F367140

General Info

Members Datasets Scaffolds Average Seq Length
257 198 229 282

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100000834|Ga0068853_10000083418
Length 308
Sequence MTAIGQQTTDGMGKDMALVSMGPMLKRAQAAGYGIAAFNMIDYNSARSIIEGAADMKAPIIVQVSVKTIRHWGFKPIATWVRMLAEAVEVPVALHLDHCSDSDVIRRCIDAGWTSVMFDGSSLPFAENKARSEQIYRLTEAAGVGLEAEIGAIGGVEDDKFVAEDSAILADYDECLEFVENMPNLAVFAPAIGTAHGFYKGQPKIAYALLEKITAAVAIPIALHGGTGLSQEQFDRCIAGGCAKVNISTMHKHRFIEGFVAVRQDKPGLEEPLPFIIGQYEAMKKDVCDMIAAFGSAGRAAHAAGAEA

Samples

Sample ID Description Type Environment
1 2558860280 Kutzneria sp. 744 Isolate Unclassified
2 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
3 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
4 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
5 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
6 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
7 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
8 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
9 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
10 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
11 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
12 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
13 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
14 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
15 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
16 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
17 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
18 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
19 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
20 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
21 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
22 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
23 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
24 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
25 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
28 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
29 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
82 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
83 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
84 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
85 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
111 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
112 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
188 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
189 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
190 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
191 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
197 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
198 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.72
Metatranscriptomes 0.39
Isolates 10.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.72
Nodule 0.39
Rhizoplane 1.17
Rhizosphere 84.05
Stem 0
Stem Tuber 0
Unclassified 11.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010900 3300001979 Bacteria 3477
2 JGI24739J22299_10021220 3300001989 Bacteria 2314
3 JGI25151J46595_10010116 3300003187 Bacteria 4409
4 JGI25406J46586_10014946 3300003203 Bacteria 3286
5 JGI25407J50210_10048932 3300003373 Bacteria 1073
6 Ga0070683_100606224 3300005329 Bacteria 1048
7 Ga0070682_100043719 3300005337 Bacteria 2771
8 Ga0070682_100155412 3300005337 Bacteria 1574
9 Ga0070687_100005150 3300005343 Bacteria 5275
10 Ga0070675_100208466 3300005354 Bacteria 1698
11 Ga0070659_100075155 3300005366 Bacteria 2693
12 Ga0070662_100326184 3300005457 Bacteria 1253
13 Ga0070685_10002804 3300005466 Bacteria 8905
14 Ga0068853_100000834 3300005539 Bacteria 21532
15 Ga0070672_100227720 3300005543 Bacteria 1565
16 Ga0070686_100021754 3300005544 Bacteria 3817
17 Ga0070665_100451491 3300005548 Bacteria 1295
18 Ga0068854_100209949 3300005578 Bacteria 1535
19 Ga0068864_100042374 3300005618 Bacteria 3895
20 Ga0068861_100033365 3300005719 Bacteria 3797
