F371405

General Info

Members Datasets Scaffolds Average Seq Length
262 194 524 345

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0005189|Ga0501034_0005189_6363_7583
Length 406
Sequence MSGHGASAAPQEHRDGPDYSAPPILQVRNLKKYFPIKKGAIFAKEVGAVKAVDDVSFDLWPGETLGVVGESGCGKSTTGRAILQLHKPTAGSVVFQGQELTTLNNQQLRAVRRDLQIVFQDPYASLNPRMTVGNIISEPLVIHGIGDKASRMQRVRELLDIVGLNPAFTNRYPHEFSGGQRQRIGIARALALQPKLIICDEPVSALDVSIQAQVMNLLEDLQTEFDLTYMFIAHDLAVVKHVSDRVAVMYLGKVVELAEAEKLYADPQHPYTQALLSSIPVADPEVARRKDRIILSGDVPSPANPPSGCPFHERCWKAQSVCKQQMPPLEMKDGDPGHQMACWFPGPDGAPGTITPAAIMAQIKAERDAAAGRQAVRPSDASRAQQPRPTEGTGGVDPTTGMPPGV

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
66 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
67 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
76 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
86 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
90 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
91 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
111 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
121 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
122 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
164 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
165 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
166 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
167 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
170 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
171 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
172 2643221670 Streptomyces sp. Root431 Isolate Unclassified
173 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
174 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
175 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
176 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
177 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
178 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
179 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
180 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
181 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
182 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
183 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
184 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
185 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
186 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
187 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
188 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
189 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
190 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
191 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
192 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
193 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
194 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.46
Metatranscriptomes 0
Isolates 9.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.58
Nodule 0.76
Rhizoplane 9.16
Rhizosphere 77.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0005189 3300049571 Bacteria 14294
2 Ga0065707_10000455 3300005295 Bacteria 78106
3 Ga0065707_10008647 3300005295 Bacteria 3591
4 Ga0065707_10099833 3300005295 Bacteria 2975
5 Ga0065707_10147635 3300005295 Bacteria 1695
6 Ga0070683_100066668 3300005329 Bacteria 3353
7 Ga0070661_100018511 3300005344 Bacteria 4952
8 Ga0070668_100012626 3300005347 Bacteria 6288
9 Ga0070669_100059838 3300005353 Bacteria 2797
10 Ga0070671_100105399 3300005355 Bacteria 2366
11 Ga0070659_100033702 3300005366 Bacteria 3980
