F371076

General Info

Members Datasets Scaffolds Average Seq Length
262 193 253 167

Family's Representative Sequence

Representative Sequence 3300012497|Ga0157319_1000008|Ga0157319_1000008219
Length 185
Sequence MPAGVVMQGGAQCTLIIPRMKLVVAVHFDGAQANAAAVAFGAWDSPEPIKTYISPIAPVEKAVRGAVDLREVSCVMQLLREHSLTPELLLIDGFVHLDTDETPGVGRHLYEALGGSIPVVGVSKKSLPGLSAQSEVLREDEAPPLVVTCAGIDIGAAKVRLRSMHGRKRVPTLMKLAARLAKNKE

Samples

Sample ID Description Type Environment
1 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
2 2643221585 Pelomonas sp. Root662 Isolate Unclassified
3 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
4 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
5 2643221656 Pelomonas sp. Root405 Isolate Unclassified
6 2738541337 Pelomonas sp. BT06 Isolate Unclassified
7 2831864461 Roseateles noduli HZ7 Isolate Nodule
8 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
95 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
96 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
108 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
109 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
110 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
111 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
120 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
123 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
124 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
125 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
126 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
127 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
128 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
129 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
130 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
131 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
132 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
133 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
134 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
135 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
167 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
168 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
169 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
170 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
171 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
172 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
173 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
174 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
175 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
176 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
177 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
178 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
179 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
180 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
181 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
182 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
183 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
184 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
185 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
190 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.56
Metatranscriptomes 0
Isolates 3.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.9
Nodule 1.91
Rhizoplane 1.91
Rhizosphere 59.54
Stem 0
Stem Tuber 0
Unclassified 13.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000016 3300002705 Bacteria 178691
2 JGI25154J39366_1002240 3300002738 Bacteria 5306
3 JGI25157J39369_1000035 3300002741 Bacteria 136011
4 rootH1_10007735 3300003316 Bacteria 11211
5 rootH1_10013260 3300003316 Bacteria 4691
6 rootH1_10013261 3300003316 Bacteria 5806
7 rootH1_10019160 3300003316 Bacteria 6430
8 rootH2_10011649 3300003320 Bacteria 8828
9 rootL2_10001664 3300003322 Bacteria 70373
10 rootL2_10006242 3300003322 Bacteria 24377
11 rootL2_10075521 3300003322 Bacteria 7126
12 rootH1_10004509 3300003323 Bacteria 42491
13 rootH1_10010182 3300003323 Bacteria 6189
14 rootH1_10063782 3300003323 Bacteria 7410
15 rootH1_10092301 3300003323 Bacteria 8904
16 rootH1_10096906 3300003323 Bacteria 5421
