F361410

General Info

Members Datasets Scaffolds Average Seq Length
250 149 249 260

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100470378|Ga0070697_1004703781
Length 281
Sequence MKSNGVMHPKSNTPTLEYSHTPFHSSDRKAFLWSISSLIILAWLILWLWDRSPYGRYLSHGRLGEIGLDGAGSVFLAITLYLVGWTLMTVAMMLPTTLPLLDMFRRLTARRPERAQLVALVIAGYLGVWAAFGVVAHLADWGLHHVVDYSPWLEANAWVIGGGTLLLAGAFQFSRLKYRCLDKCRAPLSFITEYWRGRHDHRNALLLGINHGMFCVGCCWALMLLMFGVGVGNVGWMLALGAIMAVEKNMPWGRKLSAPLGLALLACGALIVLNHSWPGRS

Samples

Sample ID Description Type Environment
1 2643221672 Variovorax sp. Root434 Isolate Unclassified
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
99 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
109 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
131 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 0
Rhizoplane 2.8
Rhizosphere 92.8
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1015006 3300003781 Bacteria 2678
2 Ga0055536_1015733 3300003781 Bacteria 2571
3 Ga0055530_10006277 3300003791 Bacteria 5354
4 Ga0055540_1001665 3300003792 Bacteria 12872
5 Ga0055531_10006669 3300003794 Bacteria 6478
6 Ga0065715_10149555 3300005293 Bacteria 1746
7 Ga0065707_10005656 3300005295 Unclassified 3725
8 Ga0065707_10137258 3300005295 Unclassified 1823
9 Ga0070680_100147987 3300005336 Bacteria 1971
10 Ga0070680_100159063 3300005336 Bacteria 1898
11 Ga0070680_100195779 3300005336 Bacteria 1704
12 Ga0070714_100036812 3300005435 Bacteria 4107
13 Ga0070713_100055873 3300005436 Bacteria 3282
14 Ga0070681_10593321 3300005458 Bacteria 1022
15 Ga0070706_100005557 3300005467 Bacteria 12001
16 Ga0070706_100031491 3300005467 Bacteria 4891
17 Ga0070706_100780468 3300005467 Bacteria 885
18 Ga0070707_100010341 3300005468 Bacteria 8688
19 Ga0070707_100553527 3300005468 Unclassified 1112
20 Ga0070698_100055602 3300005471 Bacteria 4011
21 Ga0070699_100342864 3300005518 Bacteria 1345
22 Ga0070697_100470378 3300005536 Unclassified 1097
23 Ga0070672_100077527 3300005543 Bacteria 2658
24 Ga0070696_100410685 3300005546 Unclassified 1061
25 Ga0070665_100014477 3300005548 Bacteria 7910
26 Ga0070665_100325787 3300005548 Bacteria 1540
27 Ga0070704_100369158 3300005549 Bacteria 1216
28 Ga0068861_100273536 3300005719 Unclassified 1451
29 Ga0068863_100183404 3300005841 Bacteria 2009
30 Ga0068858_100015290 3300005842 Bacteria 7221
31 Ga0081455_10031527 3300005937 Bacteria 4793
32 Ga0081455_10209481 3300005937 Bacteria 1453
33 Ga0081538_10044349 3300005981 Unclassified 2775
34 Ga0070717_10005742 3300006028 Bacteria 9084
35 Ga0070717_10069768 3300006028 Bacteria 2927
36 Ga0070717_10548736 3300006028 Bacteria 1046
37 Ga0075367_10076985 3300006178 Bacteria 2014
38 Ga0075428_100142843 3300006844 Bacteria 2602
39 Ga0075428_100393462 3300006844 Bacteria 1485
40 Ga0075430_100173409 3300006846 Unclassified 1794
41 Ga0075431_100001050 3300006847 Bacteria 24666
42 Ga0075431_100573387 3300006847 Bacteria 1114
43 Ga0075433_10010845 3300006852 Bacteria 7328
44 Ga0075433_10129487 3300006852 Bacteria 2242
45 Ga0075433_10154116 3300006852 Bacteria 2044
46 Ga0075433_10380629 3300006852 Bacteria 1246
47 Ga0075433_10416270 3300006852 Unclassified 1185
48 Ga0075434_100346005 3300006871 Bacteria 1508
49 Ga0075434_100581664 3300006871 Bacteria 1139
50 Ga0075429_100057836 3300006880 Bacteria 3376
51 Ga0075429_100092409 3300006880 Bacteria 2639
52 Ga0075436_100038317 3300006914 Bacteria 3309
53 Ga0075435_100130096 3300007076 Bacteria 2106
54 Ga0075435_100165005 3300007076 Bacteria 1867
55 Ga0111539_10030347 3300009094 Bacteria 6572
56 Ga0114129_10020225 3300009147 Bacteria 9472
57 Ga0114129_10063739 3300009147 Bacteria 5144
58 Ga0114129_10285477 3300009147 Bacteria 2204
59 Ga0114129_10291060 3300009147 Bacteria 2179
60 Ga0114129_10400785 3300009147 Bacteria 1808
