F367496

General Info

Members Datasets Scaffolds Average Seq Length
257 134 514 296

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0081221|Ga0451577_0081221_1771_2799
Length 342
Sequence MREFCQAESLTYDASFAPINGFISLTVIIAAHLIGGMSSRPTQSGVTSMLKVGYIGLGLMGKSIARNILKAGFPVVVHNRSQAAVDELVAEGAVRAASPQEVAAQVDVVFTNLPDTPDVEQVVLGVNGISAGAHAGLILVDNSTIKPATARSIAQKLAEKGVFALDAPVSGGDIGARNGTLTIMVGGDAAALEKVMPVFLAMGKTVTHVGEAGAGQVAKAANQIMVAAQMVAMGELLVFAKKAGVDPQKVVDAIKGGAAQCWTLDVKPPRLFAGNRTPGFKAHMQLKDLRIVKETAQEYDIPISGTLANTALFQQMIDLGLGELDNSAVVGVIEKLAGVEIV

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
67 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
68 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
71 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
85 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
86 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
87 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
88 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
94 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
110 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
111 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
134 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.78
Rhizosphere 96.11
Stem 0
Stem Tuber 0
Unclassified 17.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0081221 3300042876 Bacteria 2891
2 SwRhRL2b_contig_3458051 2162886007 Bacteria 3899
3 SwRhRL2b_contig_3909489 2162886007 Bacteria 3891
4 rootL2_10056592 3300003322 Bacteria 1470
5 JGI25405J52794_10000160 3300003911 Bacteria 8349
6 Ga0058859_11432190 3300004798 Unclassified 1387
7 Ga0065704_10072612 3300005289 Bacteria 8251
8 Ga0065707_10003586 3300005295 Bacteria 3803
9 Ga0065707_10083555 3300005295 Bacteria 8787
10 Ga0070658_10057437 3300005327 Bacteria 3165
11 Ga0070666_10001189 3300005335 Bacteria 15750
12 Ga0070660_100065176 3300005339 Bacteria 2835
13 Ga0070661_100015795 3300005344 Bacteria 5328
14 Ga0070675_100037135 3300005354 Bacteria 3966
15 Ga0070667_100069193 3300005367 Bacteria 3004
16 Ga0070667_100094901 3300005367 Bacteria 2571
17 Ga0070703_10023175 3300005406 Unclassified 1827
18 Ga0070706_100099874 3300005467 Bacteria 2696
19 Ga0070707_100051926 3300005468 Unclassified 3930
20 Ga0070698_100112266 3300005471 Unclassified 2691
21 Ga0070698_100183244 3300005471 Bacteria 2032
22 Ga0070698_100349775 3300005471 Bacteria 1409
23 Ga0070698_100403699 3300005471 Bacteria 1300
24 Ga0070698_100428296 3300005471 Unclassified 1258
25 Ga0070699_100015238 3300005518 Bacteria 6606
26 Ga0070699_100036549 3300005518 Unclassified 4248
27 Ga0070699_100065812 3300005518 Bacteria 3146
28 Ga0070696_100165432 3300005546 Unclassified 1632
29 Ga0070665_100021621 3300005548 Bacteria 6469
30 Ga0070665_100251177 3300005548 Bacteria 1769
31 Ga0070704_100394654 3300005549 Bacteria 1179
32 Ga0068856_100280030 3300005614 Bacteria 1684
33 Ga0068859_100036931 3300005617 Bacteria 4903
34 Ga0068858_100048052 3300005842 Bacteria 3955
35 Ga0068858_100520243 3300005842 Bacteria 1150
36 Ga0068862_100022412 3300005844 Bacteria 5283
37 Ga0068862_100242058 3300005844 Unclassified 1641
38 Ga0081455_10001102 3300005937 Bacteria 33954
39 Ga0081455_10022291 3300005937 Bacteria 5922
40 Ga0081538_10010521 3300005981 Bacteria 7585
