F355410

General Info

Members Datasets Scaffolds Average Seq Length
243 185 223 175

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100002901|Ga0068853_1000029012
Length 198
Sequence MADQFVAEIRIFPFNFAPTGWAMCNGQLLPISQNTALFSLLGTTYGGDGKSTFALPNMLDSAPMFWGQGSGLSLYDEGEASGTQNVTLLQTEMPIHDHVVQGNFNPGDVSTPSAATALTNSSPANAYTTGNPSLALMSPQAISVAGSSFPHNNMMPYLTLNFCIALQGIFPPRGAPNPGAPTKRGAKSSPIGVVRDDN

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
3 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
4 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
5 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
6 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
7 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
8 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
9 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
10 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
11 2922425934
12 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
13 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
14 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
15 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
16 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
17 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
18 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
142 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
143 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
144 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
145 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
146 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
147 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
148 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
168 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
169 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
170 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
171 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
180 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
181 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
184 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
185 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.32
Metatranscriptomes 0.83
Isolates 7.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.64
Nodule 4.12
Rhizoplane 0.82
Rhizosphere 79.84
Stem 0
Stem Tuber 0
Unclassified 6.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_859472 2162886006 Unclassified 960
2 Ga0055536_1022045 3300003781 Bacteria 1912
3 Ga0055530_10000084 3300003791 Bacteria 80615
4 Ga0055530_10017057 3300003791 Bacteria 2288
5 Ga0055540_1004778 3300003792 Bacteria 5965
6 Ga0055531_10000827 3300003794 Bacteria 25611
7 Ga0055531_10032509 3300003794 Bacteria 1703
8 Ga0065704_10187020 3300005289 Unclassified 1208
9 Ga0065707_10113046 3300005295 Bacteria 2341
10 Ga0065707_10160440 3300005295 Viruses 1568
11 Ga0070676_10067674 3300005328 Bacteria 2136
12 Ga0070670_101384495 3300005331 Bacteria 645
13 Ga0070682_100023169 3300005337 Unclassified 3686
14 Ga0070660_100023453 3300005339 Viruses 4571
15 Ga0070689_100800699 3300005340 Bacteria 829
16 Ga0070691_10000158 3300005341 Bacteria 21916
17 Ga0070687_100096604 3300005343 Unclassified 1645
18 Ga0070687_100119899 3300005343 Bacteria 1503
19 Ga0070661_100014888 3300005344 Bacteria 5488
20 Ga0070692_10607612 3300005345 Bacteria 724
21 Ga0070668_100300051 3300005347 Bacteria 1347
22 Ga0070669_100010233 3300005353 Bacteria 6664
23 Ga0070659_100015166 3300005366 Bacteria 5764
24 Ga0070701_10390466 3300005438 Bacteria 879