17 Ga0055539_1000245 3300003752 Bacteria 35164
18 Ga0055539_1000786 3300003752 Bacteria 7573
19 Ga0055533_1000170 3300003756 Bacteria 59228
20 Ga0055525_1000161 3300003759 Bacteria 87478
21 Ga0055535_1000183 3300003761 Bacteria 66520
22 Ga0055529_1000064 3300003763 Bacteria 178831
23 Ga0055526_1002903 3300003771 Bacteria 11291
24 Ga0055524_1000079 3300003775 Bacteria 120203
25 Ga0055524_1000311 3300003775 Bacteria 46317
26 Ga0055524_1012986 3300003775 Bacteria 3167
27 Ga0055530_10004927 3300003791 Bacteria 6614
28 Ga0055530_10005412 3300003791 Bacteria 6088
29 Ga0055530_10049217 3300003791 Bacteria 987
30 Ga0055540_1000004 3300003792 Bacteria 395545
31 Ga0055531_10000052 3300003794 Bacteria 125395
32 Ga0055531_10000936 3300003794 Bacteria 23539
33 Ga0055531_10001348 3300003794 Bacteria 18350
34 Ga0055531_10011584 3300003794 Bacteria 4232
35 Ga0055543_1002867 3300004625 Bacteria 5428
36 Ga0065165_1000851 3300005262 Bacteria 39990
37 Ga0070658_10034877 3300005327 Bacteria 4049
38 Ga0070658_10036603 3300005327 Bacteria 3955
39 Ga0070658_10299614 3300005327 Bacteria 1371
40 Ga0070690_100150564 3300005330 Bacteria 1587
41 Ga0068869_100004667 3300005334 Bacteria 8546
42 Ga0070682_100002922 3300005337 Bacteria 9476
43 Ga0070660_100048281 3300005339 Bacteria 3269
44 Ga0070660_100125602 3300005339 Bacteria 2050
45 Ga0070673_100028876 3300005364 Bacteria 4130
46 Ga0070659_100162826 3300005366 Bacteria 1825
47 Ga0070678_101824845 3300005456 Unclassified 573
48 Ga0070679_100857206 3300005530 Bacteria 852
49 Ga0070686_100289896 3300005544 Unclassified 1210
50 Ga0068855_100002771 3300005563 Bacteria 21564
51 Ga0068855_100152527 3300005563 Bacteria 2627
52 Ga0068855_100225151 3300005563 Bacteria 2102
53 Ga0068855_100898620 3300005563 Bacteria 936
54 Ga0068857_100001122 3300005577 Bacteria 20846
55 Ga0068854_100015238 3300005578 Bacteria 5089
56 Ga0068856_100008665 3300005614 Bacteria 9897
57 Ga0068861_100618343 3300005719 Bacteria 996
58 Ga0068860_100186155 3300005843 Unclassified 2008
59 Ga0068860_100887337 3300005843 Unclassified 907
60 Ga0075370_10000644 3300006353 Bacteria 13522
61 Ga0075370_10074557 3300006353 Bacteria 1945
62 Ga0075429_100003183 3300006880 Bacteria 13955
63 Ga0099823_1000154 3300006944 Bacteria 36546
64 Ga0079104_1000352 3300006946 Bacteria 55479
65 Ga0105240_10040613 3300009093 Bacteria 5948
66 Ga0105240_10141453 3300009093 Bacteria 2877
67 Ga0105240_10793915 3300009093 Bacteria 1026
68 Ga0105240_10985704 3300009093 Bacteria 902
69 Ga0105243_11633748 3300009148 Bacteria 672
70 Ga0105241_10038390 3300009174 Bacteria 3610
71 Ga0105242_10285695 3300009176 Unclassified 1500
72 Ga0105248_11238769 3300009177 Bacteria 844
73 Ga0105237_10187365 3300009545 Bacteria 2069
74 Ga0105238_10032013 3300009551 Bacteria 5352
75 Ga0105238_11339395 3300009551 Bacteria 742
76 Ga0105239_10006299 3300010375 Bacteria 13797
77 Ga0105239_10038548 3300010375 Bacteria 5237
78 Ga0157319_1000008 3300012497 Bacteria 315600
79 Ga0157369_10038132 3300013105 Bacteria 5256
80 Ga0157369_10136039 3300013105 Bacteria 2602
81 Ga0157374_10705593 3300013296 Bacteria 1022
82 Ga0182007_10118793 3300015262 Unclassified 883
83 Ga0209674_100039 3300025226 Bacteria 402292
84 Ga0209563_100088 3300025230 Bacteria 175375
85 Ga0209563_100153 3300025230 Bacteria 65234
86 Ga0209563_106018 3300025230 Bacteria 2128
87 Ga0207427_100604 3300025231 Bacteria 17913
88 Ga0209258_100124 3300025242 Bacteria 178883
89 Ga0209258_100455 3300025242 Bacteria 44644
90 Ga0209646_1000056 3300025246 Bacteria 269860
91 Ga0209026_1000009 3300025250 Bacteria 531812
92 Ga0209677_100217 3300025253 Bacteria 42485
93 Ga0209677_100262 3300025253 Bacteria 35617
94 Ga0209677_101460 3300025253 Bacteria 10212
95 Ga0209148_1003594 3300025254 Bacteria 4172
96 Ga0209759_1000035 3300025256 Bacteria 264254
97 Ga0209759_1001128 3300025256 Bacteria 17161
98 Ga0209759_1022544 3300025256 Bacteria 1405
99 Ga0209455_1000114 3300025272 Bacteria 178883
100 Ga0209673_1005331 3300025273 Bacteria 6506
101 Ga0209675_1011643 3300025291 Bacteria 2901
102 Ga0209564_1000389 3300025295 Bacteria 79321
103 Ga0209050_1000677 3300025298 Bacteria 51357
