F377372

General Info

Members Datasets Scaffolds Average Seq Length
271 179 246 253

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10064899|rootH2_100648997
Length 292
Sequence LFGLQKTLSHQNTPLAHFSYNISDFGYRPGTAFTELCHMENKTIKRLALVTGANQGVGLEVVKKLVAANHTVLLGSRDLAKGEAAAKQAGDGAIAIQIDVTDPNSIDAAAARIAGEYGYLDLLVNNAAISNTRKGDLSLGEYAKISKASNISMDEVRSIWETNVFGVLAVYQAMLPLLSKSQDARIVNVSSGIGSLTLNTDPNYPYRAMYSPGYAASKTALNGITVAMMVELEKTTIKVNLVSPGFTSTALNGFEGTESIEDGSREVVRVALFAPEEPSGTFTRWENENIPW

Samples

Sample ID Description Type Environment
1 2512875024 Mesorhizobium loti R88b Isolate Nodule
2 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
3 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
4 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
5 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
6 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
7 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
8 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
9 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
10 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
11 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
12 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
13 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
14 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
15 2928153084 Leifsonia sp. 563 Isolate Unclassified
16 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
17 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
18 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
19 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
20 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
21 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
22 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
26 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
27 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
28 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
29 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
30 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
33 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
34 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
35 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
36 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
77 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
78 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
172 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
173 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
174 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
175 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
176 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
177 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
179 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.3
Metatranscriptomes 1.48
Isolates 9.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.33
Nodule 4.06
Rhizoplane 0.74
Rhizosphere 65.68
Stem 0
Stem Tuber 0.37
Unclassified 18.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000604 3300000546 Bacteria 6130
2 JGI24740J21852_10041344 3300001979 Bacteria 1390
3 JGI24739J22299_10062825 3300001989 Bacteria 1170
4 JGI24737J22298_10000785 3300001990 Bacteria 11230
5 JGI24735J21928_10039189 3300002067 Bacteria 1385
6 JGI25162J39368_1000012 3300002737 Bacteria 373191
7 JGI25162J39368_1008418 3300002737 Bacteria 1482
8 JGI25164J39214_1001049 3300002772 Bacteria 8283
9 JGI25165J46597_1000014 3300003214 Bacteria 390383
10 rootH2_10030191 3300003320 Bacteria 2311
11 rootH2_10064899 3300003320 Bacteria 12073
12 rootL2_10049714 3300003322 Bacteria 8205
13 rootH1_10083261 3300003323 Bacteria 4720
14 Ga0006562J51391_1093377 3300003578 Bacteria 1396
15 Ga0055539_1000027 3300003752 Bacteria 258020
16 Ga0055533_1000020 3300003756 Bacteria 353998
17 Ga0055525_1000151 3300003759 Bacteria 94158
18 Ga0070658_10219478 3300005327 Bacteria 1607
19 Ga0070660_100047806 3300005339 Bacteria 3284
20 Ga0070661_100071730 3300005344 Bacteria 2549
21 Ga0070661_100094856 3300005344 Bacteria 2212