12 Ga0070667_100013179 3300005367 Bacteria 6834
13 Ga0070678_100172201 3300005456 Bacteria 1764
14 Ga0070698_100019046 3300005471 Bacteria 7218
15 Ga0070698_100087405 3300005471 Bacteria 3103
16 Ga0070699_100052671 3300005518 Bacteria 3521
17 Ga0070699_100295536 3300005518 Bacteria 1453
18 Ga0070679_100103513 3300005530 Bacteria 2833
19 Ga0070665_100439575 3300005548 Bacteria 1314
20 Ga0068854_100101086 3300005578 Bacteria 2162
21 Ga0070702_100000904 3300005615 Bacteria 11571
22 Ga0070702_100264561 3300005615 Bacteria 1173
23 Ga0068859_100194086 3300005617 Bacteria 2115
24 Ga0068861_100165741 3300005719 Bacteria 1827
25 Ga0068860_100010065 3300005843 Bacteria 9371
26 Ga0068862_100274307 3300005844 Bacteria 1543
27 Ga0081538_10019933 3300005981 Bacteria 4959
28 Ga0081540_1050327 3300005983 Bacteria 2070
29 Ga0070712_100163533 3300006175 Bacteria 1721
30 Ga0075370_10031391 3300006353 Bacteria 2965
31 Ga0075428_100242273 3300006844 Bacteria 1945
32 Ga0075431_100127035 3300006847 Bacteria 2631
33 Ga0075431_100180348 3300006847 Bacteria 2167
34 Ga0075433_10076728 3300006852 Bacteria 2943
35 Ga0075434_100102477 3300006871 Bacteria 2870
36 Ga0075429_100011596 3300006880 Bacteria 7645
37 Ga0075429_100068320 3300006880 Bacteria 3092
38 Ga0097620_100194089 3300006931 Bacteria 2115
39 Ga0079104_1001751 3300006946 Bacteria 13730
40 Ga0105240_10476178 3300009093 Bacteria 1393
41 Ga0105245_10185509 3300009098 Bacteria 1990
42 Ga0105247_10010287 3300009101 Bacteria 5661
43 Ga0114129_10006706 3300009147 Bacteria 16350
44 Ga0114129_10009609 3300009147 Bacteria 13796
45 Ga0114129_10015417 3300009147 Bacteria 10872
46 Ga0114129_10059554 3300009147 Bacteria 5338
47 Ga0114129_10308406 3300009147 Bacteria 2107
48 Ga0114129_10377643 3300009147 Bacteria 1872
49 Ga0105243_10127700 3300009148 Bacteria 2153
50 Ga0105243_10420869 3300009148 Bacteria 1246
51 Ga0105242_10016466 3300009176 Bacteria 5747
52 Ga0105248_10014544 3300009177 Bacteria 8662
53 Ga0105249_10079618 3300009553 Bacteria 3042
54 Ga0105249_10487173 3300009553 Bacteria 1277
55 Ga0157369_10452485 3300013105 Bacteria 1330
56 Ga0157378_10002448 3300013297 Bacteria 16524
57 Ga0157378_10171808 3300013297 Bacteria 2033
58 Ga0157372_10407646 3300013307 Bacteria 1584
59 Ga0157380_10026902 3300014326 Bacteria 4370
60 Ga0157377_10184648 3300014745 Bacteria 1314
61 Ga0157379_10018507 3300014968 Bacteria 6144
62 Ga0157376_10222090 3300014969 Bacteria 1750
63 Ga0157376_10253778 3300014969 Bacteria 1644
64 Ga0213876_10013894 3300021384 Bacteria 4268
65 Ga0207426_1015735 3300025302 Bacteria 2737
66 Ga0207705_10129987 3300025909 Bacteria 1874
67 Ga0207693_10088763 3300025915 Bacteria 2423
68 Ga0207660_10083873 3300025917 Bacteria 2348
69 Ga0207657_10234352 3300025919 Bacteria 1467
70 Ga0207649_10068662 3300025920 Bacteria 2254
71 Ga0207681_10099038 3300025923 Bacteria 2098
72 Ga0207686_10031386 3300025934 Bacteria 3154
73 Ga0207670_10023401 3300025936 Bacteria 3846
74 Ga0207711_10046804 3300025941 Bacteria 3696
75 Ga0207668_10020062 3300025972 Bacteria 4239
76 Ga0207675_100220778 3300026118 Bacteria 1826
77 Ga0207683_10000213 3300026121 Bacteria 50464
78 Ga0207698_10108500 3300026142 Bacteria 2321
79 Ga0268265_10279446 3300028380 Bacteria 1493
80 Ga0268265_10284503 3300028380 Bacteria 1481
81 Ga0307515_10208228 3300028794 Bacteria 1808
82 Ga0265338_10069318 3300028800 Bacteria 3030
83 Ga0265338_10129792 3300028800 Bacteria 1993
84 Ga0265320_10038892 3300031240 Bacteria 2382
85 Ga0307513_10021174 3300031456 Bacteria 7681