25 Ga0070663_100077674 3300005455 Bacteria 2431
26 Ga0070662_100163800 3300005457 Bacteria 1741
27 Ga0070681_10012035 3300005458 Bacteria 8580
28 Ga0070681_10294776 3300005458 Bacteria 1532
29 Ga0068867_100214065 3300005459 Unclassified 1549
30 Ga0070707_100009810 3300005468 Bacteria 8906
31 Ga0070698_100004263 3300005471 Bacteria 15721
32 Ga0070679_100018732 3300005530 Bacteria 6720
33 Ga0068853_100002901 3300005539 Bacteria 13023
34 Ga0068853_100015315 3300005539 Bacteria 6301
35 Ga0068853_100017586 3300005539 Bacteria 5900
36 Ga0068853_100017881 3300005539 Bacteria 5858
37 Ga0068853_100025051 3300005539 Bacteria 5006
38 Ga0070672_100300146 3300005543 Bacteria 1361
39 Ga0070693_100008236 3300005547 Bacteria 5127
40 Ga0068855_100014718 3300005563 Bacteria 9425
41 Ga0068855_100067636 3300005563 Unclassified 4160
42 Ga0068855_100073046 3300005563 Bacteria 3986
43 Ga0068855_100345358 3300005563 Bacteria 1640
44 Ga0070664_100006407 3300005564 Bacteria 9494
45 Ga0068857_100016694 3300005577 Bacteria 6431
46 Ga0068854_100053848 3300005578 Viruses 2891
47 Ga0068854_100330147 3300005578 Bacteria 1242
48 Ga0068856_100723673 3300005614 Bacteria 1015
49 Ga0068852_100015113 3300005616 Bacteria 5972
50 Ga0068852_100223372 3300005616 Bacteria 1792
51 Ga0068852_101348904 3300005616 Bacteria 735
52 Ga0068859_100368075 3300005617 Bacteria 1533
53 Ga0068859_101162189 3300005617 Bacteria 850
54 Ga0068866_10105506 3300005718 Bacteria 1562
55 Ga0068861_100027087 3300005719 Bacteria 4172
56 Ga0068861_101653412 3300005719 Unclassified 632
57 Ga0068860_100005073 3300005843 Bacteria 13393
58 Ga0068860_101469230 3300005843 Bacteria 703
59 Ga0068862_100023316 3300005844 Bacteria 5184
60 Ga0081455_10450846 3300005937 Bacteria 879
61 Ga0075365_10432547 3300006038 Bacteria 929
62 Ga0075364_10323037 3300006051 Bacteria 1051
63 Ga0070715_10000068 3300006163 Bacteria 33105
64 Ga0075367_10178931 3300006178 Bacteria 1322
65 Ga0075370_10140238 3300006353 Bacteria 1413
66 Ga0075428_100307359 3300006844 Viruses 1704
67 Ga0075430_100148054 3300006846 Viruses 1955
68 Ga0075430_100198088 3300006846 Unclassified 1668
69 Ga0075431_100663078 3300006847 Bacteria 1023
70 Ga0075429_100192137 3300006880 Unclassified 1788
71 Ga0075429_100782222 3300006880 Bacteria 836
72 Ga0097620_101162106 3300006931 Bacteria 850
73 Ga0105240_10200751 3300009093 Bacteria 2337
74 Ga0105240_10326023 3300009093 Bacteria 1749
75 Ga0105240_11381663 3300009093 Bacteria 741
76 Ga0111539_10309076 3300009094 Bacteria 1840
77 Ga0111539_10471321 3300009094 Bacteria 1462
78 Ga0114129_10075732 3300009147 Bacteria 4685
79 Ga0114129_10419668 3300009147 Bacteria 1760
80 Ga0105243_10135507 3300009148 Viruses 2094
81 Ga0105241_10319958 3300009174 Bacteria 1337
82 Ga0105242_10704098 3300009176 Bacteria 989
83 Ga0105237_10122735 3300009545 Bacteria 2592
84 Ga0105237_10741881 3300009545 Bacteria 988
85 Ga0105238_10138702 3300009551 Bacteria 2409
86 Ga0105238_11033301 3300009551 Bacteria 843
87 Ga0105249_10020367 3300009553 Bacteria 5930
88 Ga0105239_10127050 3300010375 Bacteria 2835
89 Ga0105239_10136899 3300010375 Bacteria 2727
90 Ga0105239_10242410 3300010375 Viruses 2023
91 Ga0157373_10032639 3300013100 Unclassified 3746
92 Ga0157370_10230533 3300013104 Bacteria 1714
93 Ga0157369_10035696 3300013105 Bacteria 5450
94 Ga0157369_10083856 3300013105 Bacteria 3407
95 Ga0157374_10108673 3300013296 Bacteria 2666
96 Ga0157378_10168304 3300013297 Bacteria 2054
97 Ga0163162_10125571 3300013306 Bacteria 2672
98 Ga0157372_10008787 3300013307 Bacteria 10729
99 Ga0157372_10119672 3300013307 Viruses 3023