22 Ga0070673_100709555 3300005364 Bacteria 924
23 Ga0070711_100182843 3300005439 Bacteria 1606
24 Ga0070711_100365889 3300005439 Bacteria 1162
25 Ga0070707_100278535 3300005468 Bacteria 1626
26 Ga0068853_100001100 3300005539 Bacteria 19147
27 Ga0068853_100037286 3300005539 Bacteria 4136
28 Ga0068853_100098969 3300005539 Bacteria 2576
29 Ga0070696_100545903 3300005546 Bacteria 928
30 Ga0070665_100000221 3300005548 Bacteria 95402
31 Ga0070665_100367862 3300005548 Bacteria 1444
32 Ga0068855_100279805 3300005563 Bacteria 1853
33 Ga0068857_100045662 3300005577 Bacteria 3887
34 Ga0068856_100154789 3300005614 Bacteria 2302
35 Ga0068856_100211028 3300005614 Bacteria 1957
36 Ga0068852_100010276 3300005616 Bacteria 6983
37 Ga0068852_100023028 3300005616 Bacteria 5006
38 Ga0068851_10066267 3300005834 Bacteria 1860
39 Ga0070715_10109396 3300006163 Bacteria 1301
40 Ga0097621_100863439 3300006237 Bacteria 841
41 Ga0068871_100044931 3300006358 Bacteria 3553
42 Ga0068871_100333564 3300006358 Bacteria 1338
43 Ga0075433_10281286 3300006852 Bacteria 1474
44 Ga0075436_100312118 3300006914 Bacteria 1129
45 Ga0105244_10045167 3300009036 Bacteria 2267
46 Ga0105240_10000015 3300009093 Bacteria 457886
47 Ga0105240_10084061 3300009093 Bacteria 3903
48 Ga0105240_10437080 3300009093 Bacteria 1467
49 Ga0105241_10029194 3300009174 Bacteria 4112
50 Ga0105241_10304654 3300009174 Bacteria 1368
51 Ga0105242_10156971 3300009176 Bacteria 1988
52 Ga0105248_10039849 3300009177 Bacteria 5265
53 Ga0105248_10554677 3300009177 Bacteria 1296
54 Ga0105237_10000459 3300009545 Bacteria 57762
55 Ga0105237_10029519 3300009545 Bacteria 5574
56 Ga0105237_10172248 3300009545 Bacteria 2165
57 Ga0105237_10283954 3300009545 Bacteria 1658
58 Ga0105237_10796829 3300009545 Bacteria 952
59 Ga0105238_10091384 3300009551 Bacteria 3031
60 Ga0105238_10106977 3300009551 Bacteria 2778
61 Ga0105238_10548349 3300009551 Bacteria 1160
62 Ga0105239_10002667 3300010375 Bacteria 22492
63 Ga0105239_10092598 3300010375 Bacteria 3337
64 Ga0105239_10513840 3300010375 Bacteria 1362
65 Ga0105239_10644198 3300010375 Bacteria 1210
66 Ga0157373_10032563 3300013100 Bacteria 3752
67 Ga0157373_10280488 3300013100 Bacteria 1181
68 Ga0157371_10022122 3300013102 Bacteria 4664
69 Ga0157370_10159218 3300013104 Bacteria 2101
70 Ga0157370_10587766 3300013104 Bacteria 1020
71 Ga0157369_10168471 3300013105 Bacteria 2309
72 Ga0157374_10082494 3300013296 Bacteria 3053
73 Ga0157374_10316795 3300013296 Bacteria 1545
74 Ga0157378_10000968 3300013297 Bacteria 26320
75 Ga0157372_10135969 3300013307 Bacteria 2830
76 Ga0157372_10742825 3300013307 Bacteria 1141
77 Ga0157372_10785289 3300013307 Bacteria 1107
78 Ga0157372_10895288 3300013307 Bacteria 1030
79 Ga0163163_10009719 3300014325 Bacteria 8609
80 Ga0157376_10245835 3300014969 Bacteria 1669
81 Ga0182005_1000316 3300015265 Bacteria 29083
82 Ga0213876_10025038 3300021384 Bacteria 3150
83 Ga0213876_10140668 3300021384 Bacteria 1284
84 Ga0213875_10000008 3300021388 Bacteria 533344
85 Ga0213875_10006897 3300021388 Bacteria 5920
86 Ga0213875_10045710 3300021388 Bacteria 2055
87 Ga0213875_10129821 3300021388 Bacteria 1178
88 Ga0213875_10139206 3300021388 Bacteria 1135
89 Ga0224572_1025898 3300024225 Bacteria 1125
90 Ga0228598_1004398 3300024227 Bacteria 2983
91 Ga0209436_104226 3300025208 Bacteria 3591
92 Ga0209566_100043 3300025225 Bacteria 266609
93 Ga0209674_100001 3300025226 Bacteria 4013750
94 Ga0209563_100001 3300025230 Bacteria 4013775
95 Ga0209563_100210 3300025230 Bacteria 30709
96 Ga0207427_100039 3300025231 Bacteria 291576
97 Ga0209437_100041 3300025233 Bacteria 444465
98 Ga0209437_100441 3300025233 Bacteria 34752
99 Ga0209646_1002268 3300025246 Bacteria 4400
100 Ga0209677_100001 3300025253 Bacteria 4013787
101 Ga0209677_100519 3300025253 Bacteria 21478
102 Ga0209129_1016761 3300025258 Bacteria 1459
103 Ga0209233_1000014 3300025261 Bacteria 996641
104 Ga0207426_1006142 3300025302 Bacteria 5289
105 Ga0207426_1017760 3300025302 Bacteria 2522
106 Ga0207647_10157452 3300025904 Bacteria 1326