104 Ga0209050_1001806 3300025298 Bacteria 20922
105 Ga0209050_1013907 3300025298 Bacteria 3524
106 Ga0209050_1014262 3300025298 Bacteria 3441
107 Ga0209256_1000011 3300025299 Bacteria 865309
108 Ga0209256_1000616 3300025299 Bacteria 49183
109 Ga0209256_1001091 3300025299 Bacteria 31214
110 Ga0209051_1000016 3300025303 Bacteria 541891
111 Ga0209051_1003794 3300025303 Bacteria 9679
112 Ga0209051_1007063 3300025303 Bacteria 6211
113 Ga0209051_1015204 3300025303 Bacteria 3552
114 Ga0209257_1000021 3300025304 Bacteria 771986
115 Ga0209257_1000102 3300025304 Bacteria 251074
116 Ga0209257_1000756 3300025304 Bacteria 48782
117 Ga0209257_1001938 3300025304 Bacteria 22335
118 Ga0209257_1002827 3300025304 Bacteria 16303
119 Ga0207705_10737542 3300025909 Bacteria 765
120 Ga0207695_10009617 3300025913 Bacteria 11933
121 Ga0207695_10088999 3300025913 Bacteria 3106
122 Ga0207695_10101649 3300025913 Bacteria 2869
123 Ga0207657_10008754 3300025919 Bacteria 10244
124 Ga0207657_10111435 3300025919 Bacteria 2259
125 Ga0207694_10014417 3300025924 Bacteria 5958
126 Ga0207690_10030573 3300025932 Bacteria 3437
127 Ga0207686_10167154 3300025934 Unclassified 1548
128 Ga0207689_10114145 3300025942 Bacteria 2220
129 Ga0207667_10002601 3300025949 Bacteria 22397
130 Ga0207667_10275520 3300025949 Unclassified 1720
131 Ga0207651_10004184 3300025960 Bacteria 7223
132 Ga0207640_10003565 3300025981 Bacteria 8390
133 Ga0207639_10602807 3300026041 Unclassified 1013
134 Ga0207678_10603170 3300026067 Bacteria 963
135 Ga0207702_10000543 3300026078 Bacteria 42119
136 Ga0207641_10267157 3300026088 Bacteria 1604
137 Ga0207648_10436240 3300026089 Bacteria 1191
138 Ga0207674_10008680 3300026116 Bacteria 11701
139 Ga0207674_10543825 3300026116 Unclassified 1122
140 Ga0207675_100238477 3300026118 Unclassified 1757
141 Ga0209281_1000454 3300027111 Bacteria 58234
142 Ga0209389_1012016 3300027296 Bacteria 7844
143 Ga0209371_1026496 3300027312 Bacteria 1319
144 Ga0268264_10406172 3300028381 Bacteria 1310
145 Ga0268264_10796339 3300028381 Unclassified 944
146 Ga0265336_10000022 3300028666 Bacteria 192716
147 Ga0307515_10029753 3300028794 Bacteria 9212
148 Ga0265324_10000521 3300029957 Bacteria 26404
149 Ga0265324_10141627 3300029957 Bacteria 816
150 Ga0307513_10139715 3300031456 Bacteria 2351
151 Ga0307408_100091975 3300031548 Bacteria 2292
152 Ga0307514_10004667 3300031649 Bacteria 12536
153 Ga0307516_10001956 3300031730 Bacteria 28214
154 Ga0307516_10065814 3300031730 Bacteria 3499
155 Ga0307414_10013004 3300032004 Bacteria 4942
156 Ga0307411_10005745 3300032005 Bacteria 6134
157 Ga0373948_0001358 3300034817 Bacteria 3364
158 Ga0373959_0025940 3300034820 Bacteria 1155
159 Ga0373951_0037358 3300035091 Bacteria 1161
160 Ga0373939_0000050 3300035114 Bacteria 41791
161 Ga0373960_0006428 3300035121 Bacteria 2757
162 Ga0373931_0002340 3300035691 Bacteria 8366
163 Ga0373935_0882193 3300035692 Bacteria 662
164 Ga0395899_0083764 3300037312 Bacteria 2319
165 Ga0395898_0018684 3300037466 Bacteria 7067
166 Ga0395905_0474555 3300037471 Bacteria 1150
167 Ga0395905_0540756 3300037471 Bacteria 1066
168 Ga0395905_0732469 3300037471 Unclassified 891
169 Ga0395901_0001171 3300038443 Bacteria 27879
170 Ga0436361_0749269 3300039447 Bacteria 121408
171 Ga0451793_1043243 3300041452 Bacteria 1247
172 Ga0451849_1056207 3300041505 Bacteria 896
173 Ga0451853_2212591 3300041512 Bacteria 1133
174 Ga0439437_015438 3300042000 Bacteria 898
175 Ga0439445_0072915 3300042004 Bacteria 952
176 Ga0439449_0120803 3300042007 Bacteria 973
177 Ga0450890_000565 3300042127 Bacteria 5402
178 Ga0450890_081707 3300042127 Bacteria 528
179 Ga0450891_000619 3300042129 Bacteria 3694
180 Ga0450892_000419 3300042130 Bacteria 5033
181 Ga0450898_038452 3300042134 Bacteria 898
182 Ga0450900_036941 3300042136 Bacteria 722
183 Ga0450902_020576 3300042137 Bacteria 1087
184 Ga0450903_011960 3300042138 Bacteria 1392
185 Ga0450889_003041 3300042144 Bacteria 1658
186 Ga0450909_083193 3300042185 Bacteria 520
187 Ga0439459_0002698 3300042438 Bacteria 2758
188 Ga0439459_0093426 3300042438 Unclassified 726
189 Ga0450893_0001629 3300042532 Bacteria 3449
