F368684

General Info

Members Datasets Scaffolds Average Seq Length
259 166 518 206

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100000074|Ga0068858_10000007447
Length 216
Sequence MTVIDELSTSVAHASTVQEIDFWFDPMCPWAWMASRWVLEVEKVRPIKARWHVMSLSVLNEGRDIAPEHRDAMAKGWGPVRVAIAAEQRYGSKVLLPLYTAFGERIHLAQRKDRDRAFHEEVLAAAGLPADLAGAAESTEYDDALRASHHDGMDRVGYDVGTPVISVGGVSFFGPVVTPAPKGEAAGRLWDGVVLVASTPGFYELKRSRDLGPIFD

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
43 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
68 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
69 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
79 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
80 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
81 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
84 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
109 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
162 2773857933 Frankia sp. BMG5.30 Isolate Nodule
163 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
164 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
165 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
166 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.73
Metatranscriptomes 7.34
Isolates 1.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0.39
Rhizoplane 11.58
Rhizosphere 82.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100000074 3300005842 Bacteria 104483
2 Ga0006778J45830_1028525 3300003162 Bacteria 795
3 Ga0006778J45830_1053548 3300003162 Bacteria 706
4 Ga0006759J45824_1067379 3300003163 Bacteria 713
5 rootH2_10016354 3300003320 Bacteria 5107
6 Ga0007416J51690_1057042 3300003577 Bacteria 765
7 Ga0007429J51699_1021537 3300003579 Bacteria 917
8 Ga0007429J51699_1037445 3300003579 Bacteria 701
9 Ga0032354_1021511 3300003693 Bacteria 894
10 Ga0058861_12041684 3300004800 Bacteria 960
11 Ga0070658_10066120 3300005327 Bacteria 2953
12 Ga0070658_10203156 3300005327 Bacteria 1672
13 Ga0070658_10446856 3300005327 Bacteria 1113
14 Ga0070683_100136983 3300005329 Bacteria 2319
15 Ga0070690_100059499 3300005330 Bacteria 2456
16 Ga0070680_100003195 3300005336 Bacteria 12182
17 Ga0070680_100179018 3300005336 Bacteria 1786
18 Ga0070680_100763485 3300005336 Bacteria 833
19 Ga0068868_100008161 3300005338 Bacteria 7493
20 Ga0068868_100115969 3300005338 Bacteria 2181
21 Ga0070660_100063196 3300005339 Bacteria 2878
22 Ga0070660_100098363 3300005339 Bacteria 2316
23 Ga0070660_100110971 3300005339 Bacteria 2182
24 Ga0070660_100276359 3300005339 Bacteria 1374
25 Ga0070692_10041753 3300005345 Bacteria 2352
26 Ga0070714_100356394 3300005435 Bacteria 1375
27 Ga0070663_100288149 3300005455 Bacteria 1311
28 Ga0070681_10000028 3300005458 Bacteria 104446
29 Ga0070681_10024395 3300005458 Bacteria 6088
30 Ga0070681_10130071 3300005458 Bacteria 2450
31 Ga0070681_10503343 3300005458 Bacteria 1124
32 Ga0070681_10764769 3300005458 Bacteria 883
33 Ga0068867_100421815 3300005459 Bacteria 1130
34 Ga0070679_100000095 3300005530 Bacteria 67964