61 Ga0114129_10563802 3300009147 Unclassified 1479
62 Ga0114129_10579378 3300009147 Bacteria 1456
63 Ga0105243_10596675 3300009148 Unclassified 1063
64 Ga0105248_10001017 3300009177 Bacteria 30997
65 Ga0157378_10040545 3300013297 Unclassified 4129
66 Ga0163162_10298498 3300013306 Unclassified 1743
67 Ga0157372_10562466 3300013307 Bacteria 1329
68 Ga0157380_10466726 3300014326 Bacteria 1217
69 Ga0157379_10045592 3300014968 Bacteria 3913
70 Ga0213872_10048736 3300021361 Bacteria 1925
71 Ga0209676_1002191 3300025292 Bacteria 14623
72 Ga0209050_1002651 3300025298 Bacteria 14662
73 Ga0209051_1002148 3300025303 Bacteria 14660
74 Ga0209257_1003162 3300025304 Bacteria 14662
75 Ga0207684_10021711 3300025910 Bacteria 5481
76 Ga0207707_10005667 3300025912 Bacteria 10934
77 Ga0207707_10262982 3300025912 Bacteria 1497
78 Ga0207693_10211196 3300025915 Bacteria 1526
79 Ga0207646_10004892 3300025922 Bacteria 14346
80 Ga0207700_10021664 3300025928 Bacteria 4393
81 Ga0207664_10029845 3300025929 Bacteria 4158
82 Ga0207664_10557211 3300025929 Bacteria 1029
83 Ga0207644_10032273 3300025931 Bacteria 3653
84 Ga0207644_10107890 3300025931 Bacteria 2101
85 Ga0207706_10139455 3300025933 Unclassified 2133
86 Ga0207691_10257637 3300025940 Bacteria 1504
87 Ga0207711_10043888 3300025941 Bacteria 3815
88 Ga0207679_10534615 3300025945 Bacteria 1050
89 Ga0207703_10102959 3300026035 Bacteria 2423
90 Ga0207702_10141767 3300026078 Bacteria 2176
91 Ga0207702_10310034 3300026078 Bacteria 1500
92 Ga0207641_10146289 3300026088 Bacteria 2137
93 Ga0207698_10544874 3300026142 Bacteria 1136
94 Ga0209984_1006140 3300027424 Bacteria 1466
95 Ga0209982_1011563 3300027552 Bacteria 1320
96 Ga0209983_1006707 3300027665 Unclassified 2363
97 Ga0209971_1009633 3300027682 Bacteria 2288
98 Ga0209971_1010948 3300027682 Bacteria 2148
99 Ga0209998_10010460 3300027717 Bacteria 1922
100 Ga0209974_10013620 3300027876 Unclassified 2709
101 Ga0207428_10073973 3300027907 Plasmid 2672
102 Ga0268266_10283435 3300028379 Bacteria 1541
103 Ga0265338_10000037 3300028800 Bacteria 237244
104 Ga0265332_10083736 3300031238 Bacteria 1352
105 Ga0307408_100007835 3300031548 Bacteria 7059
106 Ga0307408_100030879 3300031548 Unclassified 3725
107 Ga0307408_100258980 3300031548 Bacteria 1439
108 Ga0316575_10054577 3300031665 Bacteria 1591
109 Ga0307405_10034759 3300031731 Bacteria 3003
110 Ga0307405_10178600 3300031731 Bacteria 1522
111 Ga0307405_10227943 3300031731 Unclassified 1371
112 Ga0307410_10343309 3300031852 Unclassified 1191
113 Ga0307406_10386594 3300031901 Bacteria 1105
114 Ga0307412_10111769 3300031911 Bacteria 1952
115 Ga0307409_100025346 3300031995 Unclassified 4158
116 Ga0307409_100148604 3300031995 Bacteria 2030
117 Ga0307416_100205437 3300032002 Unclassified 1873
118 Ga0307414_10137019 3300032004 Bacteria 1910
119 Ga0307411_10008090 3300032005 Bacteria 5420
120 Ga0307411_10275196 3300032005 Bacteria 1337
121 Ga0307415_100124088 3300032126 Bacteria 1942
122 Ga0373935_0311193 3300035692 Bacteria 1115
123 Ga0373947_0048858 3300035725 Bacteria 2539
124 Ga0373947_0233429 3300035725 Unclassified 1212
125 Ga0373937_0086715 3300036401 Bacteria 2897
126 Ga0373925_0023938 3300037068 Bacteria 4455
127 Ga0373925_0166773 3300037068 Bacteria 1737
128 Ga0373925_0224347 3300037068 Bacteria 1501
129 Ga0395899_0028159 3300037312 Bacteria 4231
130 Ga0395899_0029876 3300037312 Bacteria 4101
131 Ga0395900_0000528 3300037418 Bacteria 53945
132 Ga0395900_0019091 3300037418 Bacteria 6990
133 Ga0395900_0027217 3300037418 Bacteria 5855
134 Ga0395900_0027694 3300037418 Bacteria 5805
135 Ga0395900_0051435 3300037418 Bacteria 4244
136 Ga0395898_0002958 3300037466 Bacteria 19307
137 Ga0395898_0011789 3300037466 Bacteria 9063
138 Ga0395898_0027391 3300037466 Bacteria 5722