86 Ga0307508_10000366 3300031616 Bacteria 54777
87 Ga0265314_10188564 3300031711 Bacteria 1229
88 Ga0307410_10039315 3300031852 Bacteria 3105
89 Ga0307406_10116356 3300031901 Bacteria 1850
90 Ga0307409_100051478 3300031995 Bacteria 3151
91 Ga0307409_100444525 3300031995 Bacteria 1250
92 Ga0307414_10037967 3300032004 Bacteria 3230
93 Ga0307411_10003460 3300032005 Bacteria 7332
94 Ga0307415_100181292 3300032126 Bacteria 1653
95 Ga0373944_0006114 3300035089 Bacteria 3190
96 Ga0373945_0006251 3300035116 Bacteria 3835
97 Ga0373943_0010769 3300035170 Bacteria 4104
98 Ga0316574_0038306 3300035398 Bacteria 2943
99 Ga0316574_0043923 3300035398 Bacteria 2763
100 Ga0316574_0089046 3300035398 Bacteria 1966
101 Ga0316574_0218368 3300035398 Bacteria 1222
102 Ga0373935_0010040 3300035692 Bacteria 5673
103 Ga0373937_0031647 3300036401 Bacteria 4795
104 Ga0373937_0045988 3300036401 Bacteria 3990
105 Ga0373925_0114353 3300037068 Bacteria 2088
106 Ga0395898_0215836 3300037466 Bacteria 1830
107 Ga0436364_1517148 3300037853 Bacteria 3341
108 Ga0395901_0347607 3300038443 Bacteria 1531
109 Ga0400483_182684 3300039062 Bacteria 3903
110 Ga0400489_94876 3300039093 Bacteria 4272
111 Ga0436365_0979564 3300039437 Bacteria 4723
112 Ga0436363_1201940 3300039450 Bacteria 934
113 Ga0439465_0015966 3300041413 Bacteria 2342
114 Ga0439433_0003985 3300041999 Bacteria 3179
115 Ga0439457_000030 3300042014 Bacteria 29028
116 Ga0451577_0144662 3300042876 Bacteria 2137
117 Ga0451577_0192518 3300042876 Bacteria 1840
118 Ga0453683_0290735 3300044673 Bacteria 1045
119 Ga0466961_0035415 3300044693 Bacteria 3206
120 Ga0466963_0001203 3300044694 Bacteria 13620
121 Ga0466963_0081718 3300044694 Bacteria 2189
122 Ga0453684_0002480 3300044712 Bacteria 44586
123 Ga0453684_0047717 3300044712 Bacteria 5675
124 Ga0453684_0157683 3300044712 Bacteria 2689
125 Ga0453684_0187967 3300044712 Bacteria 2418
126 Ga0453684_0192389 3300044712 Bacteria 2385
127 Ga0453684_0361531 3300044712 Bacteria 1634
128 Ga0466957_0002215 3300044842 Bacteria 10421
129 Ga0466957_0008571 3300044842 Bacteria 5820
130 Ga0466959_0012529 3300045049 Bacteria 6130
131 Ga0466959_0058173 3300045049 Bacteria 2816
132 Ga0451576_0021188 3300045051 Bacteria 7066
133 Ga0451576_0030877 3300045051 Bacteria 5716
134 Ga0451576_0049186 3300045051 Bacteria 4425
135 Ga0451576_0214434 3300045051 Bacteria 2010
136 Ga0466958_0000475 3300045836 Bacteria 16777
137 Ga0466958_0003080 3300045836 Bacteria 8552
138 Ga0466967_0000191 3300045976 Bacteria 25550
139 Ga0466967_0016195 3300045976 Bacteria 5869
140 Ga0466967_0298953 3300045976 Bacteria 1548
141 Ga0495592_0151977 3300046454 Bacteria 1600
142 Ga0495629_0001341 3300046459 Bacteria 19369
143 Ga0495629_0009307 3300046459 Bacteria 7188
144 Ga0495629_0147920 3300046459 Bacteria 1633
145 Ga0495641_0009724 3300046461 Bacteria 5679
146 Ga0495651_0004234 3300046462 Bacteria 10995
147 Ga0495653_0034289 3300046463 Bacteria 4016
148 Ga0495653_0060785 3300046463 Bacteria 2861
149 Ga0495582_0014519 3300046473 Bacteria 4327
150 Ga0495639_0005422 3300046475 Bacteria 5493
151 Ga0495662_0014283 3300046476 Bacteria 3862
152 Ga0495662_0103796 3300046476 Bacteria 1391
153 Ga0495594_0000462 3300046499 Bacteria 20712
154 Ga0495594_0131400 3300046499 Bacteria 1418
155 Ga0495607_0000766 3300046501 Bacteria 30801
156 Ga0495608_0040957 3300046511 Bacteria 3102
157 Ga0495628_0143234 3300046516 Bacteria 1823
158 Ga0495630_0168400 3300046517 Bacteria 1668
159 Ga0495665_0000252 3300046531 Bacteria 26953
160 Ga0495586_0058176 3300046535 Bacteria 2099