35 Ga0070679_100001427 3300005530 Bacteria 21122
36 Ga0070679_100018238 3300005530 Bacteria 6807
37 Ga0070679_100379812 3300005530 Bacteria 1360
38 Ga0070679_100722486 3300005530 Bacteria 939
39 Ga0070684_100048783 3300005535 Bacteria 3674
40 Ga0070684_100090678 3300005535 Bacteria 2718
41 Ga0070686_100067535 3300005544 Bacteria 2330
42 Ga0070696_100005196 3300005546 Bacteria 8702
43 Ga0070712_100723559 3300006175 Bacteria 850
44 Ga0097621_100646179 3300006237 Bacteria 970
45 Ga0068871_100921341 3300006358 Bacteria 811
46 Ga0105240_10426615 3300009093 Bacteria 1489
47 Ga0105245_10189477 3300009098 Bacteria 1969
48 Ga0105245_10206152 3300009098 Bacteria 1890
49 Ga0105243_10611123 3300009148 Bacteria 1051
50 Ga0105242_10217989 3300009176 Bacteria 1704
51 Ga0105242_10276217 3300009176 Bacteria 1524
52 Ga0105248_10000329 3300009177 Bacteria 55993
53 Ga0105248_10196601 3300009177 Bacteria 2272
54 Ga0105238_11426739 3300009551 Bacteria 720
55 Ga0105239_11394328 3300010375 Bacteria 809
56 Ga0157371_10033790 3300013102 Bacteria 3673
57 Ga0157369_10002391 3300013105 Bacteria 22536
58 Ga0157369_10124671 3300013105 Bacteria 2732
59 Ga0157369_10179338 3300013105 Bacteria 2229
60 Ga0157369_10327169 3300013105 Bacteria 1593
61 Ga0157369_10470566 3300013105 Bacteria 1301
62 Ga0157372_10219338 3300013307 Bacteria 2205
63 Ga0157372_10840774 3300013307 Bacteria 1066
64 Ga0163163_10026934 3300014325 Bacteria 5500
65 Ga0163163_10063765 3300014325 Bacteria 3655
66 Ga0163163_10269457 3300014325 Bacteria 1754
67 Ga0157379_10000011 3300014968 Bacteria 111920
68 Ga0197907_10294872 3300020069 Bacteria 803
69 Ga0206356_10687806 3300020070 Bacteria 963
70 Ga0206349_1763356 3300020075 Bacteria 741
71 Ga0206355_1574784 3300020076 Bacteria 909
72 Ga0206350_10594316 3300020080 Bacteria 971
73 Ga0206350_11080218 3300020080 Bacteria 1020
74 Ga0206354_10951108 3300020081 Bacteria 1582
75 Ga0154015_1360204 3300020610 Bacteria 2695
76 Ga0224712_10065638 3300022467 Bacteria 1459
77 Ga0207647_10038108 3300025904 Bacteria 3042
78 Ga0207705_10250688 3300025909 Bacteria 1350
79 Ga0207705_10362169 3300025909 Bacteria 1118
80 Ga0207705_10492949 3300025909 Bacteria 951
81 Ga0207707_10000172 3300025912 Bacteria 67443
82 Ga0207707_10023631 3300025912 Bacteria 5376
83 Ga0207707_10049563 3300025912 Bacteria 3659
84 Ga0207707_10236293 3300025912 Bacteria 1590
85 Ga0207707_10305207 3300025912 Bacteria 1376
86 Ga0207660_10002441 3300025917 Bacteria 12206
87 Ga0207660_10079518 3300025917 Bacteria 2405
88 Ga0207657_10090755 3300025919 Bacteria 2549
89 Ga0207657_10118142 3300025919 Bacteria 2183
90 Ga0207652_10000092 3300025921 Bacteria 98391
91 Ga0207652_10047438 3300025921 Bacteria 3669
92 Ga0207652_10139692 3300025921 Bacteria 2166
93 Ga0207652_10401854 3300025921 Bacteria 1236
94 Ga0207652_10401962 3300025921 Bacteria 1236
95 Ga0207652_10530235 3300025921 Bacteria 1059
96 Ga0207652_10735188 3300025921 Bacteria 879
97 Ga0207652_10965537 3300025921 Bacteria 750
98 Ga0207659_10341710 3300025926 Bacteria 1240
