F373429

General Info

Members Datasets Scaffolds Average Seq Length
265 170 530 140

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10014827|Ga0316575_100148272
Length 151
Sequence MAKKVIGEIKLQLQGGQATPAPPVGPALGQHGLNIMDFCKAFNARTQKQQGIIIPVIITVYADRSYSFITKTPPASFLLRQAAGLEKGSGEPNRLKVGKVTLAQVEEIAKTKMPDLNADSLASAVNIILGTARSMGVEIAGSKEAADGSQV

Samples

Sample ID Description Type Environment
1 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
87 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
90 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
91 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
97 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
108 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
109 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
110 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
124 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
128 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
129 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
130 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
163 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.09
Metatranscriptomes 4.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 0.75
Rhizosphere 95.85
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316575_10014827 3300031665 Bacteria 2931
2 JGI25406J46586_10015028 3300003203 Bacteria 3274
3 Ga0058860_12095701 3300004801 Bacteria 1075
4 Ga0058862_12307565 3300004803 Bacteria 668
5 Ga0065707_10125302 3300005295 Bacteria 2026
6 Ga0070670_100884254 3300005331 Bacteria 809
7 Ga0070680_101519583 3300005336 Bacteria 580
8 Ga0070689_100192290 3300005340 Bacteria 1662
9 Ga0070691_10213517 3300005341 Bacteria 1019
10 Ga0070669_101506017 3300005353 Bacteria 585
11 Ga0070675_100115402 3300005354 Bacteria 2276
12 Ga0070688_100241335 3300005365 Bacteria 1283
13 Ga0070659_101612434 3300005366 Bacteria 579
14 Ga0070709_11027183 3300005434 Bacteria 657
15 Ga0070701_10129181 3300005438 Bacteria 1434
16 Ga0070700_100275959 3300005441 Bacteria 1217
17 Ga0070694_100257326 3300005444 Bacteria 1323
18 Ga0070694_101754289 3300005444 Bacteria 528
19 Ga0070708_100049300 3300005445 Bacteria 3725
20 Ga0070678_100481388 3300005456 Bacteria 1092
21 Ga0070662_100655131 3300005457 Bacteria 886
22 Ga0070662_101194541 3300005457 Bacteria 654
23 Ga0070681_12050977 3300005458 Bacteria 500
24 Ga0070706_100025211 3300005467 Bacteria 5474
25 Ga0070706_100037215 3300005467 Bacteria 4494
26 Ga0070707_100195251 3300005468 Bacteria 1973
27 Ga0070698_100010077 3300005471 Bacteria 10093
28 Ga0070699_100511664 3300005518 Bacteria 1091
29 Ga0070699_100655766 3300005518 Bacteria 958
30 Ga0070697_100201964 3300005536 Bacteria 1690
31 Ga0070695_100120261 3300005545 Bacteria 1796
32 Ga0070696_100032298 3300005546 Bacteria 3592
33 Ga0070704_100037669 3300005549 Bacteria 3306
34 Ga0070704_100292409 3300005549 Bacteria 1354
35 Ga0068857_100418352 3300005577 Bacteria 1249
36 Ga0070702_101861610 3300005615 Bacteria 504
37 Ga0068859_100373996 3300005617 Bacteria 1520
38 Ga0068859_101426660 3300005617 Bacteria 764
39 Ga0068870_10533200 3300005840 Bacteria 788
40 Ga0081455_10089131 3300005937 Bacteria 2504
41 Ga0081538_10000001 3300005981 Bacteria 249890
42 Ga0081538_10002817 3300005981 Bacteria 16641
43 Ga0081539_10005548 3300005985 Bacteria 12787
44 Ga0081539_10373616 3300005985 Bacteria 596