21 Ga0068861_100093532 3300005719 Bacteria 2377
22 Ga0068851_10230776 3300005834 Bacteria 1043
23 Ga0068862_100262791 3300005844 Bacteria 1576
24 Ga0081538_10002207 3300005981 Bacteria 19294
25 Ga0081538_10026659 3300005981 Bacteria 4034
26 Ga0081538_10043197 3300005981 Bacteria 2834
27 Ga0081539_10002293 3300005985 Bacteria 27714
28 Ga0075430_100009728 3300006846 Bacteria 8126
29 Ga0075431_100538040 3300006847 Bacteria 1156
30 Ga0075433_10000738 3300006852 Bacteria 22422
31 Ga0105240_10407511 3300009093 Bacteria 1530
32 Ga0111539_10001313 3300009094 Bacteria 33213
33 Ga0105245_10023671 3300009098 Bacteria 5391
34 Ga0105247_10133501 3300009101 Bacteria 1620
35 Ga0114129_10002109 3300009147 Bacteria 27389
36 Ga0114129_10905129 3300009147 Bacteria 1118
37 Ga0105248_10144052 3300009177 Bacteria 2688
38 Ga0105237_10080921 3300009545 Bacteria 3238
39 Ga0105238_10002688 3300009551 Bacteria 17686
40 Ga0105239_10009677 3300010375 Bacteria 10838
41 Ga0157369_10121279 3300013105 Bacteria 2774
42 Ga0157369_10317735 3300013105 Bacteria 1619
43 Ga0157369_10439023 3300013105 Bacteria 1352
44 Ga0171462_1002 3300013250 Bacteria 1052134
45 Ga0163162_10255629 3300013306 Bacteria 1884
46 Ga0163163_10279410 3300014325 Bacteria 1721
47 Ga0157380_10380744 3300014326 Bacteria 1331
48 Ga0157377_10005673 3300014745 Bacteria 5883
49 Ga0157379_10052049 3300014968 Bacteria 3656
50 Ga0206352_10373957 3300020078 Bacteria 1269
51 Ga0209025_1000436 3300025294 Bacteria 82202
52 Ga0207647_10003976 3300025904 Bacteria 11031
53 Ga0207647_10140533 3300025904 Bacteria 1415
54 Ga0207705_10172771 3300025909 Bacteria 1628
55 Ga0207695_10289709 3300025913 Bacteria 1530
56 Ga0207671_10007618 3300025914 Bacteria 9361
57 Ga0207694_10002422 3300025924 Bacteria 15241
58 Ga0207706_10280241 3300025933 Bacteria 1454
59 Ga0207639_10003472 3300026041 Bacteria 10604
60 Ga0207674_10022105 3300026116 Bacteria 6836
61 Ga0207674_10255654 3300026116 Bacteria 1699
62 Ga0207675_100004264 3300026118 Bacteria 13831
63 Ga0207428_10009052 3300027907 Bacteria 8956
64 Ga0268266_10393812 3300028379 Bacteria 1309
65 Ga0265337_1006347 3300028556 Bacteria 4574
66 Ga0265336_10025753 3300028666 Bacteria 1852
67 Ga0307511_10000018 3300030521 Bacteria 118259
68 Ga0307511_10044266 3300030521 Bacteria 3701
69 Ga0307512_10152195 3300030522 Bacteria 1380
70 Ga0316181_1156287 3300030744 Bacteria 1524
71 Ga0307513_10137444 3300031456 Bacteria 2377
72 Ga0307405_10027910 3300031731 Bacteria 3280
73 Ga0307405_10320724 3300031731 Bacteria 1183
74 Ga0307413_10006584 3300031824 Bacteria 5321
75 Ga0307413_10144851 3300031824 Bacteria 1647
76 Ga0307410_10122391 3300031852 Bacteria 1899
77 Ga0307406_10021725 3300031901 Bacteria 3799
78 Ga0307407_10001684 3300031903 Bacteria 8199
79 Ga0307407_10010796 3300031903 Bacteria 4321
80 Ga0307407_10031667 3300031903 Bacteria 2867
81 Ga0307412_10027406 3300031911 Bacteria 3552
82 Ga0307409_100000345 3300031995 Bacteria 19238
83 Ga0307409_100009235 3300031995 Bacteria 6045
84 Ga0307409_100300307 3300031995 Bacteria 1493
85 Ga0307416_100006826 3300032002 Bacteria 7182
86 Ga0307416_100020195 3300032002 Bacteria 4746
87 Ga0307416_100135844 3300032002 Bacteria 2224
88 Ga0307416_100216777 3300032002 Bacteria 1831
89 Ga0307414_10072772 3300032004 Bacteria 2484
90 Ga0307414_10277279 3300032004 Bacteria 1407
91 Ga0307411_10006076 3300032005 Bacteria 6005
92 Ga0307415_100001886 3300032126 Bacteria 10289
93 Ga0307415_100007115 3300032126 Bacteria 6092
94 Ga0307415_100342894 3300032126 Bacteria 1254
95 Ga0307415_100388698 3300032126 Bacteria 1187
96 Ga0373934_0008712 3300035086 Bacteria 3786
97 Ga0373956_0180075 3300035119 Bacteria 999
98 Ga0373943_0040947 3300035170 Bacteria 2239
99 Ga0373935_0051121 3300035692 Bacteria 2624
100 Ga0373927_0237856 3300035695 Bacteria 1197
101 Ga0373933_0038703 3300035724 Bacteria 2802
102 Ga0373947_0239205 3300035725 Bacteria 1198
103 Ga0373937_0041348 3300036401 Bacteria 4204