107 Ga0207705_10076210 3300025909 Bacteria 2438
108 Ga0207705_10308616 3300025909 Bacteria 1214
109 Ga0207705_10400287 3300025909 Bacteria 1062
110 Ga0207684_10139385 3300025910 Bacteria 2084
111 Ga0207654_10022045 3300025911 Bacteria 3393
112 Ga0207695_10025099 3300025913 Bacteria 6685
113 Ga0207671_10000855 3300025914 Bacteria 38600
114 Ga0207671_10001225 3300025914 Bacteria 30382
115 Ga0207671_10024027 3300025914 Bacteria 4588
116 Ga0207657_10004198 3300025919 Bacteria 15258
117 Ga0207649_10050403 3300025920 Bacteria 2575
118 Ga0207694_10016941 3300025924 Bacteria 5505
119 Ga0207694_10023650 3300025924 Bacteria 4665
120 Ga0207694_10507214 3300025924 Bacteria 1010
121 Ga0207694_10547202 3300025924 Bacteria 971
122 Ga0207706_10289289 3300025933 Bacteria 1429
123 Ga0207686_10038422 3300025934 Bacteria 2896
124 Ga0207704_10419898 3300025938 Bacteria 1060
125 Ga0207665_10082877 3300025939 Bacteria 2211
126 Ga0207689_10097381 3300025942 Bacteria 2416
127 Ga0207679_10050456 3300025945 Bacteria 3041
128 Ga0207667_10075756 3300025949 Bacteria 3493
129 Ga0207640_10037032 3300025981 Bacteria 3067
130 Ga0207678_10083326 3300026067 Bacteria 2735
131 Ga0207702_10284509 3300026078 Bacteria 1564
132 Ga0207641_10460955 3300026088 Bacteria 1230
133 Ga0207648_10185134 3300026089 Bacteria 1844
134 Ga0207674_10051152 3300026116 Bacteria 4217
135 Ga0207674_10461485 3300026116 Bacteria 1228
136 Ga0207675_100175627 3300026118 Bacteria 2049
137 Ga0207698_10024307 3300026142 Bacteria 4250
138 Ga0207698_10391524 3300026142 Bacteria 1325
139 Ga0268266_10000005 3300028379 Bacteria 1448194
140 Ga0268266_10000167 3300028379 Bacteria 120012
141 Ga0265334_10045963 3300028573 Bacteria 1689
142 Ga0265338_10004783 3300028800 Bacteria 18097
143 Ga0265762_1004057 3300030760 Bacteria 2623
144 Ga0265762_1004707 3300030760 Bacteria 2441
145 Ga0265770_1010271 3300030878 Bacteria 1356
146 Ga0265328_10034389 3300031239 Bacteria 1877
147 Ga0265325_10000268 3300031241 Bacteria 37034
148 Ga0265325_10006796 3300031241 Bacteria 6915
149 Ga0265340_10007182 3300031247 Bacteria 6068
150 Ga0265340_10140648 3300031247 Bacteria 1104
151 Ga0265339_10022892 3300031249 Bacteria 3614
152 Ga0265339_10043781 3300031249 Bacteria 2472
153 Ga0265331_10031170 3300031250 Bacteria 2651
154 Ga0265331_10039302 3300031250 Bacteria 2308
155 Ga0265331_10132585 3300031250 Bacteria 1136
156 Ga0265327_10033313 3300031251 Bacteria 2872
157 Ga0265316_10015582 3300031344 Bacteria 6637
158 Ga0265316_10061158 3300031344 Bacteria 2925
159 Ga0265313_10001117 3300031595 Bacteria 25638
160 Ga0265313_10021075 3300031595 Bacteria 3574
161 Ga0265313_10063696 3300031595 Bacteria 1718
162 Ga0307508_10036783 3300031616 Bacteria 4407
163 Ga0265314_10102925 3300031711 Bacteria 1831
164 Ga0265342_10028628 3300031712 Bacteria 3467
165 Ga0307516_10058413 3300031730 Bacteria 3755
166 Ga0307413_10003703 3300031824 Bacteria 6499
167 Ga0307414_10002617 3300032004 Bacteria 9467
168 Ga0307414_10187302 3300032004 Unclassified 1671
169 Ga0373949_0055633 3300035090 Bacteria 1007
170 Ga0395899_0001928 3300037312 Bacteria 17090
171 Ga0395899_0017387 3300037312 Bacteria 5477
172 Ga0395900_0040969 3300037418 Bacteria 4775
173 Ga0395900_0048603 3300037418 Bacteria 4370
174 Ga0395898_0388323 3300037466 Bacteria 1331
175 Ga0395898_0816366 3300037466 Bacteria 872
176 Ga0436364_0035432 3300037853 Bacteria 2276
177 Ga0436364_0097893 3300037853 Bacteria 2616
178 Ga0436364_0189076 3300037853 Bacteria 2350
179 Ga0436364_0231560 3300037853 Bacteria 1341
180 Ga0436364_0392948 3300037853 Bacteria 5997
181 Ga0436364_0548200 3300037853 Bacteria 2140
182 Ga0436364_0687495 3300037853 Bacteria 9049
183 Ga0436364_1273799 3300037853 Bacteria 3578
184 Ga0436364_1415525 3300037853 Bacteria 425173
185 Ga0436364_1484144 3300037853 Bacteria 2663
186 Ga0395901_0377053 3300038443 Bacteria 1460
187 Ga0436365_1028915 3300039437 Bacteria 6900
188 Ga0436365_1850524 3300039437 Bacteria 2155
189 Ga0451577_0394311 3300042876 Bacteria 1256
190 Ga0466972_0000199 3300044658 Bacteria 43983