45 Ga0075367_10608304 3300006178 Bacteria 695
46 Ga0068871_100501533 3300006358 Bacteria 1094
47 Ga0075428_100009351 3300006844 Bacteria 10874
48 Ga0075428_100858143 3300006844 Bacteria 964
49 Ga0075428_101502501 3300006844 Bacteria 706
50 Ga0075430_100041383 3300006846 Bacteria 3898
51 Ga0075431_100081000 3300006847 Bacteria 3352
52 Ga0075431_100404678 3300006847 Bacteria 1365
53 Ga0075431_101267242 3300006847 Bacteria 699
54 Ga0075433_10001055 3300006852 Bacteria 19748
55 Ga0075433_10065549 3300006852 Bacteria 3185
56 Ga0075433_10648172 3300006852 Bacteria 926
57 Ga0075434_100321286 3300006871 Bacteria 1568
58 Ga0075434_100838381 3300006871 Bacteria 935
59 Ga0075434_101226460 3300006871 Bacteria 762
60 Ga0075429_100503697 3300006880 Bacteria 1061
61 Ga0068865_101111799 3300006881 Bacteria 696
62 Ga0075436_100268803 3300006914 Bacteria 1217
63 Ga0097620_100373998 3300006931 Bacteria 1520
64 Ga0097620_101426856 3300006931 Bacteria 764
65 Ga0075435_100431894 3300007076 Bacteria 1135
66 Ga0111539_10005514 3300009094 Bacteria 16372
67 Ga0111539_10012931 3300009094 Bacteria 10445
68 Ga0111539_10260667 3300009094 Bacteria 2018
69 Ga0111539_11728835 3300009094 Bacteria 725
70 Ga0111539_11975352 3300009094 Bacteria 676
71 Ga0111539_12162458 3300009094 Bacteria 645
72 Ga0105245_10570663 3300009098 Bacteria 1155
73 Ga0114129_10062250 3300009147 Bacteria 5213
74 Ga0114129_10083626 3300009147 Bacteria 4433
75 Ga0114129_10135528 3300009147 Bacteria 3379
76 Ga0114129_10366975 3300009147 Bacteria 1904
77 Ga0114129_12168476 3300009147 Bacteria 669
78 Ga0105243_12191265 3300009148 Bacteria 589
79 Ga0105248_10227899 3300009177 Bacteria 2097
80 Ga0105249_13023446 3300009553 Bacteria 540
81 Ga0157378_10110233 3300013297 Bacteria 2522
82 Ga0157378_10788146 3300013297 Bacteria 975
83 Ga0157378_11076371 3300013297 Bacteria 840
84 Ga0157378_11776155 3300013297 Bacteria 665
85 Ga0163162_10131430 3300013306 Bacteria 2612
86 Ga0157375_10126568 3300013308 Bacteria 2670
87 Ga0157375_10519179 3300013308 Bacteria 1354
88 Ga0163163_11156657 3300014325 Bacteria 836
89 Ga0157380_10018920 3300014326 Bacteria 5124
90 Ga0157380_12452380 3300014326 Bacteria 587
91 Ga0157377_11204125 3300014745 Bacteria 586
92 Ga0182007_10089289 3300015262 Bacteria 1014
93 Ga0163161_10238720 3300017792 Bacteria 1413
94 Ga0206356_11372038 3300020070 Bacteria 1523
95 Ga0206352_10207250 3300020078 Bacteria 979
96 Ga0228598_1027259 3300024227 Bacteria 1123
97 Ga0207699_11354677 3300025906 Bacteria 527
98 Ga0207643_10410931 3300025908 Bacteria 857
99 Ga0207684_10006657 3300025910 Bacteria 10503
100 Ga0207684_10037186 3300025910 Bacteria 4131
101 Ga0207684_10152161 3300025910 Bacteria 1991
102 Ga0207646_10165815 3300025922 Bacteria 1994
103 Ga0207646_10929897 3300025922 Bacteria 770
104 Ga0207650_10155914 3300025925 Bacteria 1806
105 Ga0207659_10219310 3300025926 Bacteria 1528
106 Ga0207687_10705657 3300025927 Bacteria 856
107 Ga0207706_10271393 3300025933 Bacteria 1480
108 Ga0207670_10293541 3300025936 Bacteria 1271
109 Ga0207670_10330198 3300025936 Bacteria 1202
110 Ga0207669_11397904 3300025937 Bacteria 596
111 Ga0207711_10519104 3300025941 Bacteria 1111
112 Ga0207689_10130975 3300025942 Bacteria 2064
113 Ga0207712_10408576 3300025961 Unclassified 1143
114 Ga0207668_10853722 3300025972 Unclassified 808
115 Ga0207708_10383677 3300026075 Bacteria 1159