161 Ga0495622_0019153 3300046557 Bacteria 3188
162 Ga0495667_0000356 3300046559 Bacteria 29062
163 Ga0495667_0133567 3300046559 Bacteria 1600
164 Ga0495634_0136675 3300046642 Bacteria 1559
165 Ga0495588_0014144 3300046674 Bacteria 3815
166 Ga0495599_0048226 3300046678 Bacteria 2670
167 Ga0495647_0023148 3300046681 Bacteria 2251
168 Ga0495647_0032288 3300046681 Bacteria 1950
169 Ga0495658_0069861 3300046683 Bacteria 2036
170 Ga0495613_0003957 3300046689 Bacteria 11096
171 Ga0495624_0081835 3300046690 Bacteria 1999
172 Ga0495581_0136950 3300047315 Bacteria 1427
173 Ga0495674_0000584 3300047319 Bacteria 34100
174 Ga0495674_0082836 3300047319 Bacteria 2750
175 Ga0495676_0025333 3300047321 Bacteria 5123
176 Ga0495676_0037487 3300047321 Bacteria 4034
177 Ga0495680_0022744 3300047322 Bacteria 5222
178 Ga0495680_0147188 3300047322 Bacteria 1719
179 Ga0495684_0146584 3300047471 Bacteria 1768
180 Ga0495593_0014231 3300047673 Bacteria 4524
181 Ga0495626_0022286 3300048091 Bacteria 3130
182 Ga0496100_0008276 3300048903 Bacteria 5795
183 Ga0496100_0161689 3300048903 Bacteria 1606
184 Ga0496101_0003445 3300048904 Bacteria 9869
185 Ga0496102_0008929 3300048905 Bacteria 8600
186 Ga0496103_0204848 3300048906 Bacteria 1269
187 Ga0496104_0035074 3300048907 Bacteria 4682
188 Ga0496104_0084009 3300048907 Bacteria 3037
189 Ga0496104_0123751 3300048907 Bacteria 2483
190 Ga0496105_0032584 3300048908 Bacteria 4278
191 Ga0496105_0043656 3300048908 Bacteria 3698
192 Ga0496106_0013117 3300048909 Bacteria 6115
193 Ga0496107_0012179 3300048910 Bacteria 6000
194 Ga0496108_0133726 3300048911 Bacteria 2132
195 Ga0496109_0016414 3300048912 Bacteria 6474
196 Ga0496109_0050161 3300048912 Bacteria 3801
197 Ga0496109_0236521 3300048912 Bacteria 1718
198 Ga0496112_0003488 3300048915 Bacteria 13027
199 Ga0496113_0177106 3300048916 Bacteria 1690
200 Ga0496114_0003608 3300048917 Bacteria 11893
201 Ga0496114_0005981 3300048917 Bacteria 9577
202 Ga0496114_0254128 3300048917 Bacteria 1547
203 Ga0496115_0040695 3300048918 Bacteria 3696
204 Ga0496115_0280955 3300048918 Bacteria 1367
205 Ga0496125_0003957 3300048928 Bacteria 17471
206 Ga0501041_0106641 3300049577 Bacteria 1737
207 Ga0501047_0004087 3300049581 Bacteria 13731
208 Ga0501069_0000030 3300049585 Bacteria 102077
209 Ga0501069_0031762 3300049585 Bacteria 2906
210 Ga0501070_0000135 3300049586 Bacteria 66258
211 Ga0501070_0004637 3300049586 Bacteria 11781
212 Ga0501071_0218417 3300049587 Bacteria 1434
213 Ga0501074_0075409 3300049590 Bacteria 2421
214 Ga0501075_0033871 3300049591 Bacteria 3801
215 Ga0501075_0145119 3300049591 Bacteria 1809
216 Ga0501080_0001228 3300049742 Bacteria 21301
217 Ga0501080_0130277 3300049742 Bacteria 2328
218 nmdc:mga0yw44_234141_c1 3300050492 Bacteria 1219
219 nmdc:mga05p37_345412_c1 3300050507 Bacteria 1753
220 nmdc:mga05p37_82974_c1 3300050507 Bacteria 3949
221 nmdc:mga09592_18426_c1 3300050508 Bacteria 5727
222 nmdc:mga09592_199120_c1 3300050508 Bacteria 1734
223 nmdc:mga06r32_165420_c1 3300050510 Bacteria 2195
224 nmdc:mga06r32_92466_c1 3300050510 Bacteria 2957
225 nmdc:mga08x19_331017_c1 3300050514 Bacteria 1061
226 nmdc:mga0a205_65610_c1 3300050515 Bacteria 3507
227 Ga0495619_0040749 3300053085 Bacteria 3036
228 Ga0500578_0006070 3300053086 Bacteria 8118
229 Ga0500562_003520 3300053108 Bacteria 3926
230 Ga0500559_0027567 3300053136 Bacteria 2424
231 Ga0500586_048505 3300053145 Bacteria 1460
232 Ga0500588_0003584 3300053146 Bacteria 3290
233 Ga0500588_0014914 3300053146 Bacteria 1979
234 Ga0500616_0000707 3300053153 Bacteria 38750