104 Ga0373937_0245742 3300036401 Bacteria 1686
105 Ga0316582_0336623 3300036647 Unclassified 1038
106 Ga0373925_0086524 3300037068 Bacteria 2391
107 Ga0395898_0011390 3300037466 Bacteria 9235
108 Ga0395901_0004974 3300038443 Bacteria 13413
109 Ga0395901_0012637 3300038443 Bacteria 8567
110 Ga0395901_0025653 3300038443 Bacteria 6051
111 Ga0439450_021324 3300042008 Bacteria 1390
112 Ga0450888_002469 3300042126 Bacteria 1830
113 Ga0450918_022598 3300042531 Bacteria 1099
114 Ga0466972_0083558 3300044658 Bacteria 1519
115 Ga0453684_0097004 3300044712 Bacteria 3619
116 Ga0466968_0011387 3300044735 Bacteria 3463
117 Ga0466970_0033780 3300044765 Bacteria 2705
118 Ga0466970_0035003 3300044765 Bacteria 2660
119 Ga0466960_0017567 3300044901 Bacteria 3121
120 Ga0466960_0057171 3300044901 Bacteria 1901
121 Ga0451576_0492749 3300045051 Unclassified 1287
122 Ga0495627_018839 3300046453 Bacteria 2322
123 Ga0495592_0004026 3300046454 Bacteria 10673
124 Ga0495641_0091127 3300046461 Bacteria 1362
125 Ga0495653_0130536 3300046463 Bacteria 1779
126 Ga0495664_0011268 3300046477 Bacteria 5039
127 Ga0495664_0225112 3300046477 Bacteria 1135
128 Ga0495585_0018788 3300046492 Bacteria 3987
129 Ga0495585_0181359 3300046492 Bacteria 1082
130 Ga0495608_0104259 3300046511 Bacteria 1826
131 Ga0495618_0033085 3300046514 Bacteria 3241
132 Ga0495631_0156383 3300046518 Bacteria 978
133 Ga0495644_0084112 3300046523 Bacteria 1200
134 Ga0495663_0026238 3300046525 Bacteria 1705
135 Ga0495652_0097781 3300046529 Bacteria 2387
136 Ga0495652_0229565 3300046529 Bacteria 1389
137 Ga0495665_0172186 3300046531 Bacteria 1127
138 Ga0495640_0076460 3300046533 Bacteria 2234
139 Ga0495587_0102244 3300046536 Bacteria 1650
140 Ga0495667_0001516 3300046559 Bacteria 15336
141 Ga0495668_0241127 3300046616 Bacteria 990
142 Ga0495635_0001929 3300046663 Bacteria 14114
143 Ga0495658_0021125 3300046683 Bacteria 3428
144 Ga0495624_0332004 3300046690 Bacteria 915
145 Ga0495674_0004007 3300047319 Bacteria 14266
146 Ga0495680_0015633 3300047322 Bacteria 6541
147 Ga0495687_014107 3300047443 Bacteria 4131
148 Ga0495684_0015701 3300047471 Bacteria 5827
149 Ga0496102_0270184 3300048905 Bacteria 1603
150 Ga0496103_0110216 3300048906 Bacteria 1748
151 Ga0496114_0004479 3300048917 Bacteria 10839
152 Ga0496117_0004136 3300048920 Bacteria 16227
153 Ga0496118_0167322 3300048921 Bacteria 1349
154 Ga0496119_0000903 3300048922 Bacteria 38694
155 Ga0496120_0016048 3300048923 Bacteria 4910
156 Ga0496122_0000494 3300048925 Bacteria 81969
157 Ga0496122_0004226 3300048925 Bacteria 18048
158 Ga0496123_0005823 3300048926 Bacteria 12230
159 Ga0496123_0011731 3300048926 Bacteria 7556
160 Ga0496124_0010266 3300048927 Bacteria 9508
161 Ga0496125_0000422 3300048928 Bacteria 78615
162 Ga0496126_0004553 3300048929 Bacteria 16472
163 Ga0501031_0001314 3300049568 Bacteria 15263
164 Ga0501031_0027582 3300049568 Bacteria 3702
165 Ga0501031_0086342 3300049568 Bacteria 2046
166 Ga0501032_0000233 3300049569 Bacteria 46360
167 Ga0501032_0021812 3300049569 Bacteria 4448
168 Ga0501033_0003003 3300049570 Bacteria 14082
169 Ga0501033_0102147 3300049570 Bacteria 2091
170 Ga0501034_0014467 3300049571 Bacteria 8125
171 Ga0501034_0077110 3300049571 Bacteria 3338
172 Ga0501036_0005843 3300049572 Bacteria 9965
173 Ga0501036_0016533 3300049572 Bacteria 6162
174 Ga0501037_0001350 3300049573 Bacteria 18023
175 Ga0501037_0044872 3300049573 Bacteria 3245
176 Ga0501037_0146922 3300049573 Bacteria 1686
177 Ga0501038_0005806 3300049574 Bacteria 11429
178 Ga0501038_0009611 3300049574 Bacteria 8874
179 Ga0501038_0115748 3300049574 Bacteria 2216
180 Ga0501038_0182905 3300049574 Bacteria 1690
181 Ga0501039_0000365 3300049575 Bacteria 32363
182 Ga0501039_0347128 3300049575 Bacteria 1166
183 Ga0501040_0038995 3300049576 Bacteria 3231
184 Ga0501040_0051490 3300049576 Bacteria 2817
185 Ga0501042_0096235 3300049578 Bacteria 2127
186 Ga0501043_0002037 3300049579 Bacteria 17244