99 Ga0207687_10283001 3300025927 Bacteria 1330
100 Ga0207690_10000109 3300025932 Bacteria 67292
101 Ga0207686_10325083 3300025934 Bacteria 1150
102 Ga0207709_10142888 3300025935 Bacteria 1647
103 Ga0207711_10000270 3300025941 Bacteria 56050
104 Ga0207661_10065804 3300025944 Bacteria 2943
105 Ga0207712_10567282 3300025961 Bacteria 978
106 Ga0207677_10017225 3300026023 Bacteria 4302
107 Ga0207703_10000066 3300026035 Bacteria 125891
108 Ga0207678_10178649 3300026067 Bacteria 1812
109 Ga0207674_11191645 3300026116 Bacteria 731
110 Ga0207683_10343489 3300026121 Bacteria 1369
111 Ga0207698_11248717 3300026142 Bacteria 757
112 Ga0265334_10003613 3300028573 Bacteria 7011
113 Ga0265336_10014969 3300028666 Bacteria 2560
114 Ga0307517_10080885 3300028786 Bacteria 2777
115 Ga0307408_100535676 3300031548 Bacteria 1031
116 Ga0307413_10033918 3300031824 Bacteria 2912
117 Ga0307413_10429192 3300031824 Bacteria 1043
118 Ga0307413_10832407 3300031824 Bacteria 778
119 Ga0307410_10030493 3300031852 Bacteria 3447
120 Ga0307407_10032055 3300031903 Bacteria 2853
121 Ga0307412_10050464 3300031911 Bacteria 2746
122 Ga0307414_10076468 3300032004 Bacteria 2433
123 Ga0307411_10393682 3300032005 Bacteria 1143
124 Ga0307411_10464228 3300032005 Bacteria 1062
125 Ga0307415_100036987 3300032126 Bacteria 3205
126 Ga0307415_100225926 3300032126 Bacteria 1504
127 Ga0307507_10000001 3300033179 Bacteria 417520
128 Ga0373945_0161248 3300035116 Bacteria 914
129 Ga0373953_0068055 3300035117 Bacteria 1465
130 Ga0373957_0088881 3300035120 Bacteria 1226
131 Ga0373943_0056179 3300035170 Bacteria 1953
132 Ga0373946_0024212 3300035171 Bacteria 2377
133 Ga0373924_0200704 3300035410 Bacteria 880
134 Ga0373937_0218440 3300036401 Bacteria 1794
135 Ga0373925_0655297 3300037068 Bacteria 865
136 Ga0395899_0002711 3300037312 Bacteria 14277
137 Ga0395901_0158273 3300038443 Bacteria 2379
138 Ga0242420_023037 3300038996 Bacteria 1123
139 Ga0436363_0689000 3300039450 Bacteria 1711
140 Ga0451843_0150747 3300041509 Bacteria 2765
141 Ga0451843_0531929 3300041509 Bacteria 2173
142 Ga0451853_3855529 3300041512 Bacteria 969
143 Ga0466969_0025001 3300044656 Bacteria 3071
144 Ga0466965_0051542 3300044683 Bacteria 2042
145 Ga0466966_0045800 3300044684 Bacteria 2795
146 Ga0466961_0011182 3300044693 Bacteria 5738
147 Ga0466961_0029001 3300044693 Bacteria 3558
148 Ga0466961_0303649 3300044693 Bacteria 975
149 Ga0466963_0253998 3300044694 Bacteria 1234
150 Ga0466963_0289438 3300044694 Bacteria 1151
151 Ga0466971_0014218 3300044719 Bacteria 3499
152 Ga0466971_0075147 3300044719 Bacteria 1537
153 Ga0466971_0194631 3300044719 Bacteria 956
154 Ga0466970_0128705 3300044765 Bacteria 1390
155 Ga0466970_0184238 3300044765 Bacteria 1159
156 Ga0466957_0720916 3300044842 Bacteria 705
157 Ga0466960_0136513 3300044901 Bacteria 1299
158 Ga0466960_0330314 3300044901 Bacteria 865
159 Ga0466959_0020117 3300045049 Bacteria 4915
160 Ga0466959_0483545 3300045049 Bacteria 838
161 Ga0466958_0035483 3300045836 Bacteria 2979
162 Ga0466958_0147819 3300045836 Bacteria 1481