235 Ga0500616_0004994 3300053153 Bacteria 9198
236 Ga0500616_0121077 3300053153 Bacteria 1250
237 Ga0466962_0000930 3300061719 Bacteria 13260
238 2644018087 2643221601 Bacteria 7493239
239 2644176627 2643221631 Bacteria 8168043
240 2644386995 2643221670 Bacteria 6497041
241 2644434773 2643221677 Bacteria 7584031
242 2644500902 2643221689 Bacteria 6042950
243 2676486682 2675903059 Bacteria 8644972
244 2791914379 2791354901 Bacteria 8322202
245 2793983300 2791355406 Bacteria 11364898
246 2840764333 2840764183 Bacteria 6358399
247 2857471824 2857465823 Bacteria 6772595
248 2857593312 2857591370 Bacteria 6569758
249 2885328595 2885326080 Bacteria 7134805
250 2895430566 2895427314 Bacteria 13147766
251 2899278924 2899275550 Bacteria 3958688
252 2916973359 2916971899 Bacteria 4250608
253 637080342 637000159 Bacteria 7596297
254 8003861622 8003856774 Bacteria 7675274
255 8047895955 8047893842 Bacteria 11723082
256 8048130697 8048127548 Bacteria 11053136
257 8048362980 8048356638 Bacteria 11044339
258 8048372979 8048369669 Bacteria 11666822
259 8048381913 8048379754 Bacteria 11877923
260 8055091697 8055087960 Bacteria 4784273
261 8055096157 8055092621 Bacteria 4873875
262 8056672232 8056667051 Bacteria 6953971
263 Ga0501034_0005189
264 Ga0065707_10000455
265 Ga0065707_10008647
266 Ga0065707_10099833
267 Ga0065707_10147635
268 Ga0070683_100066668
269 Ga0070661_100018511
270 Ga0070668_100012626
271 Ga0070669_100059838
272 Ga0070671_100105399
273 Ga0070659_100033702
274 Ga0070667_100013179
275 Ga0070678_100172201
276 Ga0070698_100019046
277 Ga0070698_100087405
278 Ga0070699_100052671
279 Ga0070699_100295536
280 Ga0070679_100103513
281 Ga0070665_100439575
282 Ga0068854_100101086
283 Ga0070702_100000904
284 Ga0070702_100264561
285 Ga0068859_100194086
286 Ga0068861_100165741
287 Ga0068860_100010065
288 Ga0068862_100274307
289 Ga0081538_10019933
290 Ga0081540_1050327
291 Ga0070712_100163533
292 Ga0075370_10031391
293 Ga0075428_100242273
294 Ga0075431_100127035
295 Ga0075431_100180348
296 Ga0075433_10076728
297 Ga0075434_100102477
298 Ga0075429_100011596
299 Ga0075429_100068320
300 Ga0097620_100194089
301 Ga0079104_1001751
302 Ga0105240_10476178
303 Ga0105245_10185509
304 Ga0105247_10010287
305 Ga0114129_10006706
306 Ga0114129_10009609
307 Ga0114129_10015417
308 Ga0114129_10059554
309 Ga0114129_10308406
310 Ga0114129_10377643
311 Ga0105243_10127700
312 Ga0105243_10420869
313 Ga0105242_10016466
314 Ga0105248_10014544
315 Ga0105249_10079618
316 Ga0105249_10487173
317 Ga0157369_10452485
318 Ga0157378_10002448
319 Ga0157378_10171808
320 Ga0157372_10407646
321 Ga0157380_10026902
322 Ga0157377_10184648
323 Ga0157379_10018507
324 Ga0157376_10222090
325 Ga0157376_10253778
326 Ga0213876_10013894
327 Ga0207426_1015735
328 Ga0207705_10129987
329 Ga0207693_10088763
330 Ga0207660_10083873
331 Ga0207657_10234352
332 Ga0207649_10068662
333 Ga0207681_10099038
334 Ga0207686_10031386
335 Ga0207670_10023401
336 Ga0207711_10046804
337 Ga0207668_10020062
338 Ga0207675_100220778
339 Ga0207683_10000213
340 Ga0207698_10108500
341 Ga0268265_10279446
342 Ga0268265_10284503
343 Ga0307515_10208228
344 Ga0265338_10069318
345 Ga0265338_10129792
346 Ga0265320_10038892
347 Ga0307513_10021174
348 Ga0307508_10000366
349 Ga0265314_10188564
350 Ga0307410_10039315
351 Ga0307406_10116356
352 Ga0307409_100051478
353 Ga0307409_100444525
354 Ga0307414_10037967
355 Ga0307411_10003460
356 Ga0307415_100181292
357 Ga0373944_0006114
358 Ga0373945_0006251
359 Ga0373943_0010769
360 Ga0316574_0038306