187 Ga0501043_0003689 3300049579 Bacteria 12576
188 Ga0501043_0173193 3300049579 Bacteria 1683
189 Ga0501046_0001460 3300049580 Bacteria 22677
190 Ga0501047_0006112 3300049581 Bacteria 11314
191 Ga0501047_0010251 3300049581 Bacteria 8864
192 Ga0501047_0147106 3300049581 Bacteria 2232
193 Ga0501048_0001995 3300049582 Bacteria 15499
194 Ga0501048_0004695 3300049582 Bacteria 10401
195 Ga0501048_0243169 3300049582 Bacteria 1277
196 Ga0501069_0000779 3300049585 Bacteria 14973
197 Ga0501070_0007149 3300049586 Bacteria 9485
198 Ga0501071_0171172 3300049587 Bacteria 1626
199 Ga0501071_0323863 3300049587 Bacteria 1171
200 Ga0501072_0034910 3300049588 Bacteria 3941
201 Ga0501072_0197049 3300049588 Bacteria 1606
202 Ga0501073_0003916 3300049589 Bacteria 11175
203 Ga0501073_0027001 3300049589 Bacteria 4109
204 Ga0501074_0007831 3300049590 Bacteria 7735
205 Ga0501074_0017622 3300049590 Bacteria 5186
206 Ga0501080_0000714 3300049742 Bacteria 26720
207 Ga0501035_0006576 3300049822 Bacteria 10887
208 Ga0501044_0002167 3300049823 Bacteria 22517
209 Ga0501044_0091720 3300049823 Bacteria 3064
210 Ga0501044_0199138 3300049823 Bacteria 1962
211 Ga0501044_0225742 3300049823 Bacteria 1822
212 Ga0501045_0094121 3300049824 Bacteria 2216
213 nmdc:mga05p37_276759_c1 3300050507 Bacteria 2004
214 nmdc:mga09592_284973_c1 3300050508 Bacteria 1433
215 nmdc:mga0qj67_6546_c1 3300050509 Bacteria 8557
216 nmdc:mga06r32_34494_c1 3300050510 Bacteria 4772
217 nmdc:mga08y16_4068_c1 3300050511 Bacteria 15273
218 nmdc:mga0n895_6209_c1 3300050512 Bacteria 10108
219 nmdc:mga0a205_4423_c1 3300050515 Bacteria 12614
220 Ga0495595_0203980 3300053084 Bacteria 985
221 Ga0500566_0068409 3300053094 Bacteria 1997
222 Ga0500660_066742 3300053100 Bacteria 1706
223 Ga0500553_074568 3300053101 Bacteria 1548
224 Ga0500556_0000070 3300053104 Bacteria 101159
225 Ga0500560_035407 3300053107 Bacteria 1536
226 Ga0501084_0014754 3300054114 Bacteria 6480
227 Ga0590071_020657 3300059421 Bacteria 1551
228 Ga0590075_002525 3300059424 Bacteria 4371
229 Ga0590077_023158 3300059426 Bacteria 1328

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044735 Ga0466968_0011387 Ga0466968_0011387_12_782 247
2 3300005337 Ga0070682_100043719 Ga0070682_1000437192 260
3 3300005343 Ga0070687_100005150 Ga0070687_1000051502 260
4 3300005366 Ga0070659_100075155 Ga0070659_1000751552 260
5 3300005466 Ga0070685_10002804 Ga0070685_100028045 260
6 3300005543 Ga0070672_100227720 Ga0070672_1002277202 260
7 3300005544 Ga0070686_100021754 Ga0070686_1000217543 260
8 3300005618 Ga0068864_100042374 Ga0068864_1000423744 260
9 3300005719 Ga0068861_100033365 Ga0068861_1000333652 260
10 3300005844 Ga0068862_100262791 Ga0068862_1002627911 260
11 3300009098 Ga0105245_10023671 Ga0105245_100236711 260
12 3300009101 Ga0105247_10133501 Ga0105247_101335011 260
13 3300014745 Ga0157377_10005673 Ga0157377_100056732 260
14 3300014968 Ga0157379_10052049 Ga0157379_100520493 260
15 3300009147 Ga0114129_10905129 Ga0114129_109051292 264
16 3300046531 Ga0495665_0172186 Ga0495665_0172186_230_1078 267
17 3300046616 Ga0495668_0241127 Ga0495668_0241127_51_857 268
18 3300053107 Ga0500560_035407 Ga0500560_035407_321_1148 268
19 iso_pu_bacteria 2795385470 2795784888 269
20 3300031456 Ga0307513_10137444 Ga0307513_101374442 270
21 3300045051 Ga0451576_0492749 Ga0451576_0492749_165_1010 270
22 iso_pu_bacteria 2675903060 2676494528 270
23 iso_pu_bacteria 2728369276 2729907325 270
24 iso_pu_bacteria 2884693830 2884694882 270
25 iso_pu_bacteria 2895427314 2895432636 270
26 iso_pu_bacteria 2895442618 2895446423 270
27 iso_pu_bacteria 8055066027 8055073283 270
28 3300035086 Ga0373934_0008712 Ga0373934_0008712_1647_2495 271
29 3300035119 Ga0373956_0180075 Ga0373956_0180075_100_948 271
30 3300044901 Ga0466960_0017567 Ga0466960_0017567_1248_2072 271
31 3300046477 Ga0495664_0225112 Ga0495664_0225112_252_1100 271
32 3300046511 Ga0495608_0104259 Ga0495608_0104259_288_1136 271
