322 Ga0070665_100073721
323 Ga0068855_100006446
324 Ga0068855_100116731
325 Ga0068856_100009122
326 Ga0068859_100000500
327 Ga0068859_100072369
328 Ga0068863_100011526
329 Ga0068858_100000540
330 Ga0068858_100000794
331 Ga0068858_100074578
332 Ga0068860_100127230
333 Ga0081455_10000016
334 Ga0081539_10000060
335 Ga0070716_100000366
336 Ga0097620_100000500
337 Ga0097620_100072368
338 Ga0099795_10018797
339 Ga0105250_10025707
340 Ga0105240_10001472
341 Ga0105240_10002587
342 Ga0105240_10014598
343 Ga0105240_10061322
344 Ga0105240_10072492
345 Ga0105240_10202903
346 Ga0105240_10343044
347 Ga0105240_10374495
348 Ga0105247_10000226
349 Ga0105241_10026920
350 Ga0105248_10010376
351 Ga0105237_10018118
352 Ga0105237_10054770
353 Ga0105237_10078643
354 Ga0105237_10258106
355 Ga0105238_10107275
356 Ga0105249_10025886
357 Ga0105249_10029496
358 Ga0105249_10181064
359 Ga0105239_10031182
360 Ga0105239_10143695
361 Ga0105239_10167327
362 Ga0157369_10050248
363 Ga0157369_10069720
364 Ga0157369_10093948
365 Ga0157374_10010528
366 Ga0157374_10044324
367 Ga0157378_10017851
368 Ga0163162_10063840
369 Ga0163162_10134701
370 Ga0157372_10497314
371 Ga0157375_10012200
372 Ga0163163_10016130
373 Ga0163163_10031596
374 Ga0163163_10087418
375 Ga0163163_10379672
376 Ga0157379_10014183
377 Ga0157379_10112153
378 Ga0157379_10253559
379 Ga0207696_1054541
380 Ga0207710_10000186
381 Ga0207680_10016426
382 Ga0207699_10011565
383 Ga0207699_10100592
384 Ga0207707_10000195
385 Ga0207707_10004672
386 Ga0207707_10012072
387 Ga0207707_10022015
388 Ga0207707_10041186
389 Ga0207707_10046736
390 Ga0207707_10077062
391 Ga0207695_10031228
392 Ga0207695_10082559
393 Ga0207671_10026525
394 Ga0207693_10000081
395 Ga0207663_10013944
396 Ga0207660_10005963
397 Ga0207660_10007921
398 Ga0207652_10020332
399 Ga0207694_10055159
400 Ga0207700_10054545
401 Ga0207664_10133783
402 Ga0207644_10002414
403 Ga0207644_10052760
404 Ga0207644_10084449
405 Ga0207706_10264921
406 Ga0207686_10014878
407 Ga0207704_10029119
408 Ga0207667_10095539
409 Ga0207667_10161438
410 Ga0207658_10000054
411 Ga0207677_10007995
412 Ga0207703_10000852
413 Ga0207703_10002025
414 Ga0207702_10115937
415 Ga0207641_10002306
416 Ga0207641_10015849
417 Ga0207683_10003886
418 Ga0268266_10000630
419 Ga0268266_10054895
420 Ga0268266_10241922
421 Ga0268266_10317016
422 Ga0268264_10005754
423 Ga0307515_10017113
424 Ga0307511_10000952
425 Ga0307513_10062745
426 Ga0307509_10000001
427 Ga0307509_10120244
428 Ga0265313_10026664
429 Ga0316575_10001460
430 Ga0316575_10002931
431 Ga0316579_10049322
432 Ga0316579_10074583
433 Ga0316576_10023681
434 Ga0316576_10035504
435 Ga0316578_10001832
436 Ga0316577_10030246
437 Ga0316577_10106186
438 Ga0316583_10002844
439 Ga0316583_10024785
440 Ga0316585_10000941
441 Ga0316585_10001081
442 Ga0316580_10006015
443 Ga0316593_10012439
444 Ga0316593_10058987
445 Ga0307510_10000015
446 Ga0307510_10005296
447 Ga0373955_0024782
448 Ga0373955_0048014
449 Ga0316574_0011826
450 Ga0373927_0028371
451 Ga0373933_0090416
452 Ga0373947_0270904
453 Ga0373937_0006442
454 Ga0316582_0007591
455 Ga0316582_0007846
456 Ga0316582_0018224
457 Ga0316582_0106090
458 Ga0316582_0229707
459 Ga0316584_0003671
460 Ga0316584_0003730
461 Ga0316584_0006312
462 Ga0316584_0024172
463 Ga0316584_0056628
464 Ga0316584_0100003
465 Ga0316584_0134654
466 Ga0395898_0004289
467 Ga0395898_0020854
468 Ga0400490_40872
469 Ga0400491_09476
470 Ga0400485_07808
471 Ga0400487_36429
472 Ga0400487_47988
473 Ga0436365_0546016
474 Ga0436365_0669871
475 Ga0436360_0426106
476 Ga0436360_1318064
477 Ga0436361_0539216
478 Ga0436361_1083951
479 Ga0436363_1349119
480 Ga0436363_1371057
481 Ga0436362_0315452
482 Ga0451577_0001378
483 Ga0466969_0007447
484 Ga0466969_0023081
485 Ga0466966_0000227
486 Ga0466961_0001167
487 Ga0466964_0001836
488 Ga0453684_0003940
489 Ga0453684_0007231
490 Ga0466971_0000177
491 Ga0466970_0006633
492 Ga0466959_0001027
493 Ga0466959_0002223
494 Ga0466959_0029099
495 Ga0466959_0030715
496 Ga0466959_0176610
497 Ga0495651_0105794
498 Ga0495580_0000167
499 Ga0495580_0047220
500 Ga0495628_0088524
501 Ga0495587_0138448
502 Ga0495634_0081006
503 Ga0495674_0042154
504 Ga0495687_027544
505 Ga0495687_033930
506 Ga0495602_0044882
507 Ga0496101_0034619
508 Ga0496102_0029944
509 Ga0496102_0034625
510 Ga0496102_0064611
511 Ga0496103_0029268
512 Ga0496104_0184574
513 Ga0496105_0069918
514 Ga0496106_0205446
515 Ga0496107_0035358
516 Ga0496108_0346023
517 Ga0496108_0482179
518 Ga0496109_0015033
519 Ga0496110_0024987
520 Ga0496112_0251442
521 Ga0496114_0019617
522 Ga0496116_0014529
523 Ga0496117_0000208
524 Ga0496118_0000005
525 Ga0496119_0002326
526 Ga0496119_0103656
527 Ga0496120_0000199
528 Ga0496121_0000903
529 Ga0496121_0044812
530 Ga0496124_0027132
531 Ga0496125_0002552
532 Ga0496125_0018491
533 Ga0496125_0089223
534 Ga0496126_0002578
535 Ga0496126_0055349
536 Ga0500583_0012749
537 Ga0500556_0001052
538 Ga0500617_064251
539 Ga0500658_0021200
540 Ga0500588_0001426
541 Ga0500616_0000016
542 Ga0500616_0012225
543 Ga0466962_0005390
544 2919494080
545 2919543707
546 2923529445