41 Ga0081540_1009759 3300005983 Bacteria 6577
42 Ga0081539_10002067 3300005985 Bacteria 30073
43 Ga0081539_10010396 3300005985 Bacteria 7567
44 Ga0081539_10039018 3300005985 Bacteria 2807
45 Ga0075428_100112934 3300006844 Bacteria 2959
46 Ga0075428_100422854 3300006844 Bacteria 1427
47 Ga0075430_100023220 3300006846 Bacteria 5277
48 Ga0075431_100270798 3300006847 Bacteria 1721
49 Ga0075431_100587259 3300006847 Bacteria 1099
50 Ga0075434_100027839 3300006871 Bacteria 5550
51 Ga0075429_100017292 3300006880 Bacteria 6236
52 Ga0075429_100052135 3300006880 Bacteria 3559
53 Ga0097620_100036931 3300006931 Bacteria 4903
54 Ga0105240_10057264 3300009093 Bacteria 4871
55 Ga0111539_10041603 3300009094 Bacteria 5523
56 Ga0111539_10225576 3300009094 Bacteria 2182
57 Ga0105245_10280882 3300009098 Unclassified 1627
58 Ga0114129_10004716 3300009147 Bacteria 19251
59 Ga0114129_10053382 3300009147 Bacteria 5668
60 Ga0114129_10284873 3300009147 Bacteria 2207
61 Ga0114129_10434635 3300009147 Bacteria 1724
62 Ga0105243_10021017 3300009148 Bacteria 4953
63 Ga0105243_10095868 3300009148 Unclassified 2453
64 Ga0105243_10182101 3300009148 Bacteria 1828
65 Ga0105242_10489501 3300009176 Unclassified 1167
66 Ga0105237_10094516 3300009545 Bacteria 2979
67 Ga0105249_10018814 3300009553 Bacteria 6156
68 Ga0105249_10036253 3300009553 Bacteria 4474
69 Ga0105249_10948550 3300009553 Unclassified 928
70 Ga0157369_10064711 3300013105 Bacteria 3937
71 Ga0157375_10216887 3300013308 Unclassified 2071
72 Ga0207653_10094951 3300025885 Unclassified 1049
73 Ga0207680_10001095 3300025903 Bacteria 12785
74 Ga0207647_10108380 3300025904 Bacteria 1643
75 Ga0207643_10110306 3300025908 Unclassified 1621
76 Ga0207684_10084460 3300025910 Bacteria 2704
77 Ga0207649_10032048 3300025920 Bacteria 3130
78 Ga0207646_10169508 3300025922 Unclassified 1971
79 Ga0207686_10272418 3300025934 Unclassified 1246
80 Ga0207709_10172696 3300025935 Bacteria 1518
81 Ga0207667_10038632 3300025949 Bacteria 5095
82 Ga0207651_10309357 3300025960 Bacteria 1317
83 Ga0207712_10032913 3300025961 Bacteria 3501
84 Ga0207712_10057248 3300025961 Bacteria 2750
85 Ga0207658_10025869 3300025986 Bacteria 4111
86 Ga0207703_10056313 3300026035 Bacteria 3202
87 Ga0207678_10204210 3300026067 Bacteria 1690
88 Ga0207702_10602068 3300026078 Bacteria 1078
89 Ga0207698_10047113 3300026142 Bacteria 3262
90 Ga0207428_10124640 3300027907 Bacteria 1973
91 Ga0268266_10000867 3300028379 Bacteria 39343
92 Ga0268266_10270076 3300028379 Bacteria 1578
93 Ga0268265_10055434 3300028380 Unclassified 3012
94 Ga0265318_10009126 3300028577 Unclassified 4381
95 Ga0265322_10007962 3300028654 Bacteria 3091
96 Ga0265331_10073243 3300031250 Bacteria 1600
97 Ga0265327_10015299 3300031251 Bacteria 4963
98 Ga0316575_10016212 3300031665 Bacteria 2816
99 Ga0316575_10028326 3300031665 Bacteria 2184
100 Ga0316579_10031401 3300031691 Bacteria 2432
101 Ga0316579_10052786 3300031691 Bacteria 1903
102 Ga0316576_10122003 3300031727 Bacteria 1958
103 Ga0316576_10125502 3300031727 Bacteria 1929
104 Ga0316576_10261038 3300031727 Unclassified 1300
105 Ga0316578_10128792 3300031728 Bacteria 1522
106 Ga0307405_10129781 3300031731 Bacteria 1740
107 Ga0316577_10006359 3300031733 Bacteria 6233
108 Ga0316577_10017488 3300031733 Unclassified 3959