139 Ga0395898_0029779 3300037466 Bacteria 5465
140 Ga0395905_0000047 3300037471 Bacteria 237582
141 Ga0395905_0000661 3300037471 Bacteria 45819
142 Ga0395901_0001602 3300038443 Bacteria 23437
143 Ga0395901_0001886 3300038443 Bacteria 21635
144 Ga0395901_0016095 3300038443 Bacteria 7619
145 Ga0395901_0121646 3300038443 Bacteria 2743
146 Ga0395901_0178611 3300038443 Bacteria 2226
147 Ga0436360_0945542 3300039438 Bacteria 3148
148 Ga0436360_1035420 3300039438 Bacteria 1632
149 Ga0436361_0783660 3300039447 Bacteria 2652
150 Ga0436362_1237578 3300039453 Bacteria 7161
151 Ga0439466_0033482 3300041411 Bacteria 1746
152 Ga0439441_000213 3300042001 Bacteria 5423
153 Ga0451576_0541510 3300045051 Bacteria 1223
154 Ga0495639_0207019 3300046475 Bacteria 962
155 Ga0495625_0000297 3300046660 Bacteria 76945
156 Ga0496104_0100360 3300048907 Bacteria 2771
157 Ga0496109_0123140 3300048912 Bacteria 2417
158 Ga0496109_0501629 3300048912 Bacteria 1146
159 Ga0496111_0034696 3300048914 Bacteria 3603
160 Ga0496112_0017529 3300048915 Bacteria 6730
161 Ga0496112_0616208 3300048915 Bacteria 1017
162 Ga0496113_0109438 3300048916 Bacteria 2149
163 Ga0501298_029974 3300049521 Bacteria 1062
164 Ga0501299_016293 3300049522 Unclassified 1315
165 Ga0501031_0012862 3300049568 Bacteria 5468
166 Ga0501032_0109851 3300049569 Bacteria 1825
167 Ga0501033_0049728 3300049570 Bacteria 3112
168 Ga0501037_0082942 3300049573 Unclassified 2322
169 Ga0501038_0006380 3300049574 Bacteria 10918
170 Ga0501039_0015944 3300049575 Bacteria 5753
171 Ga0501040_0007200 3300049576 Bacteria 7203
172 Ga0501040_0373407 3300049576 Bacteria 1023
173 Ga0501041_0001492 3300049577 Bacteria 12969
174 Ga0501042_0001585 3300049578 Bacteria 13498
175 Ga0501043_0007800 3300049579 Bacteria 8460
176 Ga0501046_0014311 3300049580 Bacteria 6699
177 Ga0501048_0002767 3300049582 Bacteria 13384
178 Ga0501048_0039695 3300049582 Bacteria 3375
179 Ga0501048_0150045 3300049582 Unclassified 1649
180 Ga0501068_0004863 3300049584 Bacteria 7316
181 Ga0501068_0020508 3300049584 Bacteria 3851
182 Ga0501069_0044489 3300049585 Bacteria 2458
183 Ga0501071_0025145 3300049587 Bacteria 4169
184 Ga0501071_0084589 3300049587 Bacteria 2325
185 Ga0501072_0097748 3300049588 Bacteria 2334
186 Ga0501072_0299010 3300049588 Unclassified 1279
187 Ga0501072_0443411 3300049588 Bacteria 1028
188 Ga0501074_0013176 3300049590 Bacteria 6012
189 Ga0501075_0001210 3300049591 Bacteria 16713
190 Ga0501075_0068328 3300049591 Bacteria 2684
191 Ga0501075_0102514 3300049591 Bacteria 2173
192 Ga0501075_0129211 3300049591 Bacteria 1924
193 Ga0501075_0352760 3300049591 Unclassified 1121
194 Ga0501076_0005297 3300049592 Bacteria 9250
195 Ga0501076_0059279 3300049592 Bacteria 3044
196 Ga0501076_0255121 3300049592 Bacteria 1435
197 Ga0501077_0006251 3300049593 Bacteria 7282
198 Ga0501077_0069370 3300049593 Bacteria 2234
199 Ga0501208_008423 3300049655 Bacteria 1391
200 Ga0501225_0025844 3300049705 Bacteria 1615
201 Ga0501225_0053478 3300049705 Unclassified 1127
202 Ga0501079_0001577 3300049741 Bacteria 16191
203 Ga0501079_0109803 3300049741 Bacteria 2142
204 Ga0501079_0117284 3300049741 Bacteria 2069
205 Ga0501081_0002175 3300049743 Bacteria 12312
206 Ga0501081_0013496 3300049743 Bacteria 5369
207 Ga0501081_0048733 3300049743 Bacteria 2916
208 Ga0501081_0484568 3300049743 Unclassified 921
209 Ga0501083_0055095 3300049744 Bacteria 2667
210 Ga0501283_037400 3300049779 Bacteria 832
211 Ga0501035_0138335 3300049822 Bacteria 2118
212 Ga0501045_0004371 3300049824 Bacteria 9743
213 Ga0501204_006468 3300049850 Unclassified 1301
214 nmdc:mga05p37_10080_c1 3300050507 Bacteria 11215
215 nmdc:mga05p37_105338_c1 3300050507 Bacteria 3470
216 nmdc:mga05p37_17884_c1 3300050507 Bacteria 8556
217 nmdc:mga05p37_261831_c1 3300050507 Bacteria 2069