361 Ga0316574_0043923
362 Ga0316574_0089046
363 Ga0316574_0218368
364 Ga0373935_0010040
365 Ga0373937_0031647
366 Ga0373937_0045988
367 Ga0373925_0114353
368 Ga0395898_0215836
369 Ga0436364_1517148
370 Ga0395901_0347607
371 Ga0400483_182684
372 Ga0400489_94876
373 Ga0436365_0979564
374 Ga0436363_1201940
375 Ga0439465_0015966
376 Ga0439433_0003985
377 Ga0439457_000030
378 Ga0451577_0144662
379 Ga0451577_0192518
380 Ga0453683_0290735
381 Ga0466961_0035415
382 Ga0466963_0001203
383 Ga0466963_0081718
384 Ga0453684_0002480
385 Ga0453684_0047717
386 Ga0453684_0157683
387 Ga0453684_0187967
388 Ga0453684_0192389
389 Ga0453684_0361531
390 Ga0466957_0002215
391 Ga0466957_0008571
392 Ga0466959_0012529
393 Ga0466959_0058173
394 Ga0451576_0021188
395 Ga0451576_0030877
396 Ga0451576_0049186
397 Ga0451576_0214434
398 Ga0466958_0000475
399 Ga0466958_0003080
400 Ga0466967_0000191
401 Ga0466967_0016195
402 Ga0466967_0298953
403 Ga0495592_0151977
404 Ga0495629_0001341
405 Ga0495629_0009307
406 Ga0495629_0147920
407 Ga0495641_0009724
408 Ga0495651_0004234
409 Ga0495653_0034289
410 Ga0495653_0060785
411 Ga0495582_0014519
412 Ga0495639_0005422
413 Ga0495662_0014283
414 Ga0495662_0103796
415 Ga0495594_0000462
416 Ga0495594_0131400
417 Ga0495607_0000766
418 Ga0495608_0040957
419 Ga0495628_0143234
420 Ga0495630_0168400
421 Ga0495665_0000252
422 Ga0495586_0058176
423 Ga0495622_0019153
424 Ga0495667_0000356
425 Ga0495667_0133567
426 Ga0495634_0136675
427 Ga0495588_0014144
428 Ga0495599_0048226
429 Ga0495647_0023148
430 Ga0495647_0032288
431 Ga0495658_0069861
432 Ga0495613_0003957
433 Ga0495624_0081835
434 Ga0495581_0136950
435 Ga0495674_0000584
436 Ga0495674_0082836
437 Ga0495676_0025333
438 Ga0495676_0037487
439 Ga0495680_0022744
440 Ga0495680_0147188
441 Ga0495684_0146584
442 Ga0495593_0014231
443 Ga0495626_0022286
444 Ga0496100_0008276
445 Ga0496100_0161689
446 Ga0496101_0003445
447 Ga0496102_0008929
448 Ga0496103_0204848
449 Ga0496104_0035074
450 Ga0496104_0084009
451 Ga0496104_0123751
452 Ga0496105_0032584
453 Ga0496105_0043656
454 Ga0496106_0013117
455 Ga0496107_0012179
456 Ga0496108_0133726
457 Ga0496109_0016414
458 Ga0496109_0050161
459 Ga0496109_0236521
460 Ga0496112_0003488
461 Ga0496113_0177106
462 Ga0496114_0003608
463 Ga0496114_0005981
464 Ga0496114_0254128
465 Ga0496115_0040695
466 Ga0496115_0280955
467 Ga0496125_0003957
468 Ga0501041_0106641
469 Ga0501047_0004087
470 Ga0501069_0000030
471 Ga0501069_0031762
472 Ga0501070_0000135
473 Ga0501070_0004637
474 Ga0501071_0218417
475 Ga0501074_0075409
476 Ga0501075_0033871
477 Ga0501075_0145119
478 Ga0501080_0001228
479 Ga0501080_0130277
480 nmdc:mga0yw44_234141_c1
481 nmdc:mga05p37_345412_c1
482 nmdc:mga05p37_82974_c1
483 nmdc:mga09592_18426_c1
484 nmdc:mga09592_199120_c1
485 nmdc:mga06r32_165420_c1
486 nmdc:mga06r32_92466_c1
487 nmdc:mga08x19_331017_c1
488 nmdc:mga0a205_65610_c1
489 Ga0495619_0040749
490 Ga0500578_0006070
491 Ga0500562_003520
492 Ga0500559_0027567
493 Ga0500586_048505
494 Ga0500588_0003584
495 Ga0500588_0014914
496 Ga0500616_0000707
497 Ga0500616_0004994
498 Ga0500616_0121077
499 Ga0466962_0000930
500 2644018087
501 2644176627
502 2644386995
503 2644434773
504 2644500902
505 2676486682
506 2791914379
507 2793983300
508 2840764333
509 2857471824
510 2857593312
511 2885328595
512 2895430566
513 2899278924
514 2916973359
515 637080342
516 8003861622
517 8047895955
518 8048130697
519 8048362980
520 8048372979
521 8048381913
522 8055091697
523 8055096157
524 8056672232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