191 Ga0453684_0078912 3300044712 Bacteria 4117
192 Ga0466957_0015034 3300044842 Bacteria 4515
193 Ga0495592_0140481 3300046454 Bacteria 1680
194 Ga0495637_0023134 3300046520 Bacteria 2828
195 Ga0495609_0013791 3300046538 Plasmid 3810
196 Ga0495624_0296333 3300046690 Bacteria 975
197 Ga0495686_0000040 3300047472 Bacteria 301210
198 Ga0495686_0000593 3300047472 Bacteria 50448
199 Ga0495686_0018087 3300047472 Bacteria 4736
200 Ga0496106_0000591 3300048909 Bacteria 25938
201 Ga0496114_0486527 3300048917 Bacteria 1092
202 Ga0496117_0015237 3300048920 Bacteria 6571
203 Ga0496117_0088075 3300048920 Bacteria 2010
204 Ga0496118_0002064 3300048921 Bacteria 28295
205 Ga0496118_0066580 3300048921 Bacteria 2629
206 Ga0496119_0003296 3300048922 Bacteria 16865
207 Ga0496119_0003928 3300048922 Bacteria 15074
208 Ga0496119_0105625 3300048922 Bacteria 1573
209 Ga0496120_0000503 3300048923 Bacteria 61033
210 Ga0496120_0000893 3300048923 Bacteria 41950
211 Ga0496120_0008407 3300048923 Bacteria 7493
212 Ga0496121_0008898 3300048924 Bacteria 11662
213 Ga0496121_0052051 3300048924 Bacteria 3443
214 Ga0496124_0000190 3300048927 Bacteria 121581
215 Ga0496126_0000164 3300048929 Bacteria 152791
216 Ga0496126_0001497 3300048929 Bacteria 36200
217 Ga0501033_0060365 3300049570 Bacteria 2798
218 Ga0501034_0006561 3300049571 Bacteria 12496
219 Ga0501034_0052331 3300049571 Bacteria 4114
220 Ga0501034_0073207 3300049571 Bacteria 3435
221 Ga0501038_0178622 3300049574 Bacteria 1714
222 Ga0501043_0284851 3300049579 Bacteria 1266
223 Ga0501047_0379837 3300049581 Bacteria 1247
224 Ga0501048_0285908 3300049582 Bacteria 1173
225 Ga0501069_0267679 3300049585 Bacteria 998
226 Ga0501070_0000090 3300049586 Bacteria 77327
227 Ga0501070_0004968 3300049586 Bacteria 11347
228 Ga0501070_0369108 3300049586 Bacteria 1163
229 Ga0501071_0260330 3300049587 Bacteria 1310
230 Ga0501073_0001442 3300049589 Bacteria 17577
231 Ga0501073_0212993 3300049589 Bacteria 1335
232 Ga0501074_0000095 3300049590 Bacteria 42376
233 Ga0501074_0028271 3300049590 Bacteria 4064
234 Ga0501080_0000250 3300049742 Bacteria 40604
235 Ga0501035_0030407 3300049822 Bacteria 4923
236 Ga0501044_0004767 3300049823 Bacteria 15173
237 Ga0501044_0019840 3300049823 Bacteria 7180
238 Ga0501044_0163313 3300049823 Bacteria 2202
239 Ga0500635_0000006 3300053080 Bacteria 187108
240 Ga0500572_000624 3300053111 Bacteria 11834
241 Ga0500595_005727 3300053119 Bacteria 5380
242 Ga0500618_008034 3300053125 Bacteria 2972
243 Ga0500559_0000007 3300053136 Bacteria 226236
244 Ga0500590_000296 3300053148 Bacteria 15848
245 Ga0500596_002385 3300053735 Bacteria 3704
246 Ga0466962_0134340 3300061719 Bacteria 1197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0052331 Ga0501034_0052331_2745_3506 219
2 3300026067 Ga0207678_10083326 Ga0207678_100833263 222
3 3300046690 Ga0495624_0296333 Ga0495624_0296333_21_689 222
4 3300046538 Ga0495609_0013791 Ga0495609_0013791_857_1678 224
5 3300049570 Ga0501033_0060365 Ga0501033_0060365_492_1178 227
6 3300049571 Ga0501034_0006561 Ga0501034_0006561_11103_11789 227
7 3300049822 Ga0501035_0030407 Ga0501035_0030407_3557_4243 227
8 3300003322 rootL2_10049714 rootL2_100497142 234
9 3300037853 Ga0436364_0231560 Ga0436364_0231560_38_748 236
10 3300049586 Ga0501070_0000090 Ga0501070_0000090_53953_54711 236
11 3300025246 Ga0209646_1002268 Ga0209646_10022684 241
12 3300006914 Ga0075436_100312118 Ga0075436_1003121182 244
13 iso_pu_bacteria 2524023129 2524189813 246
14 iso_pu_bacteria 2821136567 2821139533 246
15 iso_pu_bacteria 2904467357 2904471834 246
16 3300005339 Ga0070660_100047806 Ga0070660_1000478064 247
17 3300005344 Ga0070661_100071730 Ga0070661_1000717303 247
18 3300005616 Ga0068852_100010276 Ga0068852_1000102768 247
19 3300005834 Ga0068851_10066267 Ga0068851_100662673 247
20 3300025909 Ga0207705_10308616 Ga0207705_103086162 247
21 3300025933 Ga0207706_10289289 Ga0207706_102892892 247
22 3300025945 Ga0207679_10050456 Ga0207679_100504563 247
23 3300026116 Ga0207674_10461485 Ga0207674_104614851 247