163 Ga0466967_0335006 3300045976 Bacteria 1462
164 Ga0495592_0223843 3300046454 Bacteria 1256
165 Ga0495592_0250629 3300046454 Bacteria 1170
166 Ga0495651_0014909 3300046462 Bacteria 6009
167 Ga0495651_0035202 3300046462 Bacteria 3900
168 Ga0495582_0381186 3300046473 Bacteria 813
169 Ga0495662_0222451 3300046476 Bacteria 930
170 Ga0495664_0105605 3300046477 Bacteria 1698
171 Ga0495664_0311065 3300046477 Bacteria 950
172 Ga0495608_0000750 3300046511 Bacteria 22663
173 Ga0495618_0008175 3300046514 Bacteria 6337
174 Ga0495618_0303851 3300046514 Bacteria 991
175 Ga0495628_0026780 3300046516 Bacteria 4695
176 Ga0495628_0026834 3300046516 Bacteria 4689
177 Ga0495630_0256074 3300046517 Bacteria 1337
178 Ga0495652_0002152 3300046529 Bacteria 20756
179 Ga0495652_0056627 3300046529 Bacteria 3328
180 Ga0495652_0218352 3300046529 Bacteria 1434
181 Ga0495640_0082222 3300046533 Bacteria 2139
182 Ga0495587_0001399 3300046536 Bacteria 16058
183 Ga0495587_0110908 3300046536 Bacteria 1576
184 Ga0495587_0278131 3300046536 Bacteria 938
185 Ga0495645_0103621 3300046543 Bacteria 2021
186 Ga0495645_0117920 3300046543 Bacteria 1872
187 Ga0495667_0000230 3300046559 Bacteria 36657
188 Ga0495634_0523426 3300046642 Bacteria 693
189 Ga0495635_0023217 3300046663 Bacteria 4322
190 Ga0495635_0493519 3300046663 Bacteria 807
191 Ga0495657_0002245 3300046675 Bacteria 16354
192 Ga0495623_0309412 3300046679 Bacteria 871
193 Ga0495658_0181233 3300046683 Bacteria 1307
194 Ga0495624_0171572 3300046690 Bacteria 1323
195 Ga0495600_0001265 3300046809 Bacteria 13940
196 Ga0495600_0003005 3300046809 Bacteria 9850
197 Ga0495604_0008553 3300047317 Bacteria 8082
198 Ga0495604_0053594 3300047317 Bacteria 3116
199 Ga0495674_0004115 3300047319 Bacteria 14044
200 Ga0495674_0013335 3300047319 Bacteria 7729
201 Ga0495674_0168806 3300047319 Bacteria 1827
202 Ga0495680_0002983 3300047322 Bacteria 16907
203 Ga0495675_0005836 3300047444 Bacteria 7523
204 Ga0495684_0055955 3300047471 Bacteria 3008
205 Ga0495684_0152345 3300047471 Bacteria 1728
206 Ga0495602_0009674 3300048088 Bacteria 10016
207 Ga0495602_0177587 3300048088 Bacteria 1646
208 Ga0496101_0145132 3300048904 Bacteria 1812
209 Ga0496101_0253587 3300048904 Bacteria 1371
210 Ga0496102_0026639 3300048905 Bacteria 5159
211 Ga0496102_0367655 3300048905 Bacteria 1354
212 Ga0496102_1196563 3300048905 Bacteria 679
213 Ga0496103_0013209 3300048906 Bacteria 4896
214 Ga0496103_0235931 3300048906 Bacteria 1177
215 Ga0496104_0484291 3300048907 Bacteria 1148
216 Ga0496104_0742408 3300048907 Bacteria 889
217 Ga0496105_0174729 3300048908 Bacteria 1760
218 Ga0496105_0516195 3300048908 Bacteria 936
219 Ga0496106_0024673 3300048909 Bacteria 4471
220 Ga0496106_0191124 3300048909 Bacteria 1628
221 Ga0496107_0016496 3300048910 Bacteria 5188
222 Ga0496108_0053238 3300048911 Bacteria 3393
223 Ga0496109_0189471 3300048912 Bacteria 1932
224 Ga0496109_0258411 3300048912 Bacteria 1640
225 Ga0496110_0020883 3300048913 Bacteria 5533
226 Ga0496110_0042061 3300048913 Bacteria 3988