218 nmdc:mga05p37_91457_c1 3300050507 Unclassified 3749
219 nmdc:mga09592_121454_c1 3300050508 Bacteria 2244
220 nmdc:mga09592_161209_c1 3300050508 Bacteria 1937
221 nmdc:mga09592_421168_c1 3300050508 Bacteria 1153
222 nmdc:mga09592_491378_c1 3300050508 Unclassified 1057
223 nmdc:mga09592_493423_c1 3300050508 Unclassified 1055
224 nmdc:mga09592_700073_c1 3300050508 Unclassified 862
225 nmdc:mga06r32_109313_c1 3300050510 Bacteria 2719
226 nmdc:mga06r32_188822_c1 3300050510 Bacteria 2048
227 nmdc:mga06r32_387899_c1 3300050510 Unclassified 1379
228 nmdc:mga06r32_789506_c1 3300050510 Bacteria 911
229 nmdc:mga08y16_20981_c1 3300050511 Bacteria 6896
230 nmdc:mga0n895_370617_c1 3300050512 Bacteria 1449
231 nmdc:mga0n895_473661_c1 3300050512 Bacteria 1263
232 nmdc:mga0rr50_277483_c1 3300050513 Bacteria 1398
233 nmdc:mga08x19_30755_c1 3300050514 Bacteria 3374
234 nmdc:mga08x19_53804_c1 3300050514 Bacteria 2590
235 nmdc:mga0a205_170458_c1 3300050515 Bacteria 2073
236 nmdc:mga0a205_236654_c1 3300050515 Unclassified 1708
237 nmdc:mga0a205_28573_c1 3300050515 Bacteria 5333
238 nmdc:mga0a205_419214_c1 3300050515 Unclassified 1201
239 nmdc:mga0a205_462928_c1 3300050515 Bacteria 1127
240 nmdc:mga0a205_60405_c1 3300050515 Bacteria 3661
241 Ga0501084_0001479 3300054114 Bacteria 18666
242 Ga0501084_0139110 3300054114 Bacteria 2044
243 Ga0501084_0415024 3300054114 Bacteria 1138
244 Ga0501082_0027557 3300060353 Bacteria 4891
245 Ga0501082_0032457 3300060353 Bacteria 4503
246 Ga0501082_0335272 3300060353 Unclassified 1318
247 Ga0501082_0339729 3300060353 Bacteria 1308
248 Ga0530510_0018032 3300061734 Bacteria 5004
249 Ga0530510_0286442 3300061734 Bacteria 1231

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10400785 Ga0114129_104007853 227
2 3300006852 Ga0075433_10154116 Ga0075433_101541162 228
3 3300050515 nmdc:mga0a205_170458_c1 nmdc:mga0a205_170458_c1_726_1490 228
4 3300005336 Ga0070680_100147987 Ga0070680_1001479872 232
5 3300035725 Ga0373947_0233429 Ga0373947_0233429_342_1103 232
6 3300037068 Ga0373925_0166773 Ga0373925_0166773_806_1567 232
7 3300060353 Ga0501082_0335272 Ga0501082_0335272_67_840 233
8 3300009147 Ga0114129_10579378 Ga0114129_105793782 236
9 3300049582 Ga0501048_0150045 Ga0501048_0150045_827_1549 236
10 3300049591 Ga0501075_0068328 Ga0501075_0068328_1133_1855 236
11 3300049592 Ga0501076_0255121 Ga0501076_0255121_567_1289 236
12 3300049743 Ga0501081_0013496 Ga0501081_0013496_1054_1776 236
13 3300050508 nmdc:mga09592_700073_c1 nmdc:mga09592_700073_c1_34_756 236
14 3300042001 Ga0439441_000213 Ga0439441_000213_4085_4828 238
15 3300049522 Ga0501299_016293 Ga0501299_016293_523_1284 238
16 3300049705 Ga0501225_0053478 Ga0501225_0053478_15_776 238
17 3300049850 Ga0501204_006468 Ga0501204_006468_383_1144 238
18 3300005937 Ga0081455_10209481 Ga0081455_102094812 239
19 3300009147 Ga0114129_10285477 Ga0114129_102854772 239
20 3300050508 nmdc:mga09592_493423_c1 nmdc:mga09592_493423_c1_302_1027 239
21 3300050510 nmdc:mga06r32_188822_c1 nmdc:mga06r32_188822_c1_978_1703 239
22 3300060353 Ga0501082_0339729 Ga0501082_0339729_501_1241 239
23 3300006914 Ga0075436_100038317 Ga0075436_1000383174 240
24 3300049576 Ga0501040_0373407 Ga0501040_0373407_211_996 240
25 3300049655 Ga0501208_008423 Ga0501208_008423_630_1367 240
26 3300049779 Ga0501283_037400 Ga0501283_037400_42_779 240
27 3300050514 nmdc:mga08x19_53804_c1 nmdc:mga08x19_53804_c1_1601_2362 240
28 3300054114 Ga0501084_0415024 Ga0501084_0415024_238_1023 240
29 3300005981 Ga0081538_10044349 Ga0081538_100443492 242
30 3300009147 Ga0114129_10563802 Ga0114129_105638022 242
31 3300025931 Ga0207644_10107890 Ga0207644_101078902 244
32 3300037471 Ga0395905_0000047 Ga0395905_0000047_43440_44258 244
33 3300049576 Ga0501040_0007200 Ga0501040_0007200_6205_6996 244