24 3300026142 Ga0207698_10391524 Ga0207698_103915242 247
25 3300037418 Ga0395900_0040969 Ga0395900_0040969_1499_2269 247
26 3300037466 Ga0395898_0388323 Ga0395898_0388323_24_794 247
27 iso_pu_bacteria 2512875024 2512961160 247
28 iso_pu_bacteria 2821136567 2821142945 247
29 iso_pu_bacteria 2867346516 2867349957 247
30 iso_pu_bacteria 2868088558 2868089132 247
31 iso_pu_bacteria 2884763398 2884764067 247
32 iso_pu_bacteria 2904467357 2904470674 247
33 iso_pu_bacteria 2928153084 2928155483 247
34 iso_pu_bacteria 8056579771 8056582586 247
35 iso_pu_bacteria 8056579771 8056583457 247
36 iso_pu_bacteria 2888350351 2888354247 248
37 iso_pu_bacteria 2889010040 2889015959 248
38 iso_pu_bacteria 2889016732 2889018988 248
39 iso_pu_bacteria 2922130491 2922132854 248
40 iso_pu_bacteria 2958100919 2958106536 248
41 iso_pu_bacteria 2958172287 2958177406 248
42 iso_pu_bacteria 2965119406 2965125648 248
43 iso_pu_bacteria 2979710463 2979713399 248
44 iso_pu_bacteria 2979742915 2979751272 248
45 iso_pu_bacteria 2987652177 2987657566 248
46 3300013100 Ga0157373_10032563 Ga0157373_100325632 249
47 iso_pu_bacteria 2773857762 2774393240 249
48 3300025302 Ga0207426_1006142 Ga0207426_10061425 250
49 3300031824 Ga0307413_10003703 Ga0307413_100037032 250
50 3300032004 Ga0307414_10002617 Ga0307414_100026175 250
51 3300032004 Ga0307414_10187302 Ga0307414_101873022 250
52 3300046520 Ga0495637_0023134 Ga0495637_0023134_1072_1824 250
53 3300048924 Ga0496121_0052051 Ga0496121_0052051_1547_2305 250
54 iso_pu_bacteria 2818991442 2819575987 250
55 3300001979 JGI24740J21852_10041344 JGI24740J21852_100413441 251
56 3300001989 JGI24739J22299_10062825 JGI24739J22299_100628251 251
57 3300001990 JGI24737J22298_10000785 JGI24737J22298_100007852 251
58 3300002067 JGI24735J21928_10039189 JGI24735J21928_100391891 251
59 3300002737 JGI25162J39368_1008418 JGI25162J39368_10084182 251
60 3300002772 JGI25164J39214_1001049 JGI25164J39214_10010493 251
61 3300003214 JGI25165J46597_1000014 JGI25165J46597_100001468 251
62 3300003320 rootH2_10030191 rootH2_100301912 251
63 3300003578 Ga0006562J51391_1093377 Ga0006562J51391_10933771 251
64 3300003752 Ga0055539_1000027 Ga0055539_1000027198 251
65 3300003756 Ga0055533_1000020 Ga0055533_1000020198 251
66 3300003759 Ga0055525_1000151 Ga0055525_100015166 251
67 3300005327 Ga0070658_10219478 Ga0070658_102194782 251
68 3300005344 Ga0070661_100094856 Ga0070661_1000948562 251
69 3300005364 Ga0070673_100709555 Ga0070673_1007095551 251
70 3300005439 Ga0070711_100182843 Ga0070711_1001828432 251
71 3300005439 Ga0070711_100365889 Ga0070711_1003658892 251
72 3300005468 Ga0070707_100278535 Ga0070707_1002785352 251
73 3300005548 Ga0070665_100000221 Ga0070665_10000022126 251
74 3300005548 Ga0070665_100367862 Ga0070665_1003678622 251
75 3300005577 Ga0068857_100045662 Ga0068857_1000456624 251
76 3300005614 Ga0068856_100211028 Ga0068856_1002110282 251
77 3300006163 Ga0070715_10109396 Ga0070715_101093962 251
78 3300006358 Ga0068871_100044931 Ga0068871_1000449313 251
79 3300006852 Ga0075433_10281286 Ga0075433_102812862 251
80 3300009036 Ga0105244_10045167 Ga0105244_100451673 251
81 3300009093 Ga0105240_10437080 Ga0105240_104370802 251
82 3300009176 Ga0105242_10156971 Ga0105242_101569712 251
83 3300009177 Ga0105248_10554677 Ga0105248_105546772 251
84 3300009545 Ga0105237_10000459 Ga0105237_1000045956 251
85 3300009551 Ga0105238_10091384 Ga0105238_100913842 251
86 3300009551 Ga0105238_10548349 Ga0105238_105483492 251
87 3300010375 Ga0105239_10002667 Ga0105239_100026672 251
88 3300010375 Ga0105239_10513840 Ga0105239_105138402 251
89 3300010375 Ga0105239_10644198 Ga0105239_106441982 251
90 3300013104 Ga0157370_10159218 Ga0157370_101592184 251
91 3300013105 Ga0157369_10168471 Ga0157369_101684712 251
92 3300013296 Ga0157374_10082494 Ga0157374_100824942 251
93 3300013296 Ga0157374_10316795 Ga0157374_103167952 251
94 3300013307 Ga0157372_10742825 Ga0157372_107428251 251
95 3300013307 Ga0157372_10785289 Ga0157372_107852892 251
96 3300014969 Ga0157376_10245835 Ga0157376_102458352 251