227 Ga0496110_0381590 3300048913 Bacteria 1284
228 Ga0496111_0065786 3300048914 Bacteria 2631
229 Ga0496111_0481002 3300048914 Bacteria 915
230 Ga0496112_0142775 3300048915 Bacteria 2363
231 Ga0496112_0818385 3300048915 Bacteria 856
232 Ga0496113_0090887 3300048916 Bacteria 2352
233 Ga0496113_0622486 3300048916 Bacteria 864
234 Ga0496113_0633246 3300048916 Bacteria 856
235 Ga0496114_0729985 3300048917 Bacteria 867
236 Ga0496115_0016008 3300048918 Bacteria 5703
237 Ga0496115_0608913 3300048918 Bacteria 868
238 Ga0496122_0000637 3300048925 Bacteria 71256
239 Ga0496125_0000079 3300048928 Bacteria 230066
240 Ga0496126_0031386 3300048929 Bacteria 5021
241 Ga0501318_009294 3300049534 Bacteria 1069
242 Ga0501321_010977 3300049537 Bacteria 1003
243 Ga0501031_0107193 3300049568 Bacteria 1824
244 Ga0501034_0699665 3300049571 Bacteria 912
245 Ga0501042_0349162 3300049578 Bacteria 1070
246 Ga0501070_0087163 3300049586 Bacteria 2585
247 Ga0501070_0251588 3300049586 Bacteria 1445
248 Ga0501076_0339412 3300049592 Bacteria 1233
249 Ga0495601_0171934 3300053077 Bacteria 1416
250 Ga0495601_0426192 3300053077 Bacteria 859
251 Ga0500616_0163287 3300053153 Bacteria 1019
252 Ga0501084_0104666 3300054114 Bacteria 2377
253 Ga0590077_011595 3300059426 Bacteria 1821
254 Ga0466962_0004830 3300061719 Bacteria 6487
255 2774903233 2773857933 Bacteria 5818019
256 2808874898 2808606365 Bacteria 4301966
257 2812361909 2811994880 Bacteria 4147780
258 2966927150 2966924647 Bacteria 3268643
259 8056064438 8056060235 Bacteria 7259403
260 Ga0068858_100000074
261 Ga0006778J45830_1028525
262 Ga0006778J45830_1053548
263 Ga0006759J45824_1067379
264 rootH2_10016354
265 Ga0007416J51690_1057042
266 Ga0007429J51699_1021537
267 Ga0007429J51699_1037445
268 Ga0032354_1021511
269 Ga0058861_12041684
270 Ga0070658_10066120
271 Ga0070658_10203156
272 Ga0070658_10446856
273 Ga0070683_100136983
274 Ga0070690_100059499
275 Ga0070680_100003195
276 Ga0070680_100179018
277 Ga0070680_100763485
278 Ga0068868_100008161
279 Ga0068868_100115969
280 Ga0070660_100063196
281 Ga0070660_100098363
282 Ga0070660_100110971
283 Ga0070660_100276359
284 Ga0070692_10041753
285 Ga0070714_100356394
286 Ga0070663_100288149
287 Ga0070681_10000028
288 Ga0070681_10024395
289 Ga0070681_10130071
290 Ga0070681_10503343
291 Ga0070681_10764769
292 Ga0068867_100421815
293 Ga0070679_100000095
294 Ga0070679_100001427
295 Ga0070679_100018238
296 Ga0070679_100379812
297 Ga0070679_100722486
298 Ga0070684_100048783
299 Ga0070684_100090678
300 Ga0070686_100067535
301 Ga0070696_100005196
302 Ga0070712_100723559
303 Ga0097621_100646179
304 Ga0068871_100921341
305 Ga0105240_10426615
306 Ga0105245_10189477
307 Ga0105245_10206152
308 Ga0105243_10611123
309 Ga0105242_10217989
310 Ga0105242_10276217
311 Ga0105248_10000329
312 Ga0105248_10196601
313 Ga0105238_11426739
314 Ga0105239_11394328
315 Ga0157371_10033790
316 Ga0157369_10002391
317 Ga0157369_10124671
318 Ga0157369_10179338
319 Ga0157369_10327169
320 Ga0157369_10470566
321 Ga0157372_10219338