190 Ga0466969_0041521 3300044656 Bacteria 2300
191 Ga0466965_0004223 3300044683 Bacteria 6382
192 Ga0466966_0002396 3300044684 Bacteria 12243
193 Ga0466971_0002021 3300044719 Bacteria 8583
194 Ga0466968_0049098 3300044735 Bacteria 1797
195 Ga0466970_0028940 3300044765 Bacteria 2914
196 Ga0466957_0006923 3300044842 Bacteria 6409
197 Ga0466959_0021294 3300045049 Bacteria 4780
198 Ga0451576_0213453 3300045051 Bacteria 2015
199 Ga0451576_0555363 3300045051 Bacteria 1206
200 Ga0466967_0017142 3300045976 Bacteria 5739
201 Ga0466967_0222012 3300045976 Bacteria 1796
202 Ga0495651_0118820 3300046462 Bacteria 1945
203 Ga0495650_0010401 3300046471 Bacteria 5193
204 Ga0495650_0034544 3300046471 Bacteria 2236
205 Ga0495583_0000123 3300046506 Bacteria 131122
206 Ga0495606_0002067 3300046507 Bacteria 24517
207 Ga0495630_0631296 3300046517 Bacteria 821
208 Ga0495632_0321967 3300046519 Bacteria 683
209 Ga0495668_0064629 3300046616 Bacteria 2014
210 Ga0495625_0004572 3300046660 Bacteria 13016
211 Ga0495669_0094138 3300046684 Bacteria 1386
212 Ga0495670_0026368 3300046691 Bacteria 2876
213 Ga0495649_0001360 3300046694 Bacteria 18578
214 Ga0495589_0028465 3300046794 Bacteria 2820
215 Ga0495683_0224872 3300047323 Bacteria 835
216 Ga0495686_0027337 3300047472 Bacteria 3726
217 Ga0496101_0514272 3300048904 Bacteria 946
218 Ga0496104_0043056 3300048907 Bacteria 4240
219 Ga0496109_0329688 3300048912 Bacteria 1441
220 Ga0496112_0382706 3300048915 Bacteria 1348
221 Ga0496124_0114292 3300048927 Bacteria 2168
222 Ga0496126_0120517 3300048929 Bacteria 2276
223 Ga0501294_002453 3300049517 Bacteria 1757
224 Ga0501296_011646 3300049519 Bacteria 1054
225 Ga0501300_001574 3300049523 Bacteria 3426
226 Ga0501201_004727 3300049651 Bacteria 1266
227 Ga0501202_010788 3300049652 Bacteria 1701
228 Ga0501206_027930 3300049653 Bacteria 828
229 Ga0501211_000237 3300049658 Bacteria 4836
230 Ga0501223_009883 3300049663 Bacteria 1925
231 Ga0501227_012781 3300049665 Bacteria 1842
232 Ga0501233_001967 3300049668 Bacteria 3575
233 Ga0501242_023678 3300049674 Bacteria 802
234 Ga0501255_011626 3300049684 Bacteria 1018
235 Ga0501259_037111 3300049688 Bacteria 945
236 Ga0501232_026749 3300049757 Bacteria 778
237 Ga0501265_005770 3300049762 Bacteria 1434
238 Ga0501267_000185 3300049764 Bacteria 4327
239 Ga0501269_005034 3300049766 Bacteria 1589
240 Ga0501274_006597 3300049771 Bacteria 1004
241 Ga0501282_003619 3300049778 Bacteria 1666
242 Ga0501212_083909 3300049851 Bacteria 580
243 nmdc:mga07m45_111992_c1 3300050496 Bacteria 1572
244 nmdc:mga07m45_240146_c1 3300050496 Bacteria 1054
245 nmdc:mga07m45_8272_c1 3300050496 Bacteria 5340
246 nmdc:mga05p37_777196_c1 3300050507 Bacteria 1051
247 nmdc:mga09592_432483_c1 3300050508 Unclassified 1136
248 nmdc:mga09592_4372_c1 3300050508 Bacteria 11425
249 Ga0500635_0000242 3300053080 Bacteria 23931
250 Ga0500559_0017847 3300053136 Bacteria 3000
251 Ga0500622_0002571 3300053156 Bacteria 13005
252 Ga0500636_0019648 3300053177 Bacteria 3996
253 Ga0466962_0125847 3300061719 Bacteria 1237

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10013004 Ga0307414_100130042 144
2 3300032005 Ga0307411_10005745 Ga0307411_100057451 144
3 3300050496 nmdc:mga07m45_240146_c1 nmdc:mga07m45_240146_c1_350_871 146
4 3300042127 Ga0450890_081707 Ga0450890_081707_16_465 149
5 3300003791 Ga0055530_10049217 Ga0055530_100492171 153
6 3300003794 Ga0055531_10000052 Ga0055531_1000005241 153
7 3300025298 Ga0209050_1001806 Ga0209050_100180614 153
8 3300025303 Ga0209051_1015204 Ga0209051_10152045 153
9 3300025304 Ga0209257_1000021 Ga0209257_1000021626 153
10 3300045051 Ga0451576_0213453 Ga0451576_0213453_618_1118 154
11 3300049517 Ga0501294_002453 Ga0501294_002453_432_932 154
12 3300049519 Ga0501296_011646 Ga0501296_011646_472_972 154
13 3300049523 Ga0501300_001574 Ga0501300_001574_1140_1640 154
14 3300049651 Ga0501201_004727 Ga0501201_004727_612_1112 154
15 3300049652 Ga0501202_010788 Ga0501202_010788_587_1087 154
16 3300049653 Ga0501206_027930 Ga0501206_027930_214_714 154
17 3300049658 Ga0501211_000237 Ga0501211_000237_2473_2973 154
18 3300049663 Ga0501223_009883 Ga0501223_009883_444_944 154