97 3300021388 Ga0213875_10000008 Ga0213875_10000008359 251
98 3300021388 Ga0213875_10129821 Ga0213875_101298211 251
99 3300021388 Ga0213875_10139206 Ga0213875_101392062 251
100 3300024225 Ga0224572_1025898 Ga0224572_10258982 251
101 3300024227 Ga0228598_1004398 Ga0228598_10043982 251
102 3300025208 Ga0209436_104226 Ga0209436_1042263 251
103 3300025225 Ga0209566_100043 Ga0209566_100043109 251
104 3300025226 Ga0209674_100001 Ga0209674_1000013701 251
105 3300025230 Ga0209563_100001 Ga0209563_1000013701 251
106 3300025230 Ga0209563_100210 Ga0209563_1002102 251
107 3300025231 Ga0207427_100039 Ga0207427_10003942 251
108 3300025233 Ga0209437_100441 Ga0209437_1004419 251
109 3300025253 Ga0209677_100001 Ga0209677_1000013701 251
110 3300025253 Ga0209677_100519 Ga0209677_1005193 251
111 3300025258 Ga0209129_1016761 Ga0209129_10167611 251
112 3300025261 Ga0209233_1000014 Ga0209233_1000014476 251
113 3300025302 Ga0207426_1017760 Ga0207426_10177602 251
114 3300025904 Ga0207647_10157452 Ga0207647_101574522 251
115 3300025909 Ga0207705_10076210 Ga0207705_100762102 251
116 3300025909 Ga0207705_10400287 Ga0207705_104002872 251
117 3300025910 Ga0207684_10139385 Ga0207684_101393852 251
118 3300025914 Ga0207671_10001225 Ga0207671_100012255 251
119 3300025920 Ga0207649_10050403 Ga0207649_100504033 251
120 3300025924 Ga0207694_10016941 Ga0207694_100169415 251
121 3300025924 Ga0207694_10507214 Ga0207694_105072142 251
122 3300025924 Ga0207694_10547202 Ga0207694_105472021 251
123 3300025934 Ga0207686_10038422 Ga0207686_100384222 251
124 3300025938 Ga0207704_10419898 Ga0207704_104198982 251
125 3300025939 Ga0207665_10082877 Ga0207665_100828773 251
126 3300025942 Ga0207689_10097381 Ga0207689_100973812 251
127 3300026088 Ga0207641_10460955 Ga0207641_104609552 251
128 3300026089 Ga0207648_10185134 Ga0207648_101851342 251
129 3300026116 Ga0207674_10051152 Ga0207674_100511523 251
130 3300026118 Ga0207675_100175627 Ga0207675_1001756272 251
131 3300028379 Ga0268266_10000005 Ga0268266_1000000526 251
132 3300028379 Ga0268266_10000167 Ga0268266_1000016759 251
133 3300028573 Ga0265334_10045963 Ga0265334_100459631 251
134 3300031239 Ga0265328_10034389 Ga0265328_100343892 251
135 3300031241 Ga0265325_10000268 Ga0265325_100002687 251
136 3300031241 Ga0265325_10006796 Ga0265325_100067964 251
137 3300031247 Ga0265340_10007182 Ga0265340_100071823 251
138 3300031249 Ga0265339_10022892 Ga0265339_100228924 251
139 3300031249 Ga0265339_10043781 Ga0265339_100437812 251
140 3300031250 Ga0265331_10031170 Ga0265331_100311704 251
141 3300031250 Ga0265331_10039302 Ga0265331_100393022 251
142 3300031250 Ga0265331_10132585 Ga0265331_101325851 251
143 3300031344 Ga0265316_10015582 Ga0265316_100155823 251
144 3300031344 Ga0265316_10061158 Ga0265316_100611582 251
145 3300031595 Ga0265313_10001117 Ga0265313_1000111715 251
146 3300031595 Ga0265313_10021075 Ga0265313_100210754 251
147 3300031595 Ga0265313_10063696 Ga0265313_100636962 251
148 3300031616 Ga0307508_10036783 Ga0307508_100367832 251
149 3300031711 Ga0265314_10102925 Ga0265314_101029253 251
150 3300031712 Ga0265342_10028628 Ga0265342_100286283 251
151 3300031730 Ga0307516_10058413 Ga0307516_100584136 251
152 3300037312 Ga0395899_0001928 Ga0395899_0001928_279_1037 251
153 3300037418 Ga0395900_0048603 Ga0395900_0048603_1394_2152 251
154 3300037853 Ga0436364_0097893 Ga0436364_0097893_67_822 251
155 3300037853 Ga0436364_0189076 Ga0436364_0189076_187_942 251
156 3300037853 Ga0436364_0548200 Ga0436364_0548200_363_1118 251
157 3300037853 Ga0436364_1273799 Ga0436364_1273799_2152_2907 251
158 3300037853 Ga0436364_1415525 Ga0436364_1415525_6390_7145 251
159 3300037853 Ga0436364_1484144 Ga0436364_1484144_1567_2322 251
160 3300039437 Ga0436365_1850524 Ga0436365_1850524_1171_1926 251
161 3300042876 Ga0451577_0394311 Ga0451577_0394311_190_945 251
162 3300044712 Ga0453684_0078912 Ga0453684_0078912_1126_1881 251
163 3300047472 Ga0495686_0000040 Ga0495686_0000040_267580_268344 251
164 3300048909 Ga0496106_0000591 Ga0496106_0000591_11175_11930 251