116 Ga0207708_11239116 3300026075 Bacteria 653
117 Ga0207676_10096368 3300026095 Bacteria 2442
118 Ga0209974_10426477 3300027876 Bacteria 524
119 Ga0207428_10026272 3300027907 Bacteria 4861
120 Ga0268265_10593321 3300028380 Bacteria 1057
121 Ga0268265_10909990 3300028380 Bacteria 864
122 Ga0268264_10643820 3300028381 Bacteria 1048
123 Ga0265323_10132473 3300028653 Bacteria 806
124 Ga0265322_10015403 3300028654 Bacteria 2210
125 Ga0265338_10021648 3300028800 Bacteria 6692
126 Ga0265320_10037621 3300031240 Bacteria 2436
127 Ga0265329_10021640 3300031242 Bacteria 2158
128 Ga0265339_10248218 3300031249 Bacteria 862
129 Ga0265316_10001158 3300031344 Bacteria 28528
130 Ga0307408_100175509 3300031548 Bacteria 1714
131 Ga0316575_10059719 3300031665 Bacteria 1522
132 Ga0316579_10015344 3300031691 Bacteria 3325
133 Ga0265342_10107510 3300031712 Bacteria 1582
134 Ga0316576_10000548 3300031727 Bacteria 17648
135 Ga0316576_10002466 3300031727 Bacteria 10527
136 Ga0316576_10030207 3300031727 Bacteria 3835
137 Ga0316576_10041658 3300031727 Bacteria 3307
138 Ga0316576_10143168 3300031727 Bacteria 1800
139 Ga0316576_10190362 3300031727 Bacteria 1547
140 Ga0316576_10593068 3300031727 Bacteria 809
141 Ga0316576_10698258 3300031727 Bacteria 735
142 Ga0316578_10003567 3300031728 Bacteria 7150
143 Ga0307405_10068958 3300031731 Bacteria 2265
144 Ga0316577_10035535 3300031733 Bacteria 2785
145 Ga0316577_10038718 3300031733 Bacteria 2667
146 Ga0307413_10335645 3300031824 Bacteria 1160
147 Ga0307410_10466148 3300031852 Bacteria 1033
148 Ga0307406_11205141 3300031901 Bacteria 657
149 Ga0307412_10445860 3300031911 Bacteria 1065
150 Ga0307409_100647258 3300031995 Bacteria 1050
151 Ga0307409_101481285 3300031995 Bacteria 706
152 Ga0307416_100496131 3300032002 Bacteria 1284
153 Ga0307414_11108149 3300032004 Bacteria 731
154 Ga0316583_10001003 3300032133 Bacteria 9098
155 Ga0316585_10005766 3300032137 Bacteria 3506
156 Ga0316580_10002675 3300032139 Bacteria 4953
157 Ga0316593_10000403 3300032168 Bacteria 7777
158 Ga0316593_10017496 3300032168 Bacteria 2187
159 Ga0316593_10088778 3300032168 Bacteria 1087
160 Ga0316592_1005240 3300033524 Bacteria 2452
161 Ga0316588_1000228 3300033528 Bacteria 6735
162 Ga0316574_0006382 3300035398 Bacteria 6371
163 Ga0316574_0116292 3300035398 Bacteria 1716
164 Ga0316574_0118854 3300035398 Bacteria 1696
165 Ga0316574_0359179 3300035398 Bacteria 921
166 Ga0373931_0156138 3300035691 Bacteria 1334
167 Ga0373933_0674168 3300035724 Bacteria 680
168 Ga0373937_0113099 3300036401 Bacteria 2526
169 Ga0373937_0710653 3300036401 Bacteria 952
170 Ga0316582_0001550 3300036647 Bacteria 10190
171 Ga0316584_0031703 3300036712 Bacteria 3908
172 Ga0316584_0230479 3300036712 Bacteria 1358
173 Ga0395900_1347450 3300037418 Bacteria 627
174 Ga0395898_0282671 3300037466 Bacteria 1583
175 Ga0395905_0008542 3300037471 Bacteria 10098
176 Ga0395901_0542689 3300038443 Bacteria 1179
177 Ga0400483_202961 3300039062 Bacteria 2928
178 Ga0400483_210449 3300039062 Bacteria 2390
179 Ga0400489_80694 3300039093 Bacteria 3149
180 Ga0436365_1440488 3300039437 Bacteria 800
181 Ga0436362_0829852 3300039453 Bacteria 1255
182 Ga0439436_0238329 3300041404 Bacteria 526
183 Ga0439439_0027541 3300041406 Bacteria 1436
184 Ga0439434_0020948 3300042435 Bacteria 1964
185 Ga0439444_0110686 3300042437 Bacteria 632