109 Ga0316577_10072184 3300031733 Bacteria 1927
110 Ga0307413_10228804 3300031824 Bacteria 1364
111 Ga0307410_10112355 3300031852 Bacteria 1973
112 Ga0307412_10039720 3300031911 Bacteria 3041
113 Ga0307415_100142850 3300032126 Unclassified 1831
114 Ga0316593_10073390 3300032168 Bacteria 1186
115 Ga0373936_0012547 3300035113 Bacteria 3225
116 Ga0316574_0003017 3300035398 Bacteria 8579
117 Ga0316574_0161726 3300035398 Bacteria 1442
118 Ga0316582_0019085 3300036647 Bacteria 4006
119 Ga0316582_0026063 3300036647 Bacteria 3516
120 Ga0316582_0063244 3300036647 Bacteria 2378
121 Ga0316582_0116636 3300036647 Bacteria 1783
122 Ga0316582_0196237 3300036647 Unclassified 1376
123 Ga0316582_0251975 3300036647 Unclassified 1210
124 Ga0316582_0288491 3300036647 Bacteria 1127
125 Ga0316582_0328927 3300036647 Unclassified 1051
126 Ga0316582_0434215 3300036647 Bacteria 905
127 Ga0316584_0009313 3300036712 Bacteria 6812
128 Ga0316584_0028892 3300036712 Bacteria 4092
129 Ga0316584_0034042 3300036712 Bacteria 3776
130 Ga0316584_0316726 3300036712 Unclassified 1126
131 Ga0400490_13265 3300038726 Bacteria 1299
132 Ga0400488_15266 3300038741 Bacteria 2422
133 Ga0400487_05791 3300039110 Bacteria 3758
134 Ga0451577_0001656 3300042876 Bacteria 28799
135 Ga0451577_0005054 3300042876 Bacteria 13624
136 Ga0451577_0007385 3300042876 Bacteria 10788
137 Ga0451577_0033640 3300042876 Bacteria 4622
138 Ga0451577_0064598 3300042876 Unclassified 3263
139 Ga0451577_0136182 3300042876 Bacteria 2205
140 Ga0451577_0168569 3300042876 Bacteria 1973
141 Ga0451577_0198115 3300042876 Unclassified 1813
142 Ga0453683_0007298 3300044673 Bacteria 7526
143 Ga0453683_0021449 3300044673 Unclassified 4125
144 Ga0453683_0028875 3300044673 Bacteria 3510
145 Ga0453683_0034529 3300044673 Bacteria 3188
146 Ga0453683_0039088 3300044673 Unclassified 2982
147 Ga0453683_0131991 3300044673 Bacteria 1574
148 Ga0453683_0192437 3300044673 Unclassified 1294
149 Ga0453683_0251993 3300044673 Bacteria 1125
150 Ga0453683_0260686 3300044673 Bacteria 1106
151 Ga0453684_0000012 3300044712 Bacteria 1062512
152 Ga0453684_0000047 3300044712 Bacteria 560243
153 Ga0453684_0000718 3300044712 Bacteria 117108
154 Ga0453684_0001229 3300044712 Bacteria 78474
155 Ga0453684_0001233 3300044712 Bacteria 78087
156 Ga0453684_0001875 3300044712 Bacteria 54679
157 Ga0453684_0002770 3300044712 Bacteria 41493
158 Ga0453684_0004987 3300044712 Bacteria 27002
159 Ga0453684_0006973 3300044712 Bacteria 21148
160 Ga0453684_0010194 3300044712 Bacteria 16118
161 Ga0453684_0019940 3300044712 Bacteria 10167
162 Ga0453684_0025525 3300044712 Bacteria 8575
163 Ga0453684_0031541 3300044712 Bacteria 7445
164 Ga0453684_0034679 3300044712 Bacteria 6995
165 Ga0453684_0056977 3300044712 Bacteria 5064
166 Ga0453684_0060730 3300044712 Bacteria 4858
167 Ga0453684_0086656 3300044712 Bacteria 3885
168 Ga0453684_0096595 3300044712 Unclassified 3629
169 Ga0453684_0102944 3300044712 Bacteria 3490
170 Ga0453684_0112784 3300044712 Unclassified 3299
171 Ga0453684_0146071 3300044712 Bacteria 2817
172 Ga0453684_0191542 3300044712 Bacteria 2392
173 Ga0453684_0193080 3300044712 Bacteria 2380
174 Ga0453684_0214908 3300044712 Bacteria 2232
175 Ga0453684_0260347 3300044712 Bacteria 1987
176 Ga0453684_0263512 3300044712 Bacteria 1973