33 3300046559 Ga0495667_0001516 Ga0495667_0001516_789_1637 271
34 3300046683 Ga0495658_0021125 Ga0495658_0021125_631_1449 271
35 3300047443 Ga0495687_014107 Ga0495687_014107_183_1001 271
36 3300047471 Ga0495684_0015701 Ga0495684_0015701_4466_5314 271
37 3300053084 Ga0495595_0203980 Ga0495595_0203980_47_895 271
38 3300053094 Ga0500566_0068409 Ga0500566_0068409_1099_1917 271
39 3300053100 Ga0500660_066742 Ga0500660_066742_78_896 271
40 3300053101 Ga0500553_074568 Ga0500553_074568_651_1469 271
41 iso_pu_bacteria 2899359706 2899369981 271
42 3300005329 Ga0070683_100606224 Ga0070683_1006062241 272
43 3300030744 Ga0316181_1156287 Ga0316181_11562873 272
44 3300046453 Ga0495627_018839 Ga0495627_018839_1347_2183 272
45 3300046492 Ga0495585_0018788 Ga0495585_0018788_177_1013 272
46 3300048920 Ga0496117_0004136 Ga0496117_0004136_1083_1943 272
47 3300048922 Ga0496119_0000903 Ga0496119_0000903_5760_6629 272
48 3300048923 Ga0496120_0016048 Ga0496120_0016048_1961_2821 272
49 3300048925 Ga0496122_0000494 Ga0496122_0000494_80672_81532 272
50 3300048926 Ga0496123_0011731 Ga0496123_0011731_438_1298 272
51 3300048928 Ga0496125_0000422 Ga0496125_0000422_1157_2017 272
52 iso_pu_bacteria 2868088558 2868094119 272
53 iso_pu_bacteria 2919446982 2919449612 272
54 iso_pu_bacteria 2643221601 2644017763 273
55 iso_pu_bacteria 2643221631 2644178911 273
56 iso_pu_bacteria 2869162929 2869167835 273
57 iso_pu_bacteria 2883821847 2883826162 273
58 iso_pu_bacteria 2891326441 2891326449 273
59 iso_pu_bacteria 2891373044 2891375537 273
60 iso_pu_bacteria 2891968417 2891968978 273
61 iso_pu_bacteria 8056207758 8056210008 273
62 iso_pu_bacteria 2558860280 2559428191 274
63 iso_pu_bacteria 2816332119 2816420857 274
64 iso_pu_bacteria 2816332139 2816508541 274
65 iso_pu_bacteria 2818991472 2819747316 274
66 iso_pu_bacteria 2857729791 2857731687 274
67 iso_pu_bacteria 2917736166 2917736175 274
68 iso_pu_bacteria 2928121344 2928124408 274
69 iso_pu_bacteria 2935890801 2935894018 274
70 iso_pu_bacteria 2990088156 2990089115 274
71 3300049568 Ga0501031_0086342 Ga0501031_0086342_57_884 275
72 3300049576 Ga0501040_0051490 Ga0501040_0051490_491_1318 275
73 3300049581 Ga0501047_0147106 Ga0501047_0147106_1280_2119 275
74 3300049582 Ga0501048_0243169 Ga0501048_0243169_347_1174 275
75 3300049587 Ga0501071_0323863 Ga0501071_0323863_290_1117 275
76 3300049588 Ga0501072_0034910 Ga0501072_0034910_378_1205 275
77 3300025909 Ga0207705_10172771 Ga0207705_101727712 276
78 3300037466 Ga0395898_0011390 Ga0395898_0011390_7988_8833 276
79 3300038443 Ga0395901_0004974 Ga0395901_0004974_7907_8755 276
80 3300038443 Ga0395901_0012637 Ga0395901_0012637_443_1288 276
81 3300038443 Ga0395901_0025653 Ga0395901_0025653_378_1211 276
82 3300044658 Ga0466972_0083558 Ga0466972_0083558_284_1120 276
83 3300044765 Ga0466970_0033780 Ga0466970_0033780_845_1681 276
84 3300048905 Ga0496102_0270184 Ga0496102_0270184_74_907 276
85 3300048906 Ga0496103_0110216 Ga0496103_0110216_42_875 276
86 3300048917 Ga0496114_0004479 Ga0496114_0004479_5649_6482 276
87 3300003187 JGI25151J46595_10010116 JGI25151J46595_100101162 277
88 3300003373 JGI25407J50210_10048932 JGI25407J50210_100489321 277
89 3300005539 Ga0068853_100000834 Ga0068853_10000083418 277
90 3300005981 Ga0081538_10026659 Ga0081538_100266593 277
91 3300009093 Ga0105240_10407511 Ga0105240_104075112 277
92 3300009177 Ga0105248_10144052 Ga0105248_101440523 277
93 3300009545 Ga0105237_10080921 Ga0105237_100809211 277
94 3300009551 Ga0105238_10002688 Ga0105238_1000268815 277
95 3300010375 Ga0105239_10009677 Ga0105239_100096778 277
96 3300013105 Ga0157369_10121279 Ga0157369_101212792 277
97 3300013105 Ga0157369_10317735 Ga0157369_103177352 277
98 3300013250 Ga0171462_1002 Ga0171462_1002166 277
99 3300014325 Ga0163163_10279410 Ga0163163_102794102 277
100 3300014326 Ga0157380_10380744 Ga0157380_103807442 277
101 3300020078 Ga0206352_10373957 Ga0206352_103739572 277
102 3300025294 Ga0209025_1000436 Ga0209025_100043671 277