165 3300048917 Ga0496114_0486527 Ga0496114_0486527_181_936 251
166 3300048920 Ga0496117_0015237 Ga0496117_0015237_4352_5110 251
167 3300048921 Ga0496118_0066580 Ga0496118_0066580_1776_2534 251
168 3300048922 Ga0496119_0003296 Ga0496119_0003296_11432_12193 251
169 3300048922 Ga0496119_0003928 Ga0496119_0003928_10277_11035 251
170 3300048923 Ga0496120_0000503 Ga0496120_0000503_21256_22014 251
171 3300048923 Ga0496120_0000893 Ga0496120_0000893_38809_39570 251
172 3300048923 Ga0496120_0008407 Ga0496120_0008407_6616_7374 251
173 3300049585 Ga0501069_0267679 Ga0501069_0267679_39_794 251
174 3300049586 Ga0501070_0004968 Ga0501070_0004968_4315_5070 251
175 3300049587 Ga0501071_0260330 Ga0501071_0260330_544_1299 251
176 3300049589 Ga0501073_0001442 Ga0501073_0001442_11210_11965 251
177 3300049590 Ga0501074_0000095 Ga0501074_0000095_35619_36374 251
178 3300049742 Ga0501080_0000250 Ga0501080_0000250_4231_4986 251
179 3300049823 Ga0501044_0004767 Ga0501044_0004767_121_879 251
180 3300049823 Ga0501044_0019840 Ga0501044_0019840_47_802 251
181 3300053080 Ga0500635_0000006 Ga0500635_0000006_19661_20419 251
182 3300053119 Ga0500595_005727 Ga0500595_005727_1300_2058 251
183 3300053136 Ga0500559_0000007 Ga0500559_0000007_191751_192509 251
184 3300061719 Ga0466962_0134340 Ga0466962_0134340_89_856 251
185 3300003323 rootH1_10083261 rootH1_100832613 252
186 3300005539 Ga0068853_100037286 Ga0068853_1000372862 252
187 3300005546 Ga0070696_100545903 Ga0070696_1005459031 252
188 3300005563 Ga0068855_100279805 Ga0068855_1002798052 252
189 3300005614 Ga0068856_100154789 Ga0068856_1001547893 252
190 3300005616 Ga0068852_100023028 Ga0068852_1000230285 252
191 3300006237 Ga0097621_100863439 Ga0097621_1008634391 252
192 3300006358 Ga0068871_100333564 Ga0068871_1003335642 252
193 3300009545 Ga0105237_10283954 Ga0105237_102839542 252
194 3300009545 Ga0105237_10796829 Ga0105237_107968291 252
195 3300013102 Ga0157371_10022122 Ga0157371_100221223 252
196 3300013297 Ga0157378_10000968 Ga0157378_1000096810 252
197 3300013307 Ga0157372_10135969 Ga0157372_101359694 252
198 3300021384 Ga0213876_10025038 Ga0213876_100250382 252
199 3300021384 Ga0213876_10140668 Ga0213876_101406682 252
200 3300021388 Ga0213875_10045710 Ga0213875_100457102 252
201 3300025919 Ga0207657_10004198 Ga0207657_1000419812 252
202 3300025924 Ga0207694_10023650 Ga0207694_100236502 252
203 3300025949 Ga0207667_10075756 Ga0207667_100757562 252
204 3300025981 Ga0207640_10037032 Ga0207640_100370322 252
205 3300026078 Ga0207702_10284509 Ga0207702_102845091 252
206 3300026142 Ga0207698_10024307 Ga0207698_100243072 252
207 3300028800 Ga0265338_10004783 Ga0265338_100047836 252
208 3300030760 Ga0265762_1004057 Ga0265762_10040572 252
209 3300030760 Ga0265762_1004707 Ga0265762_10047072 252
210 3300030878 Ga0265770_1010271 Ga0265770_10102711 252
211 3300031247 Ga0265340_10140648 Ga0265340_101406482 252
212 3300031251 Ga0265327_10033313 Ga0265327_100333132 252
213 3300037312 Ga0395899_0017387 Ga0395899_0017387_3779_4537 252
214 3300037466 Ga0395898_0816366 Ga0395898_0816366_66_824 252
215 3300038443 Ga0395901_0377053 Ga0395901_0377053_66_824 252
216 3300047472 Ga0495686_0018087 Ga0495686_0018087_260_1018 252
217 3300048920 Ga0496117_0088075 Ga0496117_0088075_774_1532 252
218 3300048921 Ga0496118_0002064 Ga0496118_0002064_11487_12245 252
219 3300048929 Ga0496126_0000164 Ga0496126_0000164_47354_48112 252
220 3300049571 Ga0501034_0073207 Ga0501034_0073207_1051_1809 252
221 3300049574 Ga0501038_0178622 Ga0501038_0178622_922_1680 252
222 3300049579 Ga0501043_0284851 Ga0501043_0284851_174_932 252
223 3300049581 Ga0501047_0379837 Ga0501047_0379837_142_900 252
224 3300049586 Ga0501070_0369108 Ga0501070_0369108_246_1004 252
225 3300049589 Ga0501073_0212993 Ga0501073_0212993_398_1156 252
226 3300049590 Ga0501074_0028271 Ga0501074_0028271_2585_3343 252
227 3300049823 Ga0501044_0163313 Ga0501044_0163313_879_1637 252
228 3300053111 Ga0500572_000624 Ga0500572_000624_10174_10932 252
229 3300053735 Ga0500596_002385 Ga0500596_002385_1782_2540 252