19 3300049668 Ga0501233_001967 Ga0501233_001967_1739_2239 154
20 3300049674 Ga0501242_023678 Ga0501242_023678_246_746 154
21 3300049684 Ga0501255_011626 Ga0501255_011626_281_781 154
22 3300049688 Ga0501259_037111 Ga0501259_037111_178_678 154
23 3300049757 Ga0501232_026749 Ga0501232_026749_150_650 154
24 3300049762 Ga0501265_005770 Ga0501265_005770_276_776 154
25 3300049764 Ga0501267_000185 Ga0501267_000185_178_678 154
26 3300049766 Ga0501269_005034 Ga0501269_005034_475_975 154
27 3300049771 Ga0501274_006597 Ga0501274_006597_412_912 154
28 3300049778 Ga0501282_003619 Ga0501282_003619_919_1419 154
29 3300049851 Ga0501212_083909 Ga0501212_083909_36_536 154
30 3300049665 Ga0501227_012781 Ga0501227_012781_789_1289 157
31 3300034817 Ga0373948_0001358 Ga0373948_0001358_2037_2537 158
32 3300035091 Ga0373951_0037358 Ga0373951_0037358_412_912 158
33 3300035114 Ga0373939_0000050 Ga0373939_0000050_9315_9815 158
34 3300035121 Ga0373960_0006428 Ga0373960_0006428_1410_1910 158
35 3300035691 Ga0373931_0002340 Ga0373931_0002340_3949_4449 158
36 3300045051 Ga0451576_0555363 Ga0451576_0555363_29_517 161
37 iso_pu_bacteria 2643221544 2643744480 162
38 iso_pu_bacteria 2643221585 2643934781 162
39 iso_pu_bacteria 2643221639 2644220121 162
40 iso_pu_bacteria 2643221646 2644261134 162
41 iso_pu_bacteria 2643221656 2644316268 162
42 iso_pu_bacteria 2738541337 2739057323 162
43 iso_pu_bacteria 2831864461 2831867344 162
44 iso_pu_bacteria 2886848708 2886850100 162
45 iso_pu_bacteria 2886848708 2886851605 162
46 3300042185 Ga0450909_083193 Ga0450909_083193_11_502 163
47 3300003316 rootH1_10019160 rootH1_100191605 164
48 3300003322 rootL2_10001664 rootL2_1000166437 165
49 3300005843 Ga0068860_100887337 Ga0068860_1008873372 165
50 3300028381 Ga0268264_10796339 Ga0268264_107963392 165
51 3300003316 rootH1_10007735 rootH1_100077356 166
52 3300003322 rootL2_10006242 rootL2_1000624212 166
53 3300003323 rootH1_10004509 rootH1_1000450919 166
54 3300003323 rootH1_10010182 rootH1_100101824 166
55 3300003771 Ga0055526_1002903 Ga0055526_10029036 166
56 3300003775 Ga0055524_1000079 Ga0055524_100007969 166
57 3300003775 Ga0055524_1000311 Ga0055524_100031141 166
58 3300003775 Ga0055524_1012986 Ga0055524_10129862 166
59 3300003791 Ga0055530_10004927 Ga0055530_100049272 166
60 3300003791 Ga0055530_10005412 Ga0055530_100054125 166
61 3300003792 Ga0055540_1000004 Ga0055540_1000004169 166
62 3300003794 Ga0055531_10000936 Ga0055531_1000093617 166
63 3300003794 Ga0055531_10001348 Ga0055531_1000134820 166
64 3300003794 Ga0055531_10011584 Ga0055531_100115843 166
65 3300004625 Ga0055543_1002867 Ga0055543_10028672 166
66 3300005262 Ga0065165_1000851 Ga0065165_10008517 166
67 3300005337 Ga0070682_100002922 Ga0070682_1000029224 166
68 3300006353 Ga0075370_10000644 Ga0075370_100006444 166
69 3300006353 Ga0075370_10074557 Ga0075370_100745572 166
70 3300006944 Ga0099823_1000154 Ga0099823_100015415 166
71 3300006946 Ga0079104_1000352 Ga0079104_10003521 166
72 3300012497 Ga0157319_1000008 Ga0157319_1000008219 166
73 3300025273 Ga0209673_1005331 Ga0209673_10053316 166
74 3300025291 Ga0209675_1011643 Ga0209675_10116432 166
75 3300025295 Ga0209564_1000389 Ga0209564_100038928 166
76 3300025298 Ga0209050_1000677 Ga0209050_100067734 166
77 3300025298 Ga0209050_1013907 Ga0209050_10139074 166
78 3300025298 Ga0209050_1014262 Ga0209050_10142624 166
79 3300025299 Ga0209256_1000011 Ga0209256_100001170 166
80 3300025299 Ga0209256_1000616 Ga0209256_10006165 166
81 3300025299 Ga0209256_1001091 Ga0209256_100109111 166
82 3300025303 Ga0209051_1000016 Ga0209051_1000016262 166
83 3300025303 Ga0209051_1007063 Ga0209051_10070633 166
84 3300025304 Ga0209257_1000102 Ga0209257_100010231 166
85 3300025304 Ga0209257_1000756 Ga0209257_100075644 166
86 3300025304 Ga0209257_1001938 Ga0209257_100193817 166
87 3300025304 Ga0209257_1002827 Ga0209257_100282711 166
88 3300026089 Ga0207648_10436240 Ga0207648_104362403 166
89 3300027111 Ga0209281_1000454 Ga0209281_100045456 166
90 3300027296 Ga0209389_1012016 Ga0209389_10120166 166
91 3300027312 Ga0209371_1026496 Ga0209371_10264962 166
92 3300028794 Ga0307515_10029753 Ga0307515_100297534 166