103 3300025904 Ga0207647_10140533 Ga0207647_101405333 277
104 3300025913 Ga0207695_10289709 Ga0207695_102897092 277
105 3300025914 Ga0207671_10007618 Ga0207671_100076182 277
106 3300025924 Ga0207694_10002422 Ga0207694_1000242212 277
107 3300026041 Ga0207639_10003472 Ga0207639_100034722 277
108 3300028556 Ga0265337_1006347 Ga0265337_10063475 277
109 3300028666 Ga0265336_10025753 Ga0265336_100257531 277
110 3300036647 Ga0316582_0336623 Ga0316582_0336623_153_1007 277
111 3300044712 Ga0453684_0097004 Ga0453684_0097004_1958_2812 277
112 3300044765 Ga0466970_0035003 Ga0466970_0035003_974_1807 277
113 3300044901 Ga0466960_0057171 Ga0466960_0057171_248_1108 277
114 3300046454 Ga0495592_0004026 Ga0495592_0004026_5147_6007 277
115 3300046492 Ga0495585_0181359 Ga0495585_0181359_78_938 277
116 3300048921 Ga0496118_0167322 Ga0496118_0167322_292_1131 277
117 3300048925 Ga0496122_0004226 Ga0496122_0004226_69_953 277
118 3300048926 Ga0496123_0005823 Ga0496123_0005823_8207_9091 277
119 3300048927 Ga0496124_0010266 Ga0496124_0010266_8213_9088 277
120 3300048929 Ga0496126_0004553 Ga0496126_0004553_15132_16007 277
121 3300049568 Ga0501031_0001314 Ga0501031_0001314_12996_13841 277
122 3300049568 Ga0501031_0027582 Ga0501031_0027582_2645_3505 277
123 3300049569 Ga0501032_0000233 Ga0501032_0000233_23863_24708 277
124 3300049569 Ga0501032_0021812 Ga0501032_0021812_1001_1861 277
125 3300049570 Ga0501033_0003003 Ga0501033_0003003_13121_13966 277
126 3300049570 Ga0501033_0102147 Ga0501033_0102147_870_1730 277
127 3300049571 Ga0501034_0014467 Ga0501034_0014467_1423_2268 277
128 3300049571 Ga0501034_0077110 Ga0501034_0077110_233_1093 277
129 3300049572 Ga0501036_0016533 Ga0501036_0016533_500_1345 277
130 3300049573 Ga0501037_0001350 Ga0501037_0001350_500_1345 277
131 3300049573 Ga0501037_0146922 Ga0501037_0146922_166_1026 277
132 3300049574 Ga0501038_0009611 Ga0501038_0009611_1165_2010 277
133 3300049574 Ga0501038_0115748 Ga0501038_0115748_827_1687 277
134 3300049575 Ga0501039_0000365 Ga0501039_0000365_4892_5737 277
135 3300049575 Ga0501039_0347128 Ga0501039_0347128_75_935 277
136 3300049576 Ga0501040_0038995 Ga0501040_0038995_1804_2649 277
137 3300049578 Ga0501042_0096235 Ga0501042_0096235_760_1605 277
138 3300049579 Ga0501043_0003689 Ga0501043_0003689_8312_9157 277
139 3300049579 Ga0501043_0173193 Ga0501043_0173193_799_1659 277
140 3300049580 Ga0501046_0001460 Ga0501046_0001460_5053_5898 277
141 3300049581 Ga0501047_0006112 Ga0501047_0006112_1674_2519 277
142 3300049582 Ga0501048_0001995 Ga0501048_0001995_11796_12641 277
143 3300049585 Ga0501069_0000779 Ga0501069_0000779_463_1308 277
144 3300049586 Ga0501070_0007149 Ga0501070_0007149_3460_4305 277
145 3300049587 Ga0501071_0171172 Ga0501071_0171172_463_1308 277
146 3300049588 Ga0501072_0197049 Ga0501072_0197049_437_1348 277
147 3300049589 Ga0501073_0003916 Ga0501073_0003916_2066_2911 277
148 3300049590 Ga0501074_0007831 Ga0501074_0007831_1673_2518 277
149 3300049742 Ga0501080_0000714 Ga0501080_0000714_3488_4333 277
150 3300049822 Ga0501035_0006576 Ga0501035_0006576_5219_6064 277
151 3300049823 Ga0501044_0002167 Ga0501044_0002167_12520_13365 277
152 3300049823 Ga0501044_0091720 Ga0501044_0091720_87_947 277
153 3300049824 Ga0501045_0094121 Ga0501045_0094121_516_1361 277
154 3300053104 Ga0500556_0000070 Ga0500556_0000070_30578_31462 277
155 3300054114 Ga0501084_0014754 Ga0501084_0014754_805_1650 277
156 3300059424 Ga0590075_002525 Ga0590075_002525_1875_2738 277
157 iso_pu_bacteria 8005246636 8005248139 277
158 3300001979 JGI24740J21852_10010900 JGI24740J21852_100109003 278
159 3300001989 JGI24739J22299_10021220 JGI24739J22299_100212202 278
160 3300003203 JGI25406J46586_10014946 JGI25406J46586_100149463 278
161 3300005337 Ga0070682_100155412 Ga0070682_1001554123 278
162 3300005354 Ga0070675_100208466 Ga0070675_1002084661 278
163 3300005457 Ga0070662_100326184 Ga0070662_1003261842 278
164 3300005548 Ga0070665_100451491 Ga0070665_1004514912 278