34 3300014326 Ga0157380_10466726 Ga0157380_104667262 245
35 3300037068 Ga0373925_0023938 Ga0373925_0023938_3603_4406 245
36 3300046475 Ga0495639_0207019 Ga0495639_0207019_204_947 246
37 3300031548 Ga0307408_100258980 Ga0307408_1002589802 247
38 3300005293 Ga0065715_10149555 Ga0065715_101495552 249
39 3300005336 Ga0070680_100159063 Ga0070680_1001590633 249
40 3300005336 Ga0070680_100195779 Ga0070680_1001957792 249
41 3300005458 Ga0070681_10593321 Ga0070681_105933211 249
42 3300005467 Ga0070706_100780468 Ga0070706_1007804681 249
43 3300005546 Ga0070696_100410685 Ga0070696_1004106851 249
44 3300006844 Ga0075428_100142843 Ga0075428_1001428433 249
45 3300006846 Ga0075430_100173409 Ga0075430_1001734092 249
46 3300006847 Ga0075431_100573387 Ga0075431_1005733871 249
47 3300006852 Ga0075433_10010845 Ga0075433_100108452 249
48 3300006880 Ga0075429_100057836 Ga0075429_1000578363 249
49 3300009147 Ga0114129_10063739 Ga0114129_100637394 249
50 3300009148 Ga0105243_10596675 Ga0105243_105966752 249
51 3300013297 Ga0157378_10040545 Ga0157378_100405454 249
52 3300025912 Ga0207707_10005667 Ga0207707_100056679 249
53 3300025912 Ga0207707_10262982 Ga0207707_102629822 249
54 3300045051 Ga0451576_0541510 Ga0451576_0541510_209_970 249
55 3300049587 Ga0501071_0084589 Ga0501071_0084589_637_1449 249
56 3300049588 Ga0501072_0443411 Ga0501072_0443411_23_835 249
57 3300049591 Ga0501075_0129211 Ga0501075_0129211_979_1791 249
58 3300049743 Ga0501081_0048733 Ga0501081_0048733_1024_1836 249
59 3300050507 nmdc:mga05p37_10080_c1 nmdc:mga05p37_10080_c1_7449_8198 249
60 3300050507 nmdc:mga05p37_91457_c1 nmdc:mga05p37_91457_c1_2984_3733 249
61 3300050508 nmdc:mga09592_121454_c1 nmdc:mga09592_121454_c1_1314_2075 249
62 3300050510 nmdc:mga06r32_789506_c1 nmdc:mga06r32_789506_c1_79_840 249
63 3300050515 nmdc:mga0a205_60405_c1 nmdc:mga0a205_60405_c1_1924_2673 249
64 3300054114 Ga0501084_0139110 Ga0501084_0139110_1140_1952 249
65 3300060353 Ga0501082_0032457 Ga0501082_0032457_318_1109 249
66 3300005719 Ga0068861_100273536 Ga0068861_1002735362 250
67 3300005842 Ga0068858_100015290 Ga0068858_1000152902 250
68 3300009094 Ga0111539_10030347 Ga0111539_100303474 250
69 3300013306 Ga0163162_10298498 Ga0163162_102984981 250
70 3300014968 Ga0157379_10045592 Ga0157379_100455922 250
71 3300025933 Ga0207706_10139455 Ga0207706_101394552 250
72 3300026035 Ga0207703_10102959 Ga0207703_101029593 250
73 3300026142 Ga0207698_10544874 Ga0207698_105448742 250
74 3300027907 Ga0207428_10073973 Ga0207428_100739734 250
75 3300050508 nmdc:mga09592_491378_c1 nmdc:mga09592_491378_c1_264_1016 250
76 3300050511 nmdc:mga08y16_20981_c1 nmdc:mga08y16_20981_c1_3293_4045 250
77 3300009147 Ga0114129_10291060 Ga0114129_102910602 251
78 3300049591 Ga0501075_0102514 Ga0501075_0102514_1275_2060 251
79 3300049591 Ga0501075_0352760 Ga0501075_0352760_239_1063 251
80 3300050507 nmdc:mga05p37_261831_c1 nmdc:mga05p37_261831_c1_957_1733 251
81 3300005295 Ga0065707_10137258 Ga0065707_101372582 252
82 3300005937 Ga0081455_10031527 Ga0081455_100315275 252
83 3300006847 Ga0075431_100001050 Ga0075431_10000105026 252
84 3300006880 Ga0075429_100092409 Ga0075429_1000924093 252
85 3300027424 Ga0209984_1006140 Ga0209984_10061402 252
86 3300027552 Ga0209982_1011563 Ga0209982_10115632 252
87 3300027665 Ga0209983_1006707 Ga0209983_10067073 252
88 3300027682 Ga0209971_1010948 Ga0209971_10109481 252
89 3300027717 Ga0209998_10010460 Ga0209998_100104602 252
90 3300027876 Ga0209974_10013620 Ga0209974_100136204 252
91 3300031548 Ga0307408_100007835 Ga0307408_1000078353 252
92 3300031731 Ga0307405_10034759 Ga0307405_100347592 252
93 3300031731 Ga0307405_10227943 Ga0307405_102279432 252
94 3300031901 Ga0307406_10386594 Ga0307406_103865942 252
95 3300049568 Ga0501031_0012862 Ga0501031_0012862_1870_2661 252