177 Ga0453684_0300482 3300044712 Unclassified 1824
178 Ga0453684_0328962 3300044712 Bacteria 1728
179 Ga0453684_0359545 3300044712 Unclassified 1639
180 Ga0453684_0389438 3300044712 Bacteria 1563
181 Ga0453684_0438437 3300044712 Bacteria 1456
182 Ga0453684_0531904 3300044712 Bacteria 1297
183 Ga0453684_0592405 3300044712 Bacteria 1216
184 Ga0453684_0748325 3300044712 Bacteria 1058
185 Ga0453684_0764983 3300044712 Bacteria 1044
186 Ga0453684_0781463 3300044712 Bacteria 1031
187 Ga0451576_0000322 3300045051 Bacteria 116299
188 Ga0451576_0000997 3300045051 Bacteria 52358
189 Ga0451576_0002061 3300045051 Bacteria 31600
190 Ga0451576_0008235 3300045051 Bacteria 12262
191 Ga0451576_0197017 3300045051 Bacteria 2104
192 Ga0451576_0476839 3300045051 Bacteria 1310
193 Ga0496108_0101491 3300048911 Bacteria 2454
194 Ga0496111_0111175 3300048914 Bacteria 2018
195 Ga0496116_0051735 3300048919 Bacteria 2726
196 Ga0496119_0057647 3300048922 Bacteria 2346
197 Ga0496126_0115219 3300048929 Bacteria 2337
198 Ga0501031_0005241 3300049568 Bacteria 8451
199 Ga0501031_0287718 3300049568 Unclassified 1066
200 Ga0501032_0000727 3300049569 Bacteria 26753
201 Ga0501033_0000159 3300049570 Bacteria 64757
202 Ga0501034_0008449 3300049571 Bacteria 10874
203 Ga0501036_0008308 3300049572 Bacteria 8505
204 Ga0501037_0000650 3300049573 Bacteria 26827
205 Ga0501038_0016076 3300049574 Bacteria 6794
206 Ga0501039_0011958 3300049575 Bacteria 6615
207 Ga0501039_0516653 3300049575 Bacteria 938
208 Ga0501042_0067860 3300049578 Unclassified 2550
209 Ga0501042_0206782 3300049578 Bacteria 1415
210 Ga0501043_0007795 3300049579 Bacteria 8462
211 Ga0501046_0001066 3300049580 Bacteria 26864
212 Ga0501046_0442935 3300049580 Bacteria 935
213 Ga0501047_0009858 3300049581 Bacteria 9026
214 Ga0501048_0001489 3300049582 Bacteria 17772
215 Ga0501067_0033042 3300049583 Bacteria 2872
216 Ga0501068_0046807 3300049584 Bacteria 2608
217 Ga0501068_0407852 3300049584 Bacteria 877
218 Ga0501069_0022709 3300049585 Bacteria 3416
219 Ga0501070_0000131 3300049586 Bacteria 67175
220 Ga0501071_0008579 3300049587 Bacteria 6757
221 Ga0501072_0080703 3300049588 Bacteria 2578
222 Ga0501072_0103285 3300049588 Bacteria 2265
223 Ga0501073_0018421 3300049589 Bacteria 5047
224 Ga0501073_0164369 3300049589 Bacteria 1537
225 Ga0501073_0337141 3300049589 Bacteria 1041
226 Ga0501074_0022052 3300049590 Bacteria 4626
227 Ga0501074_0044024 3300049590 Bacteria 3232
228 Ga0501075_0011448 3300049591 Bacteria 6278
229 Ga0501076_0033324 3300049592 Bacteria 4022
230 Ga0501076_0044739 3300049592 Unclassified 3492
231 Ga0501206_013297 3300049653 Unclassified 1124
232 Ga0501079_0093249 3300049741 Unclassified 2333
233 Ga0501079_0109844 3300049741 Bacteria 2142
234 Ga0501081_0019654 3300049743 Unclassified 4500
235 Ga0501081_0166196 3300049743 Bacteria 1592
236 Ga0501083_0001155 3300049744 Bacteria 17779
237 Ga0501083_0037408 3300049744 Bacteria 3306
238 Ga0501035_0000684 3300049822 Bacteria 37075
239 Ga0501044_0000735 3300049823 Bacteria 39493
240 nmdc:mga05p37_127421_c1 3300050507 Bacteria 3125
241 nmdc:mga05p37_143764_c1 3300050507 Bacteria 2922
242 nmdc:mga05p37_20528_c1 3300050507 Bacteria 7993
243 nmdc:mga05p37_226684_c1 3300050507 Bacteria 2253
244 nmdc:mga05p37_266170_c1 3300050507 Bacteria 2050