100 Ga0163163_10581898 3300014325 Bacteria 1183
101 Ga0157380_10003556 3300014326 Bacteria 10715
102 Ga0157380_10173413 3300014326 Unclassified 1887
103 Ga0157376_10008261 3300014969 Bacteria 7499
104 Ga0213872_10004818 3300021361 Bacteria 7044
105 Ga0209233_1003075 3300025261 Bacteria 5942
106 Ga0209676_1009744 3300025292 Bacteria 4103
107 Ga0209050_1000001 3300025298 Bacteria 3563507
108 Ga0209050_1000051 3300025298 Bacteria 353153
109 Ga0209051_1001284 3300025303 Bacteria 22247
110 Ga0209257_1000028 3300025304 Bacteria 699493
111 Ga0209257_1000949 3300025304 Bacteria 40020
112 Ga0207642_10222990 3300025899 Bacteria 1054
113 Ga0207685_10000059 3300025905 Bacteria 33076
114 Ga0207645_10077570 3300025907 Bacteria 2129
115 Ga0207645_10550186 3300025907 Bacteria 783
116 Ga0207707_10006978 3300025912 Bacteria 9852
117 Ga0207707_10386455 3300025912 Bacteria 1203
118 Ga0207695_10154140 3300025913 Bacteria 2233
119 Ga0207695_10346768 3300025913 Bacteria 1372
120 Ga0207657_10070326 3300025919 Unclassified 2967
121 Ga0207649_10013233 3300025920 Unclassified 4603
122 Ga0207652_10106148 3300025921 Viruses 2486
123 Ga0207681_10006316 3300025923 Bacteria 7274
124 Ga0207694_10236498 3300025924 Bacteria 1492
125 Ga0207690_10173182 3300025932 Viruses 1618
126 Ga0207706_10019383 3300025933 Bacteria 6120
127 Ga0207706_10232362 3300025933 Bacteria 1613
128 Ga0207686_10451750 3300025934 Bacteria 989
129 Ga0207709_10143256 3300025935 Viruses 1645
130 Ga0207711_10095857 3300025941 Bacteria 2617
131 Ga0207689_10006623 3300025942 Bacteria 10217
132 Ga0207679_10049312 3300025945 Viruses 3071
133 Ga0207667_10042173 3300025949 Unclassified 4852
134 Ga0207667_10107070 3300025949 Bacteria 2884
135 Ga0207712_10057136 3300025961 Bacteria 2752
136 Ga0207640_10126785 3300025981 Bacteria 1839
137 Ga0207640_10464857 3300025981 Bacteria 1046
138 Ga0207639_10006234 3300026041 Bacteria 8103
139 Ga0207639_10009136 3300026041 Bacteria 6832
140 Ga0207639_10035780 3300026041 Viruses 3676
141 Ga0207639_10488420 3300026041 Bacteria 1123
142 Ga0207678_10110501 3300026067 Bacteria 2345
143 Ga0207708_10014151 3300026075 Bacteria 5965
144 Ga0207702_11320607 3300026078 Unclassified 715
145 Ga0207641_10116870 3300026088 Bacteria 2374
146 Ga0207674_10051206 3300026116 Unclassified 4214
147 Ga0207675_100012195 3300026118 Bacteria 8028
148 Ga0207675_100046935 3300026118 Bacteria 4034
149 Ga0207698_10074748 3300026142 Bacteria 2705
150 Ga0207698_10190131 3300026142 Bacteria 1828
151 Ga0207698_10356573 3300026142 Bacteria 1383
152 Ga0207698_10633540 3300026142 Bacteria 1057
153 Ga0268265_10007973 3300028380 Bacteria 7149
154 Ga0268265_10474432 3300028380 Unclassified 1174
155 Ga0268264_10046904 3300028381 Unclassified 3591
156 Ga0268264_11301870 3300028381 Bacteria 737
157 Ga0265329_10092689 3300031242 Bacteria 959
158 Ga0265327_10000026 3300031251 Bacteria 379288
159 Ga0307513_10471648 3300031456 Bacteria 976
160 Ga0307405_10019269 3300031731 Bacteria 3785
161 Ga0307405_10125172 3300031731 Bacteria 1766
162 Ga0307407_10498620 3300031903 Bacteria 892
163 Ga0307412_10087475 3300031911 Bacteria 2171
164 Ga0307412_10127275 3300031911 Unclassified 1844
165 Ga0307416_100185263 3300032002 Bacteria 1956
166 Ga0307416_100218787 3300032002 Bacteria 1824
167 Ga0307414_10458126 3300032004 Bacteria 1120
168 Ga0307411_10019979 3300032005 Bacteria 3884
169 Ga0307415_100028042 3300032126 Bacteria 3576
170 Ga0307415_100067236 3300032126 Bacteria 2504
171 Ga0307415_100668469 3300032126 Unclassified 933
172 Ga0395905_0092273 3300037471 Bacteria 2840