186 Ga0451577_0000139 3300042876 Bacteria 161883
187 Ga0451577_0061827 3300042876 Bacteria 3339
188 Ga0451577_0166999 3300042876 Bacteria 1983
189 Ga0451577_0368616 3300042876 Bacteria 1303
190 Ga0451577_1839067 3300042876 Bacteria 531
191 Ga0453683_0000392 3300044673 Bacteria 52154
192 Ga0453683_0000503 3300044673 Bacteria 44706
193 Ga0453683_0018335 3300044673 Bacteria 4493
194 Ga0453684_0010619 3300044712 Bacteria 15695
195 Ga0453684_0011627 3300044712 Bacteria 14698
196 Ga0453684_0092224 3300044712 Bacteria 3735
197 Ga0453684_0395206 3300044712 Bacteria 1549
198 Ga0453684_0501026 3300044712 Bacteria 1344
199 Ga0453684_1307573 3300044712 Bacteria 756
200 Ga0451576_0001666 3300045051 Bacteria 36880
201 Ga0451576_0055578 3300045051 Bacteria 4141
202 Ga0451576_0115723 3300045051 Bacteria 2791
203 Ga0451576_0719373 3300045051 Bacteria 1049
204 Ga0451576_0834056 3300045051 Bacteria 968
205 Ga0451576_0909777 3300045051 Bacteria 923
206 Ga0496106_1291237 3300048909 Bacteria 567
207 Ga0496107_0029766 3300048910 Bacteria 3888
208 Ga0496116_0030807 3300048919 Bacteria 3850
209 Ga0496117_0366306 3300048920 Bacteria 739
210 Ga0501335_000459 3300049551 Bacteria 2596
211 Ga0501034_1205023 3300049571 Bacteria 636
212 Ga0501036_1267898 3300049572 Bacteria 600
213 Ga0501040_0485905 3300049576 Bacteria 890
214 Ga0501068_0240719 3300049584 Bacteria 1152
215 Ga0501070_0959287 3300049586 Bacteria 665
216 Ga0501075_0315338 3300049591 Bacteria 1192
217 Ga0501075_0654356 3300049591 Bacteria 801
218 Ga0501076_0211765 3300049592 Bacteria 1584
219 Ga0501076_0418044 3300049592 Bacteria 1103
220 Ga0501076_0652950 3300049592 Bacteria 868
221 Ga0501260_034900 3300049689 Bacteria 592
222 Ga0501079_0057078 3300049741 Bacteria 3013
223 Ga0501081_0240299 3300049743 Bacteria 1320
224 Ga0501081_0923027 3300049743 Bacteria 659
225 Ga0501081_1198595 3300049743 Bacteria 575
226 Ga0501045_0311655 3300049824 Bacteria 1171
227 nmdc:mga06z11_533870_c1 3300050494 Bacteria 712
228 nmdc:mga05p37_1154861_c1 3300050507 Bacteria 805
229 nmdc:mga05p37_152150_c1 3300050507 Bacteria 2829
230 nmdc:mga05p37_16963_c1 3300050507 Bacteria 8784
231 nmdc:mga05p37_217518_c2 3300050507 Bacteria 1912
232 nmdc:mga05p37_348353_c1 3300050507 Bacteria 1745
233 nmdc:mga09592_140785_c1 3300050508 Bacteria 2079
234 nmdc:mga09592_251399_c1 3300050508 Bacteria 1532
235 nmdc:mga0qj67_138398_c1 3300050509 Bacteria 1973
236 nmdc:mga0qj67_62146_c1 3300050509 Bacteria 2968
237 nmdc:mga06r32_1561001_c1 3300050510 Bacteria 599
238 nmdc:mga06r32_435916_c1 3300050510 Bacteria 1291
239 nmdc:mga06r32_77280_c1 3300050510 Bacteria 3233
240 nmdc:mga08y16_154013_c1 3300050511 Bacteria 2389
241 nmdc:mga08y16_199363_c1 3300050511 Bacteria 2074
242 nmdc:mga08y16_295898_c1 3300050511 Bacteria 1669
243 nmdc:mga08y16_33336_c1 3300050511 Bacteria 5409
244 nmdc:mga0n895_1049823_c1 3300050512 Bacteria 794
245 nmdc:mga0n895_266684_c1 3300050512 Bacteria 1737
246 nmdc:mga0n895_81940_c1 3300050512 Bacteria 3216
247 nmdc:mga0rr50_657947_c1 3300050513 Bacteria 894
248 nmdc:mga08x19_246158_c1 3300050514 Bacteria 1233
249 nmdc:mga0a205_321736_c1 3300050515 Bacteria 1418
250 nmdc:mga0a205_345791_c1 3300050515 Bacteria 1355
251 nmdc:mga0a205_553_c1 3300050515 Bacteria 29648
252 Ga0501084_0849447 3300054114 Bacteria 768
253 Ga0590071_002566 3300059421 Bacteria 4570
254 Ga0590071_005860 3300059421 Bacteria 2946