93 3300031548 Ga0307408_100091975 Ga0307408_1000919752 166
94 3300039447 Ga0436361_0749269 Ga0436361_0749269_65196_65696 166
95 3300041505 Ga0451849_1056207 Ga0451849_1056207_81_581 166
96 3300042000 Ga0439437_015438 Ga0439437_015438_204_761 166
97 3300042127 Ga0450890_000565 Ga0450890_000565_1773_2273 166
98 3300042129 Ga0450891_000619 Ga0450891_000619_210_710 166
99 3300042130 Ga0450892_000419 Ga0450892_000419_184_684 166
100 3300042136 Ga0450900_036941 Ga0450900_036941_72_572 166
101 3300042137 Ga0450902_020576 Ga0450902_020576_476_976 166
102 3300042138 Ga0450903_011960 Ga0450903_011960_877_1377 166
103 3300042144 Ga0450889_003041 Ga0450889_003041_614_1114 166
104 3300042438 Ga0439459_0002698 Ga0439459_0002698_16_573 166
105 3300042438 Ga0439459_0093426 Ga0439459_0093426_216_716 166
106 3300042532 Ga0450893_0001629 Ga0450893_0001629_2764_3264 166
107 3300046691 Ga0495670_0026368 Ga0495670_0026368_2221_2721 166
108 3300048927 Ga0496124_0114292 Ga0496124_0114292_168_668 166
109 3300048929 Ga0496126_0120517 Ga0496126_0120517_329_829 166
110 3300050496 nmdc:mga07m45_111992_c1 nmdc:mga07m45_111992_c1_711_1268 166
111 3300050496 nmdc:mga07m45_8272_c1 nmdc:mga07m45_8272_c1_1072_1572 166
112 3300053156 Ga0500622_0002571 Ga0500622_0002571_3591_4091 166
113 3300003759 Ga0055525_1000161 Ga0055525_100016147 167
114 3300005456 Ga0070678_101824845 Ga0070678_1018248451 167
115 3300006880 Ga0075429_100003183 Ga0075429_1000031835 167
116 3300009177 Ga0105248_11238769 Ga0105248_112387692 167
117 3300010375 Ga0105239_10006299 Ga0105239_100062995 167
118 3300013105 Ga0157369_10136039 Ga0157369_101360392 167
119 3300025230 Ga0209563_100088 Ga0209563_10008845 167
120 3300025303 Ga0209051_1003794 Ga0209051_10037943 167
121 3300025913 Ga0207695_10009617 Ga0207695_1000961711 167
122 3300025924 Ga0207694_10014417 Ga0207694_100144172 167
123 3300026088 Ga0207641_10267157 Ga0207641_102671572 167
124 3300029957 Ga0265324_10141627 Ga0265324_101416272 167
125 3300031456 Ga0307513_10139715 Ga0307513_101397153 167
126 3300037471 Ga0395905_0474555 Ga0395905_0474555_63_566 167
127 3300042004 Ga0439445_0072915 Ga0439445_0072915_416_919 167
128 3300042007 Ga0439449_0120803 Ga0439449_0120803_402_905 167
129 3300042134 Ga0450898_038452 Ga0450898_038452_291_794 167
130 3300044656 Ga0466969_0041521 Ga0466969_0041521_1085_1588 167
131 3300044683 Ga0466965_0004223 Ga0466965_0004223_5806_6309 167
132 3300044684 Ga0466966_0002396 Ga0466966_0002396_10953_11456 167
133 3300044719 Ga0466971_0002021 Ga0466971_0002021_5906_6409 167
134 3300044735 Ga0466968_0049098 Ga0466968_0049098_898_1401 167
135 3300044765 Ga0466970_0028940 Ga0466970_0028940_2204_2707 167
136 3300045049 Ga0466959_0021294 Ga0466959_0021294_676_1179 167
137 3300046471 Ga0495650_0034544 Ga0495650_0034544_1147_1650 167
138 3300048907 Ga0496104_0043056 Ga0496104_0043056_3561_4064 167
139 3300048912 Ga0496109_0329688 Ga0496109_0329688_268_771 167
140 3300050507 nmdc:mga05p37_777196_c1 nmdc:mga05p37_777196_c1_408_911 167
141 3300050508 nmdc:mga09592_432483_c1 nmdc:mga09592_432483_c1_578_1099 167
142 3300050508 nmdc:mga09592_4372_c1 nmdc:mga09592_4372_c1_1952_2455 167
143 3300061719 Ga0466962_0125847 Ga0466962_0125847_515_1018 167
144 3300003761 Ga0055535_1000183 Ga0055535_100018358 168
145 3300003763 Ga0055529_1000064 Ga0055529_1000064111 168
146 3300025242 Ga0209258_100124 Ga0209258_10012468 168
147 3300025254 Ga0209148_1003594 Ga0209148_10035944 168
148 3300025256 Ga0209759_1001128 Ga0209759_100112810 168
149 3300025272 Ga0209455_1000114 Ga0209455_1000114111 168
150 3300028666 Ga0265336_10000022 Ga0265336_10000022121 168
151 3300029957 Ga0265324_10000521 Ga0265324_1000052113 168
152 3300031649 Ga0307514_10004667 Ga0307514_100046677 168
153 3300031730 Ga0307516_10001956 Ga0307516_100019568 168
154 3300037471 Ga0395905_0540756 Ga0395905_0540756_178_684 168
155 3300041452 Ga0451793_1043243 Ga0451793_1043243_625_1131 168
156 3300041512 Ga0451853_2212591 Ga0451853_2212591_143_649 168
157 3300044842 Ga0466957_0006923 Ga0466957_0006923_1325_1831 168
158 3300045976 Ga0466967_0017142 Ga0466967_0017142_913_1419 168