173 Ga0436364_1457760 3300037853 Bacteria 1190
174 Ga0395901_0752301 3300038443 Bacteria 968
175 Ga0436360_0209146 3300039438 Bacteria 1598
176 Ga0436361_0501586 3300039447 Bacteria 20741
177 Ga0439436_0043994 3300041404 Unclassified 1273
178 Ga0439439_0024833 3300041406 Bacteria 1506
179 Ga0451849_1444298 3300041505 Bacteria 1057
180 Ga0451843_0541450 3300041509 Bacteria 1341
181 Ga0439431_0005150 3300041997 Bacteria 2883
182 Ga0439449_0025391 3300042007 Bacteria 2215
183 Ga0450898_001804 3300042134 Unclassified 2885
184 Ga0439434_0007007 3300042435 Bacteria 3293
185 Ga0466972_0002241 3300044658 Bacteria 9504
186 Ga0466965_0047451 3300044683 Bacteria 2127
187 Ga0453684_0000738 3300044712 Bacteria 114519
188 Ga0453684_0048312 3300044712 Bacteria 5630
189 Ga0453684_0283245 3300044712 Bacteria 1889
190 Ga0466970_0002184 3300044765 Bacteria 9450
191 Ga0466957_0261115 3300044842 Bacteria 1154
192 Ga0466967_0427801 3300045976 Bacteria 1291
193 Ga0495582_0497046 3300046473 Bacteria 705
194 Ga0495594_0069466 3300046499 Bacteria 1957
195 Ga0495630_0177516 3300046517 Bacteria 1624
196 Ga0495666_0133032 3300046526 Unclassified 1162
197 Ga0495667_0398323 3300046559 Bacteria 867
198 Ga0495624_0068120 3300046690 Bacteria 2219
199 Ga0495676_0194302 3300047321 Bacteria 1414
200 Ga0496105_0035715 3300048908 Bacteria 4092
201 Ga0496112_0658296 3300048915 Bacteria 977
202 Ga0496121_0010969 3300048924 Bacteria 10118
203 Ga0496125_0453255 3300048928 Bacteria 734
204 Ga0496126_0138961 3300048929 Viruses 2093
205 Ga0501298_001929 3300049521 Bacteria 3094
206 Ga0501300_040413 3300049523 Bacteria 702
207 Ga0501217_014842 3300049661 Bacteria 1766
208 Ga0501253_001740 3300049683 Bacteria 2299
209 Ga0501257_049995 3300049686 Bacteria 1041
210 nmdc:mga00v17_191618_c1 3300050491 Bacteria 1320
211 nmdc:mga00v17_193152_c1 3300050491 Bacteria 1315
212 nmdc:mga06z11_33670_c1 3300050494 Bacteria 2508
213 nmdc:mga05p37_1211484_c1 3300050507 Bacteria 779
214 nmdc:mga05p37_264694_c1 3300050507 Bacteria 2056
215 nmdc:mga09592_833011_c1 3300050508 Bacteria 779
216 nmdc:mga09592_88245_c1 3300050508 Bacteria 2649
217 nmdc:mga0qj67_14195_c1 3300050509 Bacteria 6020
218 nmdc:mga06r32_283711_c1 3300050510 Bacteria 1643
219 nmdc:mga08y16_266390_c1 3300050511 Bacteria 1769
220 Ga0495655_0000072 3300053083 Bacteria 20024
221 Ga0500628_000192 3300053129 Bacteria 11866
222 Ga0587073_0014742 3300059492 Bacteria 1397
223 Ga0587088_009864 3300059508 Bacteria 1385

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013100 Ga0157373_10032639 Ga0157373_100326392 144
2 3300026088 Ga0207641_10116870 Ga0207641_101168702 151
3 3300005614 Ga0068856_100723673 Ga0068856_1007236732 152
4 3300009551 Ga0105238_11033301 Ga0105238_110333012 152
5 3300021361 Ga0213872_10004818 Ga0213872_100048185 160
6 3300039447 Ga0436361_0501586 Ga0436361_0501586_8361_8888 160
7 3300050508 nmdc:mga09592_833011_c1 nmdc:mga09592_833011_c1_166_660 161
8 3300014969 Ga0157376_10008261 Ga0157376_100082619 163
9 3300025941 Ga0207711_10095857 Ga0207711_100958572 163
10 3300025942 Ga0207689_10006623 Ga0207689_1000662310 163
11 3300026142 Ga0207698_10633540 Ga0207698_106335401 163
12 3300031251 Ga0265327_10000026 Ga0265327_1000002655 164
13 3300009148 Ga0105243_10135507 Ga0105243_101355071 167
14 3300025935 Ga0207709_10143256 Ga0207709_101432561 167
15 3300048929 Ga0496126_0138961 Ga0496126_0138961_433_966 167
16 iso_pu_bacteria 2522125168 2522550811 167
17 iso_pu_bacteria 2791355123 2792747421 167
18 iso_pu_bacteria 2904690495 2904692533 167