322 Ga0157372_10840774
323 Ga0163163_10026934
324 Ga0163163_10063765
325 Ga0163163_10269457
326 Ga0157379_10000011
327 Ga0197907_10294872
328 Ga0206356_10687806
329 Ga0206349_1763356
330 Ga0206355_1574784
331 Ga0206350_10594316
332 Ga0206350_11080218
333 Ga0206354_10951108
334 Ga0154015_1360204
335 Ga0224712_10065638
336 Ga0207647_10038108
337 Ga0207705_10250688
338 Ga0207705_10362169
339 Ga0207705_10492949
340 Ga0207707_10000172
341 Ga0207707_10023631
342 Ga0207707_10049563
343 Ga0207707_10236293
344 Ga0207707_10305207
345 Ga0207660_10002441
346 Ga0207660_10079518
347 Ga0207657_10090755
348 Ga0207657_10118142
349 Ga0207652_10000092
350 Ga0207652_10047438
351 Ga0207652_10139692
352 Ga0207652_10401854
353 Ga0207652_10401962
354 Ga0207652_10530235
355 Ga0207652_10735188
356 Ga0207652_10965537
357 Ga0207659_10341710
358 Ga0207687_10283001
359 Ga0207690_10000109
360 Ga0207686_10325083
361 Ga0207709_10142888
362 Ga0207711_10000270
363 Ga0207661_10065804
364 Ga0207712_10567282
365 Ga0207677_10017225
366 Ga0207703_10000066
367 Ga0207678_10178649
368 Ga0207674_11191645
369 Ga0207683_10343489
370 Ga0207698_11248717
371 Ga0265334_10003613
372 Ga0265336_10014969
373 Ga0307517_10080885
374 Ga0307408_100535676
375 Ga0307413_10033918
376 Ga0307413_10429192
377 Ga0307413_10832407
378 Ga0307410_10030493
379 Ga0307407_10032055
380 Ga0307412_10050464
381 Ga0307414_10076468
382 Ga0307411_10393682
383 Ga0307411_10464228
384 Ga0307415_100036987
385 Ga0307415_100225926
386 Ga0307507_10000001
387 Ga0373945_0161248
388 Ga0373953_0068055
389 Ga0373957_0088881
390 Ga0373943_0056179
391 Ga0373946_0024212
392 Ga0373924_0200704
393 Ga0373937_0218440
394 Ga0373925_0655297
395 Ga0395899_0002711
396 Ga0395901_0158273
397 Ga0242420_023037
398 Ga0436363_0689000
399 Ga0451843_0150747
400 Ga0451843_0531929
401 Ga0451853_3855529
402 Ga0466969_0025001
403 Ga0466965_0051542
404 Ga0466966_0045800
405 Ga0466961_0011182
406 Ga0466961_0029001
407 Ga0466961_0303649
408 Ga0466963_0253998
409 Ga0466963_0289438
410 Ga0466971_0014218
411 Ga0466971_0075147
412 Ga0466971_0194631
413 Ga0466970_0128705
414 Ga0466970_0184238
415 Ga0466957_0720916
416 Ga0466960_0136513
417 Ga0466960_0330314
418 Ga0466959_0020117
419 Ga0466959_0483545
420 Ga0466958_0035483
421 Ga0466958_0147819
422 Ga0466967_0335006
423 Ga0495592_0223843
424 Ga0495592_0250629
425 Ga0495651_0014909
426 Ga0495651_0035202
427 Ga0495582_0381186
428 Ga0495662_0222451
429 Ga0495664_0105605
430 Ga0495664_0311065
431 Ga0495608_0000750
432 Ga0495618_0008175
433 Ga0495618_0303851
434 Ga0495628_0026780
435 Ga0495628_0026834
436 Ga0495630_0256074
437 Ga0495652_0002152
438 Ga0495652_0056627
439 Ga0495652_0218352
440 Ga0495640_0082222
441 Ga0495587_0001399
442 Ga0495587_0110908
443 Ga0495587_0278131
444 Ga0495645_0103621
445 Ga0495645_0117920
446 Ga0495667_0000230
447 Ga0495634_0523426
448 Ga0495635_0023217
449 Ga0495635_0493519
450 Ga0495657_0002245
451 Ga0495623_0309412
452 Ga0495658_0181233
453 Ga0495624_0171572
454 Ga0495600_0001265
455 Ga0495600_0003005