159 3300045976 Ga0466967_0222012 Ga0466967_0222012_1124_1630 168
160 3300046462 Ga0495651_0118820 Ga0495651_0118820_941_1447 168
161 3300046471 Ga0495650_0010401 Ga0495650_0010401_3564_4070 168
162 3300046517 Ga0495630_0631296 Ga0495630_0631296_10_516 168
163 3300053136 Ga0500559_0017847 Ga0500559_0017847_2421_2927 168
164 3300031730 Ga0307516_10065814 Ga0307516_100658142 169
165 3300002705 JGI25156J39149_1000016 JGI25156J39149_100001646 170
166 3300002738 JGI25154J39366_1002240 JGI25154J39366_10022404 170
167 3300002741 JGI25157J39369_1000035 JGI25157J39369_100003592 170
168 3300003316 rootH1_10013260 rootH1_100132606 170
169 3300003316 rootH1_10013261 rootH1_100132615 170
170 3300003320 rootH2_10011649 rootH2_100116497 170
171 3300003322 rootL2_10075521 rootL2_100755218 170
172 3300003323 rootH1_10063782 rootH1_100637823 170
173 3300003323 rootH1_10092301 rootH1_100923018 170
174 3300003323 rootH1_10096906 rootH1_100969064 170
175 3300003752 Ga0055539_1000245 Ga0055539_10002456 170
176 3300003752 Ga0055539_1000786 Ga0055539_10007863 170
177 3300003756 Ga0055533_1000170 Ga0055533_100017049 170
178 3300005327 Ga0070658_10034877 Ga0070658_100348773 170
179 3300005327 Ga0070658_10036603 Ga0070658_100366034 170
180 3300005327 Ga0070658_10299614 Ga0070658_102996142 170
181 3300005330 Ga0070690_100150564 Ga0070690_1001505643 170
182 3300005334 Ga0068869_100004667 Ga0068869_1000046678 170
183 3300005339 Ga0070660_100048281 Ga0070660_1000482812 170
184 3300005339 Ga0070660_100125602 Ga0070660_1001256023 170
185 3300005364 Ga0070673_100028876 Ga0070673_1000288766 170
186 3300005366 Ga0070659_100162826 Ga0070659_1001628263 170
187 3300005530 Ga0070679_100857206 Ga0070679_1008572062 170
188 3300005544 Ga0070686_100289896 Ga0070686_1002898962 170
189 3300005563 Ga0068855_100002771 Ga0068855_10000277118 170
190 3300005563 Ga0068855_100152527 Ga0068855_1001525273 170
191 3300005563 Ga0068855_100225151 Ga0068855_1002251512 170
192 3300005563 Ga0068855_100898620 Ga0068855_1008986202 170
193 3300005577 Ga0068857_100001122 Ga0068857_10000112218 170
194 3300005578 Ga0068854_100015238 Ga0068854_1000152383 170
195 3300005614 Ga0068856_100008665 Ga0068856_1000086652 170
196 3300005719 Ga0068861_100618343 Ga0068861_1006183432 170
197 3300005843 Ga0068860_100186155 Ga0068860_1001861553 170
198 3300009093 Ga0105240_10040613 Ga0105240_100406135 170
199 3300009093 Ga0105240_10141453 Ga0105240_101414533 170
200 3300009093 Ga0105240_10793915 Ga0105240_107939151 170
201 3300009093 Ga0105240_10985704 Ga0105240_109857042 170
202 3300009148 Ga0105243_11633748 Ga0105243_116337481 170
203 3300009174 Ga0105241_10038390 Ga0105241_100383902 170
204 3300009176 Ga0105242_10285695 Ga0105242_102856951 170
205 3300009545 Ga0105237_10187365 Ga0105237_101873653 170
206 3300009551 Ga0105238_10032013 Ga0105238_100320134 170
207 3300009551 Ga0105238_11339395 Ga0105238_113393952 170
208 3300010375 Ga0105239_10038548 Ga0105239_100385483 170
209 3300013105 Ga0157369_10038132 Ga0157369_100381323 170
210 3300013296 Ga0157374_10705593 Ga0157374_107055932 170
211 3300015262 Ga0182007_10118793 Ga0182007_101187932 170
212 3300025226 Ga0209674_100039 Ga0209674_100039378 170
213 3300025230 Ga0209563_100153 Ga0209563_10015349 170
214 3300025230 Ga0209563_106018 Ga0209563_1060182 170
215 3300025231 Ga0207427_100604 Ga0207427_10060415 170
216 3300025242 Ga0209258_100455 Ga0209258_10045518 170
217 3300025246 Ga0209646_1000056 Ga0209646_1000056229 170
218 3300025250 Ga0209026_1000009 Ga0209026_1000009429 170
219 3300025253 Ga0209677_100217 Ga0209677_10021737 170
220 3300025253 Ga0209677_100262 Ga0209677_1002627 170
221 3300025253 Ga0209677_101460 Ga0209677_1014604 170
222 3300025256 Ga0209759_1000035 Ga0209759_100003534 170
223 3300025256 Ga0209759_1022544 Ga0209759_10225441 170
224 3300025909 Ga0207705_10737542 Ga0207705_107375421 170
225 3300025913 Ga0207695_10088999 Ga0207695_100889992 170
226 3300025913 Ga0207695_10101649 Ga0207695_101016493 170
227 3300025919 Ga0207657_10008754 Ga0207657_100087547 170
228 3300025919 Ga0207657_10111435 Ga0207657_101114353 170
229 3300025932 Ga0207690_10030573 Ga0207690_100305736 170