255 Ga0590074_006497 3300059423 Bacteria 1941
256 Ga0590075_005461 3300059424 Bacteria 2999
257 Ga0590075_009218 3300059424 Bacteria 2362
258 Ga0590077_002758 3300059426 Bacteria 3697
259 Ga0587073_0172404 3300059492 Bacteria 629
260 Ga0587083_0066415 3300059505 Bacteria 826
261 Ga0587094_068682 3300059513 Bacteria 634
262 Ga0501082_0331609 3300060353 Bacteria 1326
263 Ga0530510_0167423 3300061734 Bacteria 1627
264 Ga0530510_0405859 3300061734 Bacteria 1028
265 Ga0530510_1315116 3300061734 Bacteria 554
266 Ga0316575_10014827
267 JGI25406J46586_10015028
268 Ga0058860_12095701
269 Ga0058862_12307565
270 Ga0065707_10125302
271 Ga0070670_100884254
272 Ga0070680_101519583
273 Ga0070689_100192290
274 Ga0070691_10213517
275 Ga0070669_101506017
276 Ga0070675_100115402
277 Ga0070688_100241335
278 Ga0070659_101612434
279 Ga0070709_11027183
280 Ga0070701_10129181
281 Ga0070700_100275959
282 Ga0070694_100257326
283 Ga0070694_101754289
284 Ga0070708_100049300
285 Ga0070678_100481388
286 Ga0070662_100655131
287 Ga0070662_101194541
288 Ga0070681_12050977
289 Ga0070706_100025211
290 Ga0070706_100037215
291 Ga0070707_100195251
292 Ga0070698_100010077
293 Ga0070699_100511664
294 Ga0070699_100655766
295 Ga0070697_100201964
296 Ga0070695_100120261
297 Ga0070696_100032298
298 Ga0070704_100037669
299 Ga0070704_100292409
300 Ga0068857_100418352
301 Ga0070702_101861610
302 Ga0068859_100373996
303 Ga0068859_101426660
304 Ga0068870_10533200
305 Ga0081455_10089131
306 Ga0081538_10000001
307 Ga0081538_10002817
308 Ga0081539_10005548
309 Ga0081539_10373616
310 Ga0075367_10608304
311 Ga0068871_100501533
312 Ga0075428_100009351
313 Ga0075428_100858143
314 Ga0075428_101502501
315 Ga0075430_100041383
316 Ga0075431_100081000
317 Ga0075431_100404678
318 Ga0075431_101267242
319 Ga0075433_10001055
320 Ga0075433_10065549
321 Ga0075433_10648172
322 Ga0075434_100321286
323 Ga0075434_100838381
324 Ga0075434_101226460
325 Ga0075429_100503697
326 Ga0068865_101111799
327 Ga0075436_100268803
328 Ga0097620_100373998
329 Ga0097620_101426856
330 Ga0075435_100431894
331 Ga0111539_10005514
332 Ga0111539_10012931
333 Ga0111539_10260667
334 Ga0111539_11728835
335 Ga0111539_11975352
336 Ga0111539_12162458
337 Ga0105245_10570663
338 Ga0114129_10062250
339 Ga0114129_10083626
340 Ga0114129_10135528
341 Ga0114129_10366975
342 Ga0114129_12168476
343 Ga0105243_12191265
344 Ga0105248_10227899
345 Ga0105249_13023446
346 Ga0157378_10110233
347 Ga0157378_10788146
348 Ga0157378_11076371
349 Ga0157378_11776155
350 Ga0163162_10131430
351 Ga0157375_10126568
352 Ga0157375_10519179
353 Ga0163163_11156657
354 Ga0157380_10018920
355 Ga0157380_12452380
356 Ga0157377_11204125
357 Ga0182007_10089289
358 Ga0163161_10238720
359 Ga0206356_11372038
360 Ga0206352_10207250
361 Ga0228598_1027259
362 Ga0207699_11354677
363 Ga0207643_10410931
364 Ga0207684_10006657
365 Ga0207684_10037186
366 Ga0207684_10152161
367 Ga0207646_10165815
368 Ga0207646_10929897
369 Ga0207650_10155914
370 Ga0207659_10219310
371 Ga0207687_10705657
372 Ga0207706_10271393
373 Ga0207670_10293541
374 Ga0207670_10330198
375 Ga0207669_11397904
376 Ga0207711_10519104
377 Ga0207689_10130975
378 Ga0207712_10408576
379 Ga0207668_10853722
380 Ga0207708_10383677
381 Ga0207708_11239116
382 Ga0207676_10096368
383 Ga0209974_10426477
384 Ga0207428_10026272
385 Ga0268265_10593321
386 Ga0268265_10909990