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

120

316

0.92

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

22

344

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nez-assembly1.cif.gz_B structure of topotecan-bound abcg2 0.7736 140 330
8i39-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 with aba 0.7678 139 330
6hbu-assembly1.cif.gz_A cryo-em structure of the abcg2 e211q mutant bound to atp and magnesium 0.7544 142 330
8wd6-assembly1.cif.gz_A cryo-em structure of the abcg25 0.7429 141 330
8bi0-assembly1.cif.gz_A abcg2 turnover-2 state with tariquidar bound 0.7402 140 329
ID Description Score Start End Superfamily
af_E7F3N0_225_379_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.7059 47 95 3.40.190.80
af_Q2G0V0_26_276_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7054 49 96 3.40.190.10
4lubB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7014 49 95 3.40.190.10
4ef1A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6981 49 96 3.40.190.10
5uh0B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6937 49 96 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A661ZEU8-F1-model_v4 Transport permease protein 0.9484 141 331 GO:0005886
GO:0140359
AF-A0A642C7H6-F1-model_v4 ABC transporter permease 0.9474 136 333 GO:0043190
GO:0140359
AF-A0A3M1WU55-F1-model_v4 Transport permease protein 0.946 139 332 GO:0016810
GO:0043190
GO:0140359
AF-A0A3D0SPF0-F1-model_v4 ABC transporter permease 0.9458 177 333 GO:0043190
GO:0140359
AF-A0A5E4KA59-F1-model_v4 ABC-2 type transporter 0.9448 217 330 GO:0043190
GO:0140359

Map