165 3300005578 Ga0068854_100209949 Ga0068854_1002099492 278
166 3300005719 Ga0068861_100093532 Ga0068861_1000935322 278
167 3300005834 Ga0068851_10230776 Ga0068851_102307762 278
168 3300005981 Ga0081538_10002207 Ga0081538_1000220715 278
169 3300005981 Ga0081538_10043197 Ga0081538_100431972 278
170 3300005985 Ga0081539_10002293 Ga0081539_100022933 278
171 3300006846 Ga0075430_100009728 Ga0075430_1000097288 278
172 3300006847 Ga0075431_100538040 Ga0075431_1005380401 278
173 3300006852 Ga0075433_10000738 Ga0075433_1000073821 278
174 3300009094 Ga0111539_10001313 Ga0111539_100013135 278
175 3300009147 Ga0114129_10002109 Ga0114129_1000210923 278
176 3300013105 Ga0157369_10439023 Ga0157369_104390232 278
177 3300013306 Ga0163162_10255629 Ga0163162_102556292 278
178 3300025904 Ga0207647_10003976 Ga0207647_100039764 278
179 3300025933 Ga0207706_10280241 Ga0207706_102802412 278
180 3300026116 Ga0207674_10022105 Ga0207674_100221055 278
181 3300026116 Ga0207674_10255654 Ga0207674_102556542 278
182 3300026118 Ga0207675_100004264 Ga0207675_10000426415 278
183 3300027907 Ga0207428_10009052 Ga0207428_100090523 278
184 3300028379 Ga0268266_10393812 Ga0268266_103938122 278
185 3300030521 Ga0307511_10000018 Ga0307511_1000001869 278
186 3300030521 Ga0307511_10044266 Ga0307511_100442661 278
187 3300030522 Ga0307512_10152195 Ga0307512_101521951 278
188 3300031731 Ga0307405_10027910 Ga0307405_100279103 278
189 3300031731 Ga0307405_10320724 Ga0307405_103207242 278
190 3300031824 Ga0307413_10006584 Ga0307413_100065842 278
191 3300031824 Ga0307413_10144851 Ga0307413_101448512 278
192 3300031852 Ga0307410_10122391 Ga0307410_101223912 278
193 3300031901 Ga0307406_10021725 Ga0307406_100217251 278
194 3300031903 Ga0307407_10001684 Ga0307407_100016844 278
195 3300031903 Ga0307407_10010796 Ga0307407_100107963 278
196 3300031903 Ga0307407_10031667 Ga0307407_100316673 278
197 3300031911 Ga0307412_10027406 Ga0307412_100274062 278
198 3300031995 Ga0307409_100000345 Ga0307409_10000034512 278
199 3300031995 Ga0307409_100009235 Ga0307409_1000092353 278
200 3300031995 Ga0307409_100300307 Ga0307409_1003003072 278
201 3300032002 Ga0307416_100006826 Ga0307416_1000068265 278
202 3300032002 Ga0307416_100020195 Ga0307416_1000201952 278
203 3300032002 Ga0307416_100135844 Ga0307416_1001358442 278
204 3300032002 Ga0307416_100216777 Ga0307416_1002167772 278
205 3300032004 Ga0307414_10072772 Ga0307414_100727722 278
206 3300032004 Ga0307414_10277279 Ga0307414_102772792 278
207 3300032005 Ga0307411_10006076 Ga0307411_100060764 278
208 3300032126 Ga0307415_100001886 Ga0307415_1000018864 278
209 3300032126 Ga0307415_100007115 Ga0307415_1000071153 278
210 3300032126 Ga0307415_100342894 Ga0307415_1003428941 278
211 3300032126 Ga0307415_100388698 Ga0307415_1003886982 278
212 3300035170 Ga0373943_0040947 Ga0373943_0040947_24_872 278
213 3300035692 Ga0373935_0051121 Ga0373935_0051121_20_868 278
214 3300035695 Ga0373927_0237856 Ga0373927_0237856_305_1165 278
215 3300035724 Ga0373933_0038703 Ga0373933_0038703_1750_2598 278
216 3300035725 Ga0373947_0239205 Ga0373947_0239205_13_873 278
217 3300036401 Ga0373937_0041348 Ga0373937_0041348_2639_3484 278
218 3300036401 Ga0373937_0245742 Ga0373937_0245742_163_1011 278
219 3300037068 Ga0373925_0086524 Ga0373925_0086524_664_1512 278
220 3300042008 Ga0439450_021324 Ga0439450_021324_240_1106 278
221 3300042126 Ga0450888_002469 Ga0450888_002469_872_1741 278
222 3300042531 Ga0450918_022598 Ga0450918_022598_142_1008 278
223 3300046461 Ga0495641_0091127 Ga0495641_0091127_495_1343 278
224 3300046463 Ga0495653_0130536 Ga0495653_0130536_34_882 278
225 3300046477 Ga0495664_0011268 Ga0495664_0011268_1424_2284 278
226 3300046514 Ga0495618_0033085 Ga0495618_0033085_130_990 278
227 3300046518 Ga0495631_0156383 Ga0495631_0156383_52_921 278
228 3300046523 Ga0495644_0084112 Ga0495644_0084112_152_1021 278
229 3300046525 Ga0495663_0026238 Ga0495663_0026238_222_1091 278