245 nmdc:mga05p37_640721_c1 3300050507 Bacteria 1192
246 nmdc:mga09592_11328_c1 3300050508 Bacteria 7252
247 nmdc:mga0qj67_21759_c1 3300050509 Bacteria 4920
248 nmdc:mga06r32_278705_c1 3300050510 Bacteria 1659
249 nmdc:mga08y16_487923_c1 3300050511 Bacteria 1253
250 nmdc:mga08y16_93977_c1 3300050511 Bacteria 3124
251 nmdc:mga0n895_108680_c1 3300050512 Unclassified 2788
252 nmdc:mga0a205_159128_c1 3300050515 Bacteria 2156
253 Ga0501084_0000279 3300054114 Bacteria 38579
254 Ga0501084_0432841 3300054114 Bacteria 1112
255 Ga0501082_0009617 3300060353 Bacteria 8323
256 Ga0501082_0117860 3300060353 Unclassified 2300
257 Ga0530510_0058960 3300061734 Unclassified 2776
258 Ga0451577_0081221
259 SwRhRL2b_contig_3458051
260 SwRhRL2b_contig_3909489
261 rootL2_10056592
262 JGI25405J52794_10000160
263 Ga0058859_11432190
264 Ga0065704_10072612
265 Ga0065707_10003586
266 Ga0065707_10083555
267 Ga0070658_10057437
268 Ga0070666_10001189
269 Ga0070660_100065176
270 Ga0070661_100015795
271 Ga0070675_100037135
272 Ga0070667_100069193
273 Ga0070667_100094901
274 Ga0070703_10023175
275 Ga0070706_100099874
276 Ga0070707_100051926
277 Ga0070698_100112266
278 Ga0070698_100183244
279 Ga0070698_100349775
280 Ga0070698_100403699
281 Ga0070698_100428296
282 Ga0070699_100015238
283 Ga0070699_100036549
284 Ga0070699_100065812
285 Ga0070696_100165432
286 Ga0070665_100021621
287 Ga0070665_100251177
288 Ga0070704_100394654
289 Ga0068856_100280030
290 Ga0068859_100036931
291 Ga0068858_100048052
292 Ga0068858_100520243
293 Ga0068862_100022412
294 Ga0068862_100242058
295 Ga0081455_10001102
296 Ga0081455_10022291
297 Ga0081538_10010521
298 Ga0081540_1009759
299 Ga0081539_10002067
300 Ga0081539_10010396
301 Ga0081539_10039018
302 Ga0075428_100112934
303 Ga0075428_100422854
304 Ga0075430_100023220
305 Ga0075431_100270798
306 Ga0075431_100587259
307 Ga0075434_100027839
308 Ga0075429_100017292
309 Ga0075429_100052135
310 Ga0097620_100036931
311 Ga0105240_10057264
312 Ga0111539_10041603
313 Ga0111539_10225576
314 Ga0105245_10280882
315 Ga0114129_10004716
316 Ga0114129_10053382
317 Ga0114129_10284873
318 Ga0114129_10434635
319 Ga0105243_10021017
320 Ga0105243_10095868
321 Ga0105243_10182101
322 Ga0105242_10489501
323 Ga0105237_10094516
324 Ga0105249_10018814
325 Ga0105249_10036253
326 Ga0105249_10948550
327 Ga0157369_10064711
328 Ga0157375_10216887
329 Ga0207653_10094951
330 Ga0207680_10001095
331 Ga0207647_10108380
332 Ga0207643_10110306
333 Ga0207684_10084460
334 Ga0207649_10032048
335 Ga0207646_10169508
336 Ga0207686_10272418
337 Ga0207709_10172696
338 Ga0207667_10038632
339 Ga0207651_10309357
340 Ga0207712_10032913
341 Ga0207712_10057248
342 Ga0207658_10025869
343 Ga0207703_10056313
344 Ga0207678_10204210
345 Ga0207702_10602068
346 Ga0207698_10047113
347 Ga0207428_10124640
348 Ga0268266_10000867
349 Ga0268266_10270076
350 Ga0268265_10055434
351 Ga0265318_10009126
352 Ga0265322_10007962
353 Ga0265331_10073243
354 Ga0265327_10015299
355 Ga0316575_10016212
356 Ga0316575_10028326
357 Ga0316579_10031401
358 Ga0316579_10052786
359 Ga0316576_10122003
360 Ga0316576_10125502
361 Ga0316576_10261038
362 Ga0316578_10128792
363 Ga0307405_10129781
364 Ga0316577_10006359
365 Ga0316577_10017488
366 Ga0316577_10072184
367 Ga0307413_10228804
368 Ga0307410_10112355
369 Ga0307412_10039720