387 Ga0268264_10643820
388 Ga0265323_10132473
389 Ga0265322_10015403
390 Ga0265338_10021648
391 Ga0265320_10037621
392 Ga0265329_10021640
393 Ga0265339_10248218
394 Ga0265316_10001158
395 Ga0307408_100175509
396 Ga0316575_10059719
397 Ga0316579_10015344
398 Ga0265342_10107510
399 Ga0316576_10000548
400 Ga0316576_10002466
401 Ga0316576_10030207
402 Ga0316576_10041658
403 Ga0316576_10143168
404 Ga0316576_10190362
405 Ga0316576_10593068
406 Ga0316576_10698258
407 Ga0316578_10003567
408 Ga0307405_10068958
409 Ga0316577_10035535
410 Ga0316577_10038718
411 Ga0307413_10335645
412 Ga0307410_10466148
413 Ga0307406_11205141
414 Ga0307412_10445860
415 Ga0307409_100647258
416 Ga0307409_101481285
417 Ga0307416_100496131
418 Ga0307414_11108149
419 Ga0316583_10001003
420 Ga0316585_10005766
421 Ga0316580_10002675
422 Ga0316593_10000403
423 Ga0316593_10017496
424 Ga0316593_10088778
425 Ga0316592_1005240
426 Ga0316588_1000228
427 Ga0316574_0006382
428 Ga0316574_0116292
429 Ga0316574_0118854
430 Ga0316574_0359179
431 Ga0373931_0156138
432 Ga0373933_0674168
433 Ga0373937_0113099
434 Ga0373937_0710653
435 Ga0316582_0001550
436 Ga0316584_0031703
437 Ga0316584_0230479
438 Ga0395900_1347450
439 Ga0395898_0282671
440 Ga0395905_0008542
441 Ga0395901_0542689
442 Ga0400483_202961
443 Ga0400483_210449
444 Ga0400489_80694
445 Ga0436365_1440488
446 Ga0436362_0829852
447 Ga0439436_0238329
448 Ga0439439_0027541
449 Ga0439434_0020948
450 Ga0439444_0110686
451 Ga0451577_0000139
452 Ga0451577_0061827
453 Ga0451577_0166999
454 Ga0451577_0368616
455 Ga0451577_1839067
456 Ga0453683_0000392
457 Ga0453683_0000503
458 Ga0453683_0018335
459 Ga0453684_0010619
460 Ga0453684_0011627
461 Ga0453684_0092224
462 Ga0453684_0395206
463 Ga0453684_0501026
464 Ga0453684_1307573
465 Ga0451576_0001666
466 Ga0451576_0055578
467 Ga0451576_0115723
468 Ga0451576_0719373
469 Ga0451576_0834056
470 Ga0451576_0909777
471 Ga0496106_1291237
472 Ga0496107_0029766
473 Ga0496116_0030807
474 Ga0496117_0366306
475 Ga0501335_000459
476 Ga0501034_1205023
477 Ga0501036_1267898
478 Ga0501040_0485905
479 Ga0501068_0240719
480 Ga0501070_0959287
481 Ga0501075_0315338
482 Ga0501075_0654356
483 Ga0501076_0211765
484 Ga0501076_0418044
485 Ga0501076_0652950
486 Ga0501260_034900
487 Ga0501079_0057078
488 Ga0501081_0240299
489 Ga0501081_0923027
490 Ga0501081_1198595
491 Ga0501045_0311655
492 nmdc:mga06z11_533870_c1
493 nmdc:mga05p37_1154861_c1
494 nmdc:mga05p37_152150_c1
495 nmdc:mga05p37_16963_c1
496 nmdc:mga05p37_217518_c2
497 nmdc:mga05p37_348353_c1
498 nmdc:mga09592_140785_c1
499 nmdc:mga09592_251399_c1
500 nmdc:mga0qj67_138398_c1
501 nmdc:mga0qj67_62146_c1
502 nmdc:mga06r32_1561001_c1
503 nmdc:mga06r32_435916_c1
504 nmdc:mga06r32_77280_c1
505 nmdc:mga08y16_154013_c1
506 nmdc:mga08y16_199363_c1
507 nmdc:mga08y16_295898_c1
508 nmdc:mga08y16_33336_c1
509 nmdc:mga0n895_1049823_c1
510 nmdc:mga0n895_266684_c1
511 nmdc:mga0n895_81940_c1
512 nmdc:mga0rr50_657947_c1
513 nmdc:mga08x19_246158_c1
514 nmdc:mga0a205_321736_c1
515 nmdc:mga0a205_345791_c1
516 nmdc:mga0a205_553_c1
517 Ga0501084_0849447
518 Ga0590071_002566
519 Ga0590071_005860
520 Ga0590074_006497
521 Ga0590075_005461
522 Ga0590075_009218
523 Ga0590077_002758
524 Ga0587073_0172404
525 Ga0587083_0066415
526 Ga0587094_068682
527 Ga0501082_0331609
528 Ga0530510_0167423
529 Ga0530510_0405859
530 Ga0530510_1315116