456 Ga0495604_0008553
457 Ga0495604_0053594
458 Ga0495674_0004115
459 Ga0495674_0013335
460 Ga0495674_0168806
461 Ga0495680_0002983
462 Ga0495675_0005836
463 Ga0495684_0055955
464 Ga0495684_0152345
465 Ga0495602_0009674
466 Ga0495602_0177587
467 Ga0496101_0145132
468 Ga0496101_0253587
469 Ga0496102_0026639
470 Ga0496102_0367655
471 Ga0496102_1196563
472 Ga0496103_0013209
473 Ga0496103_0235931
474 Ga0496104_0484291
475 Ga0496104_0742408
476 Ga0496105_0174729
477 Ga0496105_0516195
478 Ga0496106_0024673
479 Ga0496106_0191124
480 Ga0496107_0016496
481 Ga0496108_0053238
482 Ga0496109_0189471
483 Ga0496109_0258411
484 Ga0496110_0020883
485 Ga0496110_0042061
486 Ga0496110_0381590
487 Ga0496111_0065786
488 Ga0496111_0481002
489 Ga0496112_0142775
490 Ga0496112_0818385
491 Ga0496113_0090887
492 Ga0496113_0622486
493 Ga0496113_0633246
494 Ga0496114_0729985
495 Ga0496115_0016008
496 Ga0496115_0608913
497 Ga0496122_0000637
498 Ga0496125_0000079
499 Ga0496126_0031386
500 Ga0501318_009294
501 Ga0501321_010977
502 Ga0501031_0107193
503 Ga0501034_0699665
504 Ga0501042_0349162
505 Ga0501070_0087163
506 Ga0501070_0251588
507 Ga0501076_0339412
508 Ga0495601_0171934
509 Ga0495601_0426192
510 Ga0500616_0163287
511 Ga0501084_0104666
512 Ga0590077_011595
513 Ga0466962_0004830
514 2774903233
515 2808874898
516 2812361909
517 2966927150
518 8056064438

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22234

Rv2466c-like

Mycothiol-dependent nitroreductase Rv2466c

27

207

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wkw-assembly2.cif.gz_B crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.9673 13 209
4wkw-assembly2.cif.gz_B crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.9571 13 209
4zil-assembly1.cif.gz_B crystal structure of rv2466c and oxidoreductase from mycobacterium tuberculosis in its reduced state 0.9465 11 209
4wkw-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.9437 11 209
4wkw-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein from mycobacterium leprae determined by iodide sad phasing 0.9298 11 209
ID Description Score Start End Superfamily
4wkwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9673 13 209 3.40.30.10
4wkwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9571 13 209 3.40.30.10
af_P9WLE7_3_196_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8499 14 203 3.40.30.10
af_P9WLE7_3_196_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8256 14 203 3.40.30.10
2in3A02 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;putative protein disulfide isomerase domain 0.7754 68 144 1.10.472.60
ID Description Score Start End GO Terms
AF-A0A520EGQ7-F1-model_v4 Disulfide bond formation protein DsbA 0.992 13 177
AF-A0A1C6MN74-F1-model_v4 DSBA-like thioredoxin domain-containing protein 0.9841 11 209
AF-A0A6N7GI81-F1-model_v4 Disulfide bond formation protein DsbA 0.981 11 209
AF-A0A4Q1L040-F1-model_v4 Disulfide bond formation protein DsbA 0.9783 12 209
AF-A0A372JL95-F1-model_v4 Disulfide bond formation protein DsbA 0.9766 11 209

Map