370 Ga0307415_100142850
371 Ga0316593_10073390
372 Ga0373936_0012547
373 Ga0316574_0003017
374 Ga0316574_0161726
375 Ga0316582_0019085
376 Ga0316582_0026063
377 Ga0316582_0063244
378 Ga0316582_0116636
379 Ga0316582_0196237
380 Ga0316582_0251975
381 Ga0316582_0288491
382 Ga0316582_0328927
383 Ga0316582_0434215
384 Ga0316584_0009313
385 Ga0316584_0028892
386 Ga0316584_0034042
387 Ga0316584_0316726
388 Ga0400490_13265
389 Ga0400488_15266
390 Ga0400487_05791
391 Ga0451577_0001656
392 Ga0451577_0005054
393 Ga0451577_0007385
394 Ga0451577_0033640
395 Ga0451577_0064598
396 Ga0451577_0136182
397 Ga0451577_0168569
398 Ga0451577_0198115
399 Ga0453683_0007298
400 Ga0453683_0021449
401 Ga0453683_0028875
402 Ga0453683_0034529
403 Ga0453683_0039088
404 Ga0453683_0131991
405 Ga0453683_0192437
406 Ga0453683_0251993
407 Ga0453683_0260686
408 Ga0453684_0000012
409 Ga0453684_0000047
410 Ga0453684_0000718
411 Ga0453684_0001229
412 Ga0453684_0001233
413 Ga0453684_0001875
414 Ga0453684_0002770
415 Ga0453684_0004987
416 Ga0453684_0006973
417 Ga0453684_0010194
418 Ga0453684_0019940
419 Ga0453684_0025525
420 Ga0453684_0031541
421 Ga0453684_0034679
422 Ga0453684_0056977
423 Ga0453684_0060730
424 Ga0453684_0086656
425 Ga0453684_0096595
426 Ga0453684_0102944
427 Ga0453684_0112784
428 Ga0453684_0146071
429 Ga0453684_0191542
430 Ga0453684_0193080
431 Ga0453684_0214908
432 Ga0453684_0260347
433 Ga0453684_0263512
434 Ga0453684_0300482
435 Ga0453684_0328962
436 Ga0453684_0359545
437 Ga0453684_0389438
438 Ga0453684_0438437
439 Ga0453684_0531904
440 Ga0453684_0592405
441 Ga0453684_0748325
442 Ga0453684_0764983
443 Ga0453684_0781463
444 Ga0451576_0000322
445 Ga0451576_0000997
446 Ga0451576_0002061
447 Ga0451576_0008235
448 Ga0451576_0197017
449 Ga0451576_0476839
450 Ga0496108_0101491
451 Ga0496111_0111175
452 Ga0496116_0051735
453 Ga0496119_0057647
454 Ga0496126_0115219
455 Ga0501031_0005241
456 Ga0501031_0287718
457 Ga0501032_0000727
458 Ga0501033_0000159
459 Ga0501034_0008449
460 Ga0501036_0008308
461 Ga0501037_0000650
462 Ga0501038_0016076
463 Ga0501039_0011958
464 Ga0501039_0516653
465 Ga0501042_0067860
466 Ga0501042_0206782
467 Ga0501043_0007795
468 Ga0501046_0001066
469 Ga0501046_0442935
470 Ga0501047_0009858
471 Ga0501048_0001489
472 Ga0501067_0033042
473 Ga0501068_0046807
474 Ga0501068_0407852
475 Ga0501069_0022709
476 Ga0501070_0000131
477 Ga0501071_0008579
478 Ga0501072_0080703
479 Ga0501072_0103285
480 Ga0501073_0018421
481 Ga0501073_0164369
482 Ga0501073_0337141
483 Ga0501074_0022052
484 Ga0501074_0044024
485 Ga0501075_0011448
486 Ga0501076_0033324
487 Ga0501076_0044739
488 Ga0501206_013297
489 Ga0501079_0093249
490 Ga0501079_0109844
491 Ga0501081_0019654
492 Ga0501081_0166196
493 Ga0501083_0001155
494 Ga0501083_0037408
495 Ga0501035_0000684
496 Ga0501044_0000735
497 nmdc:mga05p37_127421_c1
498 nmdc:mga05p37_143764_c1
499 nmdc:mga05p37_20528_c1
500 nmdc:mga05p37_226684_c1
501 nmdc:mga05p37_266170_c1
502 nmdc:mga05p37_640721_c1
503 nmdc:mga09592_11328_c1
504 nmdc:mga0qj67_21759_c1
505 nmdc:mga06r32_278705_c1
506 nmdc:mga08y16_487923_c1
507 nmdc:mga08y16_93977_c1
508 nmdc:mga0n895_108680_c1
509 nmdc:mga0a205_159128_c1
510 Ga0501084_0000279
511 Ga0501084_0432841
512 Ga0501082_0009617
513 Ga0501082_0117860
514 Ga0530510_0058960