230 3300025934 Ga0207686_10167154 Ga0207686_101671542 170
231 3300025942 Ga0207689_10114145 Ga0207689_101141452 170
232 3300025949 Ga0207667_10002601 Ga0207667_1000260111 170
233 3300025949 Ga0207667_10275520 Ga0207667_102755203 170
234 3300025960 Ga0207651_10004184 Ga0207651_100041844 170
235 3300025981 Ga0207640_10003565 Ga0207640_100035657 170
236 3300026041 Ga0207639_10602807 Ga0207639_106028072 170
237 3300026067 Ga0207678_10603170 Ga0207678_106031701 170
238 3300026078 Ga0207702_10000543 Ga0207702_1000054329 170
239 3300026116 Ga0207674_10008680 Ga0207674_100086802 170
240 3300026116 Ga0207674_10543825 Ga0207674_105438252 170
241 3300026118 Ga0207675_100238477 Ga0207675_1002384773 170
242 3300028381 Ga0268264_10406172 Ga0268264_104061723 170
243 3300034820 Ga0373959_0025940 Ga0373959_0025940_389_901 170
244 3300035692 Ga0373935_0882193 Ga0373935_0882193_21_533 170
245 3300037312 Ga0395899_0083764 Ga0395899_0083764_1211_1723 170
246 3300037466 Ga0395898_0018684 Ga0395898_0018684_718_1230 170
247 3300037471 Ga0395905_0732469 Ga0395905_0732469_99_611 170
248 3300038443 Ga0395901_0001171 Ga0395901_0001171_14685_15197 170
249 3300046506 Ga0495583_0000123 Ga0495583_0000123_49396_49908 170
250 3300046507 Ga0495606_0002067 Ga0495606_0002067_8567_9079 170
251 3300046519 Ga0495632_0321967 Ga0495632_0321967_67_579 170
252 3300046616 Ga0495668_0064629 Ga0495668_0064629_689_1201 170
253 3300046660 Ga0495625_0004572 Ga0495625_0004572_5980_6492 170
254 3300046684 Ga0495669_0094138 Ga0495669_0094138_24_536 170
255 3300046694 Ga0495649_0001360 Ga0495649_0001360_13445_13957 170
256 3300046794 Ga0495589_0028465 Ga0495589_0028465_243_755 170
257 3300047323 Ga0495683_0224872 Ga0495683_0224872_57_569 170
258 3300047472 Ga0495686_0027337 Ga0495686_0027337_2932_3444 170
259 3300048904 Ga0496101_0514272 Ga0496101_0514272_106_618 170
260 3300048915 Ga0496112_0382706 Ga0496112_0382706_213_725 170
261 3300053080 Ga0500635_0000242 Ga0500635_0000242_14987_15499 170
262 3300053177 Ga0500636_0019648 Ga0500636_0019648_2902_3414 170

Structural Annotation

Top 5 Hits

ID Description Score Start End
3goc-assembly1.cif.gz_A crystal structure of the endonuclease v (sav1684) from streptomyces avermitilis. northeast structural genomics consortium target svr196 0.8164 3 167
3goc-assembly1.cif.gz_A crystal structure of the endonuclease v (sav1684) from streptomyces avermitilis. northeast structural genomics consortium target svr196 0.7899 3 167
6ozi-assembly1.cif.gz_B crystal structure of ciona intestinalis (ci) endonuclease v (d234n) in complex with a 23mer dna containing an inosine followed by a ribo-adenosine 0.7872 2 167
5aoy-assembly1.cif.gz_A structure of mouse endonuclease v 0.785 2 168
6ozh-assembly2.cif.gz_D crystal structure of ciona intestinalis (ci) endonuclease v in complex with a 24mer dna containing an inosine followed by a ribo-adenosine 0.78 2 167
ID Description Score Start End Superfamily
3gocB00 Alpha Beta;2-Layer Sandwich;archaeoglobus fulgidus dsm 4304 fold;archaeoglobus fulgidus dsm 4304 superfamily 0.8187 3 167 3.30.2170.10
3gocB00 Alpha Beta;2-Layer Sandwich;archaeoglobus fulgidus dsm 4304 fold;archaeoglobus fulgidus dsm 4304 superfamily 0.792 3 167 3.30.2170.10
af_Q10348_2_245_3.30.2170.10 Alpha Beta;2-Layer Sandwich;archaeoglobus fulgidus dsm 4304 fold;archaeoglobus fulgidus dsm 4304 superfamily 0.7886 2 170 3.30.2170.10
1mgtA01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Methylated DNA-protein cysteine methyltransferase domain 0.7812 3 35 3.30.160.70
af_Q10348_2_245_3.30.2170.10 Alpha Beta;2-Layer Sandwich;archaeoglobus fulgidus dsm 4304 fold;archaeoglobus fulgidus dsm 4304 superfamily 0.7802 2 170 3.30.2170.10
ID Description Score Start End GO Terms
AF-A0A1I6K9W1-F1-model_v4 Endonuclease V 0.9763 2 165 GO:0004519
AF-A0A519EEK8-F1-model_v4 Endonuclease V 0.9723 2 168 GO:0004519
GO:0006281
AF-A0A0Q8GJM4-F1-model_v4 Endonuclease V 0.9699 1 168
AF-A0A0Q8GJM4-F1-model_v4 Endonuclease V 0.9642 1 168
AF-A0A1J1E5G8-F1-model_v4 deleted 0.9553 1 166

Feature Viewer

pLDDT pTM Quality
95.03 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map