96 3300049573 Ga0501037_0082942 Ga0501037_0082942_1196_1987 252
97 3300049574 Ga0501038_0006380 Ga0501038_0006380_6755_7546 252
98 3300049575 Ga0501039_0015944 Ga0501039_0015944_690_1481 252
99 3300049577 Ga0501041_0001492 Ga0501041_0001492_5745_6536 252
100 3300049578 Ga0501042_0001585 Ga0501042_0001585_6876_7667 252
101 3300049579 Ga0501043_0007800 Ga0501043_0007800_835_1626 252
102 3300049580 Ga0501046_0014311 Ga0501046_0014311_4433_5224 252
103 3300049582 Ga0501048_0002767 Ga0501048_0002767_10128_10919 252
104 3300049584 Ga0501068_0004863 Ga0501068_0004863_3266_4057 252
105 3300049587 Ga0501071_0025145 Ga0501071_0025145_958_1749 252
106 3300049588 Ga0501072_0299010 Ga0501072_0299010_424_1194 252
107 3300049590 Ga0501074_0013176 Ga0501074_0013176_835_1626 252
108 3300049591 Ga0501075_0001210 Ga0501075_0001210_7310_8101 252
109 3300049592 Ga0501076_0005297 Ga0501076_0005297_3321_4112 252
110 3300049593 Ga0501077_0006251 Ga0501077_0006251_4234_5025 252
111 3300049741 Ga0501079_0001577 Ga0501079_0001577_8679_9470 252
112 3300049743 Ga0501081_0002175 Ga0501081_0002175_4859_5650 252
113 3300049743 Ga0501081_0484568 Ga0501081_0484568_135_893 252
114 3300049824 Ga0501045_0004371 Ga0501045_0004371_2480_3271 252
115 3300050508 nmdc:mga09592_161209_c1 nmdc:mga09592_161209_c1_949_1734 252
116 3300050510 nmdc:mga06r32_109313_c1 nmdc:mga06r32_109313_c1_146_931 252
117 3300054114 Ga0501084_0001479 Ga0501084_0001479_9554_10345 252
118 3300061734 Ga0530510_0018032 Ga0530510_0018032_117_908 252
119 3300031665 Ga0316575_10054577 Ga0316575_100545772 253
120 3300031852 Ga0307410_10343309 Ga0307410_103433092 253
121 3300005549 Ga0070704_100369158 Ga0070704_1003691581 254
122 3300006852 Ga0075433_10129487 Ga0075433_101294873 254
123 3300031731 Ga0307405_10178600 Ga0307405_101786002 254
124 3300031911 Ga0307412_10111769 Ga0307412_101117692 254
125 3300031995 Ga0307409_100148604 Ga0307409_1001486042 254
126 3300032004 Ga0307414_10137019 Ga0307414_101370192 254
127 3300032126 Ga0307415_100124088 Ga0307415_1001240882 254
128 3300037312 Ga0395899_0028159 Ga0395899_0028159_397_1176 254
129 3300037418 Ga0395900_0000528 Ga0395900_0000528_30510_31289 254
130 3300037418 Ga0395900_0027217 Ga0395900_0027217_3048_3827 254
131 3300037466 Ga0395898_0002958 Ga0395898_0002958_1897_2676 254
132 3300037466 Ga0395898_0011789 Ga0395898_0011789_2931_3710 254
133 3300037471 Ga0395905_0000661 Ga0395905_0000661_28017_28796 254
134 3300038443 Ga0395901_0001602 Ga0395901_0001602_1907_2686 254
135 3300038443 Ga0395901_0001886 Ga0395901_0001886_781_1560 254
136 3300048907 Ga0496104_0100360 Ga0496104_0100360_1529_2317 254
137 3300048914 Ga0496111_0034696 Ga0496111_0034696_1029_1817 254
138 3300049521 Ga0501298_029974 Ga0501298_029974_207_986 254
139 3300049705 Ga0501225_0025844 Ga0501225_0025844_392_1171 254
140 3300005467 Ga0070706_100005557 Ga0070706_10000555714 255
141 3300006852 Ga0075433_10416270 Ga0075433_104162702 255
142 3300009147 Ga0114129_10020225 Ga0114129_100202254 255
143 3300050507 nmdc:mga05p37_17884_c1 nmdc:mga05p37_17884_c1_3953_4756 255
144 3300050515 nmdc:mga0a205_419214_c1 nmdc:mga0a205_419214_c1_286_1089 255
145 3300031548 Ga0307408_100030879 Ga0307408_1000308794 256
146 3300031995 Ga0307409_100025346 Ga0307409_1000253463 256
147 3300032002 Ga0307416_100205437 Ga0307416_1002054372 256
148 3300032005 Ga0307411_10008090 Ga0307411_100080906 256
149 3300032005 Ga0307411_10275196 Ga0307411_102751961 256
150 3300050508 nmdc:mga09592_421168_c1 nmdc:mga09592_421168_c1_91_882 256
151 3300050510 nmdc:mga06r32_387899_c1 nmdc:mga06r32_387899_c1_454_1245 256
152 3300013307 Ga0157372_10562466 Ga0157372_105624662 257
153 3300037312 Ga0395899_0029876 Ga0395899_0029876_873_1652 257
154 3300037418 Ga0395900_0019091 Ga0395900_0019091_5419_6198 257