230 3300046529 Ga0495652_0097781 Ga0495652_0097781_1392_2240 278
231 3300046529 Ga0495652_0229565 Ga0495652_0229565_189_1049 278
232 3300046533 Ga0495640_0076460 Ga0495640_0076460_257_1117 278
233 3300046536 Ga0495587_0102244 Ga0495587_0102244_307_1155 278
234 3300046663 Ga0495635_0001929 Ga0495635_0001929_8362_9210 278
235 3300046690 Ga0495624_0332004 Ga0495624_0332004_35_883 278
236 3300047319 Ga0495674_0004007 Ga0495674_0004007_164_1024 278
237 3300047322 Ga0495680_0015633 Ga0495680_0015633_4827_5675 278
238 3300049572 Ga0501036_0005843 Ga0501036_0005843_6973_7833 278
239 3300049573 Ga0501037_0044872 Ga0501037_0044872_1089_1949 278
240 3300049574 Ga0501038_0005806 Ga0501038_0005806_7768_8628 278
241 3300049574 Ga0501038_0182905 Ga0501038_0182905_209_1069 278
242 3300049579 Ga0501043_0002037 Ga0501043_0002037_4014_4874 278
243 3300049581 Ga0501047_0010251 Ga0501047_0010251_830_1690 278
244 3300049582 Ga0501048_0004695 Ga0501048_0004695_6886_7746 278
245 3300049589 Ga0501073_0027001 Ga0501073_0027001_3096_3956 278
246 3300049590 Ga0501074_0017622 Ga0501074_0017622_979_1839 278
247 3300049823 Ga0501044_0199138 Ga0501044_0199138_202_1038 278
248 3300049823 Ga0501044_0225742 Ga0501044_0225742_243_1103 278
249 3300050507 nmdc:mga05p37_276759_c1 nmdc:mga05p37_276759_c1_1118_1984 278
250 3300050508 nmdc:mga09592_284973_c1 nmdc:mga09592_284973_c1_415_1281 278
251 3300050509 nmdc:mga0qj67_6546_c1 nmdc:mga0qj67_6546_c1_7059_7925 278
252 3300050510 nmdc:mga06r32_34494_c1 nmdc:mga06r32_34494_c1_1472_2338 278
253 3300050511 nmdc:mga08y16_4068_c1 nmdc:mga08y16_4068_c1_5154_6020 278
254 3300050512 nmdc:mga0n895_6209_c1 nmdc:mga0n895_6209_c1_7305_8171 278
255 3300050515 nmdc:mga0a205_4423_c1 nmdc:mga0a205_4423_c1_5504_6370 278
256 3300059421 Ga0590071_020657 Ga0590071_020657_575_1441 278
257 3300059426 Ga0590077_023158 Ga0590077_023158_339_1205 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01116

F_bP_aldolase

Fructose-bisphosphate aldolase class-II

19

299

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8q57-assembly1.cif.gz_A crystal structure of class ii sfp aldolase from yersinia aldovae (yasqia-zn-so4) with bound sulfate ions 0.9664 1 277
8q58-assembly1.cif.gz_A crystal structure of metal-dependent classii sulfofructosephosphate aldolase (sfpa) from hafnia paralvei hpsqia-zn 0.9664 1 277
8q59-assembly1.cif.gz_A-2 crystal structure of metal-dependent class ii sulfofructose phosphate aldolase from yersinia aldovae in complex with sulfofructose phosphate (yasqia-zn-sfp) 0.9642 1 277
8q59-assembly1.cif.gz_B-2 crystal structure of metal-dependent class ii sulfofructose phosphate aldolase from yersinia aldovae in complex with sulfofructose phosphate (yasqia-zn-sfp) 0.9623 1 277
6ofu-assembly1.cif.gz_A x-ray crystal structure of the ydji aldolase from escherichia coli k12 0.9499 3 277
ID Description Score Start End Superfamily
6ofuA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9496 3 277 3.20.20.70
3q94B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9429 2 277 3.20.20.70
1gvfB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9392 3 277 3.20.20.70
3q94B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9259 2 277 3.20.20.70
6ofuA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9247 3 277 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A0K2REI6-F1-model_v4 D-tagatose-1,6-bisphosphate aldolase subunit GatY 0.9922 162 276 GO:0005975
GO:0008270
GO:0016832
AF-A0A4Z0GJZ9-F1-model_v4 Fructose-bisphosphate aldolase 0.9779 1 138 GO:0005975
GO:0008270
GO:0016832
AF-X1FNT7-F1-model_v4 Fructose-bisphosphate aldolase 0.9768 151 276 GO:0005975
GO:0008270
GO:0016832
AF-A0A0B1ZTT6-F1-model_v4 Fructose-bisphosphate aldolase 0.976 1 143 GO:0005975
GO:0008270
GO:0016832
AF-A0A7J5BPI2-F1-model_v4 Class II fructose-bisphosphate aldolase 0.9711 1 275 GO:0005975
GO:0008270
GO:0016832

Feature Viewer

pLDDT pTM Quality
92.71 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map