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00298

Ribosomal_L11

Ribosomal protein L11, RNA binding domain

71

139

0.99

PF03946

Ribosomal_L11_N

Ribosomal protein L11, N-terminal domain

9

66

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.9794 3 72
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.9528 3 72
3egv-assembly1.cif.gz_B ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 0.9527 3 79
2bcw-assembly1.cif.gz_A coordinates of the n-terminal domain of ribosomal protein l11,c-terminal domain of ribosomal protein l7/l12 and a portion of the g' domain of elongation factor g, as fitted into cryo-em map of an escherichia coli 70s*ef-g*gdp*fusidic acid complex 0.9482 9 72
3egv-assembly1.cif.gz_B ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 0.9409 3 79
ID Description Score Start End Superfamily
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.98 3 67 3.30.1550.10
3egvB00 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9527 3 79 3.30.1550.10
4v19K01 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.951 7 70 3.30.1550.10
af_Q23884_18_102_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9426 3 81 3.30.1550.10
3egvB00 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9409 3 79 3.30.1550.10
ID Description Score Start End GO Terms
AF-A0A2V5R234-F1-model_v4 50S ribosomal protein L11 1.003 1 74 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A849X8K1-F1-model_v4 50S ribosomal protein L11 1.003 1 69 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A1B7WHC5-F1-model_v4 50S ribosomal protein L11 1.002 1 69 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A2D7JF69-F1-model_v4 50S ribosomal protein L11 0.998 1 71 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A2N2LDD6-F1-model_v4 50S ribosomal protein L11 0.997 1 72 GO:0003735
GO:0006412
GO:0022625
GO:0070180

Map