155 3300037418 Ga0395900_0027694 Ga0395900_0027694_2704_3483 257
156 3300037418 Ga0395900_0051435 Ga0395900_0051435_2690_3469 257
157 3300037466 Ga0395898_0027391 Ga0395898_0027391_1054_1833 257
158 3300037466 Ga0395898_0029779 Ga0395898_0029779_4311_5090 257
159 3300038443 Ga0395901_0016095 Ga0395901_0016095_5023_5802 257
160 3300038443 Ga0395901_0121646 Ga0395901_0121646_383_1162 257
161 3300038443 Ga0395901_0178611 Ga0395901_0178611_685_1464 257
162 3300039447 Ga0436361_0783660 Ga0436361_0783660_62_847 257
163 3300041411 Ga0439466_0033482 Ga0439466_0033482_776_1591 259
164 3300005841 Ga0068863_100183404 Ga0068863_1001834042 260
165 3300007076 Ga0075435_100130096 Ga0075435_1001300962 260
166 3300009177 Ga0105248_10001017 Ga0105248_1000101715 260
167 3300021361 Ga0213872_10048736 Ga0213872_100487362 260
168 3300025931 Ga0207644_10032273 Ga0207644_100322731 260
169 3300025941 Ga0207711_10043888 Ga0207711_100438882 260
170 3300026088 Ga0207641_10146289 Ga0207641_101462892 260
171 3300048912 Ga0496109_0123140 Ga0496109_0123140_846_1670 260
172 3300005295 Ga0065707_10005656 Ga0065707_100056564 261
173 3300005468 Ga0070707_100553527 Ga0070707_1005535271 261
174 3300005518 Ga0070699_100342864 Ga0070699_1003428642 261
175 3300005536 Ga0070697_100470378 Ga0070697_1004703781 261
176 3300006844 Ga0075428_100393462 Ga0075428_1003934622 261
177 3300006871 Ga0075434_100346005 Ga0075434_1003460052 261
178 3300007076 Ga0075435_100165005 Ga0075435_1001650052 261
179 3300036401 Ga0373937_0086715 Ga0373937_0086715_747_1559 261
180 3300049569 Ga0501032_0109851 Ga0501032_0109851_698_1522 261
181 3300049570 Ga0501033_0049728 Ga0501033_0049728_1454_2278 261
182 3300049582 Ga0501048_0039695 Ga0501048_0039695_472_1296 261
183 3300049584 Ga0501068_0020508 Ga0501068_0020508_986_1810 261
184 3300049585 Ga0501069_0044489 Ga0501069_0044489_181_1005 261
185 3300049588 Ga0501072_0097748 Ga0501072_0097748_1329_2144 261
186 3300049592 Ga0501076_0059279 Ga0501076_0059279_567_1391 261
187 3300049593 Ga0501077_0069370 Ga0501077_0069370_1153_1977 261
188 3300049741 Ga0501079_0109803 Ga0501079_0109803_1038_1853 261
189 3300049741 Ga0501079_0117284 Ga0501079_0117284_294_1118 261
190 3300049744 Ga0501083_0055095 Ga0501083_0055095_1550_2374 261
191 3300049822 Ga0501035_0138335 Ga0501035_0138335_823_1647 261
192 3300050507 nmdc:mga05p37_105338_c1 nmdc:mga05p37_105338_c1_423_1241 261
193 3300050512 nmdc:mga0n895_473661_c1 nmdc:mga0n895_473661_c1_155_982 261
194 3300050515 nmdc:mga0a205_236654_c1 nmdc:mga0a205_236654_c1_218_1027 261
195 3300050515 nmdc:mga0a205_28573_c1 nmdc:mga0a205_28573_c1_2457_3275 261
196 3300050515 nmdc:mga0a205_462928_c1 nmdc:mga0a205_462928_c1_46_861 261
197 3300060353 Ga0501082_0027557 Ga0501082_0027557_2670_3485 261
198 3300061734 Ga0530510_0286442 Ga0530510_0286442_130_945 261
199 3300005471 Ga0070698_100055602 Ga0070698_1000556024 262
200 3300006028 Ga0070717_10005742 Ga0070717_100057425 262
201 3300039438 Ga0436360_0945542 Ga0436360_0945542_1164_1964 262
202 3300039438 Ga0436360_1035420 Ga0436360_1035420_339_1139 262
203 3300006852 Ga0075433_10380629 Ga0075433_103806292 263
204 3300028800 Ga0265338_10000037 Ga0265338_10000037151 263
205 3300031238 Ga0265332_10083736 Ga0265332_100837362 263
206 3300025945 Ga0207679_10534615 Ga0207679_105346152 267
207 3300027682 Ga0209971_1009633 Ga0209971_10096331 267
208 iso_pu_bacteria 2643221672 2644400886 267
209 3300005435 Ga0070714_100036812 Ga0070714_1000368124 269
210 3300005436 Ga0070713_100055873 Ga0070713_1000558734 269
211 3300005467 Ga0070706_100031491 Ga0070706_1000314915 269
212 3300005468 Ga0070707_100010341 Ga0070707_1000103415 269
213 3300006028 Ga0070717_10069768 Ga0070717_100697683 269
214 3300006028 Ga0070717_10548736 Ga0070717_105487361 269