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

51

210

0.99

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

213

333

0.97

PF07991

IlvN

Acetohydroxy acid isomeroreductase, NADPH-binding domain

47

127

0.92

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

35

125

0.89

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

51

143

0.83

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

51

164

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpd-assembly1.cif.gz_A x-ray crystal structure of tartronate semialdehyde reductase [salmonella typhimurium lt2] 0.9739 3 293
4dll-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9695 3 287
3pdu-assembly1.cif.gz_D crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+ 0.9686 1 285
4dll-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9686 3 288
2uyy-assembly1.cif.gz_D structure of the cytokine-like nuclear factor n-pac 0.9644 2 284
ID Description Score Start End Superfamily
af_Q4DFE2_2_165_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9955 1 163 3.40.50.720
af_Q4DFE2_166_292_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9949 164 289 1.10.1040.10
af_F1QE62_28_195_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9885 3 163 3.40.50.720
af_Q4DFE2_2_165_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9835 1 163 3.40.50.720
af_Q9C991_11_173_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9828 2 159 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Y4VV82-F1-model_v4 NAD-binding protein 0.9995 1 293 GO:0016054
GO:0016491
GO:0050661
GO:0051287
AF-A0A7S1MGW9-F1-model_v4 6-phosphogluconate dehydrogenase NADP-binding domain-containing protein 0.9986 2 114 GO:0050661
AF-A0A850AM76-F1-model_v4 deleted 0.9976 3 293
AF-A0A352S2Q2-F1-model_v4 2-hydroxy-3-oxopropionate reductase 0.9956 70 159 GO:0050661
AF-A0A846ZYT9-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9935 2 220 GO:0016054
GO:0016491
GO:0050661
GO:0051287

Map