230 3300013104 Ga0157370_10587766 Ga0157370_105877662 253
231 3300013307 Ga0157372_10895288 Ga0157372_108952881 253
232 iso_pu_bacteria 2919692658 2919696858 253
233 3300005539 Ga0068853_100001100 Ga0068853_10000110012 254
234 3300005539 Ga0068853_100098969 Ga0068853_1000989694 254
235 3300009093 Ga0105240_10000015 Ga0105240_10000015126 254
236 3300009093 Ga0105240_10084061 Ga0105240_100840614 254
237 3300009174 Ga0105241_10029194 Ga0105241_100291945 254
238 3300009545 Ga0105237_10029519 Ga0105237_100295191 254
239 3300009545 Ga0105237_10172248 Ga0105237_101722482 254
240 3300010375 Ga0105239_10092598 Ga0105239_100925982 254
241 3300015265 Ga0182005_1000316 Ga0182005_10003164 254
242 3300025911 Ga0207654_10022045 Ga0207654_100220452 254
243 3300025914 Ga0207671_10000855 Ga0207671_1000085528 254
244 3300025914 Ga0207671_10024027 Ga0207671_100240272 254
245 3300002737 JGI25162J39368_1000012 JGI25162J39368_1000012286 255
246 3300025233 Ga0209437_100041 Ga0209437_100041327 255
247 3300025913 Ga0207695_10025099 Ga0207695_100250991 255
248 3300049582 Ga0501048_0285908 Ga0501048_0285908_319_1092 255
249 3300053148 Ga0500590_000296 Ga0500590_000296_6421_7191 256
250 3300009177 Ga0105248_10039849 Ga0105248_100398492 257
251 3300053125 Ga0500618_008034 Ga0500618_008034_159_935 258
252 3300003320 rootH2_10064899 rootH2_100648997 259
253 3300009174 Ga0105241_10304654 Ga0105241_103046542 259
254 3300009551 Ga0105238_10106977 Ga0105238_101069774 259
255 3300013100 Ga0157373_10280488 Ga0157373_102804882 259
256 3300035090 Ga0373949_0055633 Ga0373949_0055633_120_908 259
257 3300037853 Ga0436364_0035432 Ga0436364_0035432_1250_2029 259
258 3300048922 Ga0496119_0105625 Ga0496119_0105625_628_1407 259
259 3300048924 Ga0496121_0008898 Ga0496121_0008898_8921_9700 259
260 3300048927 Ga0496124_0000190 Ga0496124_0000190_42972_43751 259
261 3300048929 Ga0496126_0001497 Ga0496126_0001497_26666_27445 259
262 3300021388 Ga0213875_10006897 Ga0213875_100068974 261
263 3300037853 Ga0436364_0392948 Ga0436364_0392948_1956_2741 261
264 3300037853 Ga0436364_0687495 Ga0436364_0687495_4479_5264 261
265 3300039437 Ga0436365_1028915 Ga0436365_1028915_4824_5609 261
266 3300044658 Ga0466972_0000199 Ga0466972_0000199_39484_40359 262
267 3300014325 Ga0163163_10009719 Ga0163163_100097193 265
268 3300046454 Ga0495592_0140481 Ga0495592_0140481_145_1005 265
269 3300044842 Ga0466957_0015034 Ga0466957_0015034_1036_2013 266
270 3300000546 LJNas_1000604 LJNas_10006042 271
271 3300047472 Ga0495686_0000593 Ga0495686_0000593_2512_3387 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

46

259

0.9

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

52

277

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9013 24 264
5cdy-assembly1.cif.gz_D the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.889 24 267
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.885 25 258
7xwl-assembly2.cif.gz_B structure of patulin-detoxifying enzyme y155f/v187f with nadph 0.8843 23 271
7xwi-assembly1.cif.gz_D structure of patulin-detoxifying enzyme with nadph 0.8822 23 271
ID Description Score Start End Superfamily
af_K7MUD1_29_120_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.984 24 101 3.40.50.720
af_Q0JBH4_12_100_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9666 24 104 3.40.50.720
af_Q2FV41_2_233_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9534 23 270 3.40.50.720
af_Q2FV41_2_233_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9494 23 270 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9388 24 94 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5R2N5I4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9993 146 271 GO:0016491
AF-A0A2M8ZIK4-F1-model_v4 deleted 0.9945 21 271
AF-A0A2M8ZIK4-F1-model_v4 deleted 0.9866 21 271
AF-A0A5R2N5I4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9837 146 271 GO:0016491
AF-A0A0N0UHI0-F1-model_v4 Dehydrogenase 0.9762 21 158 GO:0016491

Feature Viewer

pLDDT pTM Quality
90.67 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map