52

204

0.97

PF08352

oligo_HPY

Oligopeptide/dipeptide transporter, C-terminal region

255

322

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fwi-assembly1.cif.gz_B crystal structure of the nucleotide-binding domain of a dipeptide abc transporter 0.9457 5 338
4fwi-assembly1.cif.gz_B crystal structure of the nucleotide-binding domain of a dipeptide abc transporter 0.9398 5 338
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.936 6 248
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9327 6 279
7z19-assembly1.cif.gz_I e. coli c-p lyase bound to a single phnk abc domain 0.9323 5 270
ID Description Score Start End Superfamily
af_P9WQJ5_2_332_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9698 5 334 3.40.50.300
af_Q2FZR5_3_331_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9655 5 339 3.40.50.300
af_P0AAG0_1_323_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9597 5 334 3.40.50.300
af_I6Y482_6_279_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9581 5 282 3.40.50.300
af_Q2FZR1_3_327_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9579 4 336 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A844W5Y6-F1-model_v4 deleted 0.9806 86 223
AF-A0A352SRK6-F1-model_v4 Peptide ABC transporter ATP-binding protein 0.9793 5 186 GO:0005524
GO:0005886
GO:0016887
AF-A0A537WAU2-F1-model_v4 ABC transporter ATP-binding protein 0.977 23 275 GO:0005524
GO:0005886
GO:0015833
GO:0016887
AF-A0A2J4V5N6-F1-model_v4 deleted 0.9769 100 334
AF-A0A6F8YU69-F1-model_v4 ABC transporter ATP-binding protein 0.9755 5 270 GO:0005524
GO:0016887

Map