215 3300006871 Ga0075434_100581664 Ga0075434_1005816642 269
216 3300025910 Ga0207684_10021711 Ga0207684_100217112 269
217 3300025915 Ga0207693_10211196 Ga0207693_102111962 269
218 3300025922 Ga0207646_10004892 Ga0207646_1000489216 269
219 3300025928 Ga0207700_10021664 Ga0207700_100216645 269
220 3300025929 Ga0207664_10029845 Ga0207664_100298452 269
221 3300025929 Ga0207664_10557211 Ga0207664_105572111 269
222 3300026078 Ga0207702_10141767 Ga0207702_101417672 269
223 3300026078 Ga0207702_10310034 Ga0207702_103100343 269
224 3300035692 Ga0373935_0311193 Ga0373935_0311193_40_861 269
225 3300035725 Ga0373947_0048858 Ga0373947_0048858_237_1058 269
226 3300037068 Ga0373925_0224347 Ga0373925_0224347_231_1052 269
227 3300039453 Ga0436362_1237578 Ga0436362_1237578_4284_5099 269
228 3300048912 Ga0496109_0501629 Ga0496109_0501629_219_1037 269
229 3300048915 Ga0496112_0017529 Ga0496112_0017529_3248_4066 269
230 3300048915 Ga0496112_0616208 Ga0496112_0616208_184_999 269
231 3300048916 Ga0496113_0109438 Ga0496113_0109438_163_981 269
232 3300050512 nmdc:mga0n895_370617_c1 nmdc:mga0n895_370617_c1_500_1318 269
233 3300050513 nmdc:mga0rr50_277483_c1 nmdc:mga0rr50_277483_c1_196_1011 269
234 3300050514 nmdc:mga08x19_30755_c1 nmdc:mga08x19_30755_c1_981_1796 269
235 3300003781 Ga0055536_1015006 Ga0055536_10150064 271
236 3300003781 Ga0055536_1015733 Ga0055536_10157332 271
237 3300003791 Ga0055530_10006277 Ga0055530_100062775 271
238 3300003792 Ga0055540_1001665 Ga0055540_10016654 271
239 3300003794 Ga0055531_10006669 Ga0055531_100066695 271
240 3300005543 Ga0070672_100077527 Ga0070672_1000775273 271
241 3300005548 Ga0070665_100014477 Ga0070665_1000144778 271
242 3300005548 Ga0070665_100325787 Ga0070665_1003257872 271
243 3300006178 Ga0075367_10076985 Ga0075367_100769852 271
244 3300025292 Ga0209676_1002191 Ga0209676_100219113 271
245 3300025298 Ga0209050_1002651 Ga0209050_100265113 271
246 3300025303 Ga0209051_1002148 Ga0209051_100214813 271
247 3300025304 Ga0209257_1003162 Ga0209257_100316213 271
248 3300025940 Ga0207691_10257637 Ga0207691_102576372 271
249 3300028379 Ga0268266_10283435 Ga0268266_102834352 271
250 3300046660 Ga0495625_0000297 Ga0495625_0000297_30113_30928 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09948

DUF2182

Predicted metal-binding integral membrane protein (DUF2182)

82

271

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jt9-assembly1.cif.gz_A human vmat2 complex with ketanserin 0.3611 72 267
4q9v-assembly1.cif.gz_A crystal structure of tipe3 0.2854 54 264
4q9v-assembly1.cif.gz_A crystal structure of tipe3 0.283 54 264
6yof-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.2778 17 269
6fmy-assembly1.cif.gz_A imisx-ep of s-peptst 0.2709 17 269
ID Description Score Start End Superfamily
af_Q54TF0_1_186_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.4343 150 270 1.20.1270.60
af_Q2FXH1_4_180_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3987 77 270 1.20.1250.20
af_P38125_110_564_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.389 81 270 1.20.1250.20
af_Q2FXH1_4_180_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3844 77 270 1.20.1250.20
af_Q4D3I2_10_174_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3688 78 262 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A535EYR7-F1-model_v4 DUF2182 domain-containing protein 0.9157 90 268 GO:0016020
AF-A0A2V7SG42-F1-model_v4 DUF2182 domain-containing protein 0.8953 73 271 GO:0016020
AF-A0A7W1SNH0-F1-model_v4 DUF2182 domain-containing protein 0.8916 72 268 GO:0016020
AF-A0A844AYN8-F1-model_v4 DUF2182 domain-containing protein 0.8908 69 270 GO:0016020
AF-A0A829YJF3-F1-model_v4 DUF2182 domain-containing protein 0.8858 72 271 GO:0016020

Feature Viewer

pLDDT pTM Quality
78.86 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map