19 iso_pu_bacteria 2908756301 2908756801 167
20 iso_pu_bacteria 2512875016 2512933671 168
21 iso_pu_bacteria 2876363079 2876364074 168
22 iso_pu_bacteria 2903448605 2903453824 168
23 iso_pu_bacteria 2903521522 2903525766 168
24 iso_pu_bacteria 2903528002 2903532687 168
25 iso_pu_bacteria 2922425934 2922433746 168
26 iso_pu_bacteria 2937848649 2937853893 168
27 iso_pu_bacteria 2963644680 2963645532 168
28 iso_pu_bacteria 2968083720 2968085134 168
29 iso_pu_bacteria 2977922695 2977924685 168
30 iso_pu_bacteria 3004211236 3004218476 168
31 iso_pu_bacteria 3004218560 3004222891 168
32 iso_pu_bacteria 8019555841 8019563006 168
33 iso_pu_bacteria 8019565922 8019573087 168
34 3300005539 Ga0068853_100017586 Ga0068853_1000175861 169
35 3300005563 Ga0068855_100345358 Ga0068855_1003453583 169
36 3300005616 Ga0068852_100015113 Ga0068852_1000151134 169
37 3300005937 Ga0081455_10450846 Ga0081455_104508462 169
38 3300009147 Ga0114129_10419668 Ga0114129_104196682 169
39 3300009174 Ga0105241_10319958 Ga0105241_103199582 169
40 3300009176 Ga0105242_10704098 Ga0105242_107040982 169
41 3300025934 Ga0207686_10451750 Ga0207686_104517502 169
42 3300025981 Ga0207640_10464857 Ga0207640_104648572 169
43 3300026142 Ga0207698_10356573 Ga0207698_103565732 169
44 3300050507 nmdc:mga05p37_1211484_c1 nmdc:mga05p37_1211484_c1_63_581 169
45 iso_pu_bacteria 2971410472 2971414192 169
46 iso_pu_bacteria 8056533031 8056539274 169
47 3300005547 Ga0070693_100008236 Ga0070693_1000082365 170
48 3300006051 Ga0075364_10323037 Ga0075364_103230372 170
49 3300006178 Ga0075367_10178931 Ga0075367_101789313 170
50 3300006353 Ga0075370_10140238 Ga0075370_101402383 170
51 3300009094 Ga0111539_10309076 Ga0111539_103090762 170
52 3300041509 Ga0451843_0541450 Ga0451843_0541450_760_1281 170
53 3300044683 Ga0466965_0047451 Ga0466965_0047451_1480_2001 170
54 3300050491 nmdc:mga00v17_191618_c1 nmdc:mga00v17_191618_c1_521_1042 170
55 3300050491 nmdc:mga00v17_193152_c1 nmdc:mga00v17_193152_c1_495_1016 170
56 3300050494 nmdc:mga06z11_33670_c1 nmdc:mga06z11_33670_c1_1261_1782 170
57 3300050511 nmdc:mga08y16_266390_c1 nmdc:mga08y16_266390_c1_963_1529 170
58 3300053083 Ga0495655_0000072 Ga0495655_0000072_15261_15776 170
59 3300003791 Ga0055530_10000084 Ga0055530_1000008441 171
60 3300003794 Ga0055531_10000827 Ga0055531_1000082721 171
61 3300006846 Ga0075430_100198088 Ga0075430_1001980881 171
62 3300006880 Ga0075429_100782222 Ga0075429_1007822222 171
63 3300013104 Ga0157370_10230533 Ga0157370_102305332 171
64 3300025298 Ga0209050_1000051 Ga0209050_1000051120 171
65 3300025304 Ga0209257_1000028 Ga0209257_1000028248 171
66 3300032126 Ga0307415_100067236 Ga0307415_1000672362 171
67 3300039438 Ga0436360_0209146 Ga0436360_0209146_903_1436 171
68 3300041404 Ga0439436_0043994 Ga0439436_0043994_564_1082 171
69 3300044658 Ga0466972_0002241 Ga0466972_0002241_8420_8944 171
70 3300044765 Ga0466970_0002184 Ga0466970_0002184_8366_8890 171
71 3300053129 Ga0500628_000192 Ga0500628_000192_37_561 171
72 3300005295 Ga0065707_10113046 Ga0065707_101130462 172
73 3300005328 Ga0070676_10067674 Ga0070676_100676741 172
74 3300005337 Ga0070682_100023169 Ga0070682_1000231692 172
75 3300005339 Ga0070660_100023453 Ga0070660_1000234532 172
76 3300005343 Ga0070687_100119899 Ga0070687_1001198991 172
77 3300005344 Ga0070661_100014888 Ga0070661_1000148885 172
78 3300005353 Ga0070669_100010233 Ga0070669_1000102332 172
79 3300005366 Ga0070659_100015166 Ga0070659_1000151664 172
80 3300005438 Ga0070701_10390466 Ga0070701_103904662 172
81 3300005457 Ga0070662_100163800 Ga0070662_1001638002 172
82 3300005458 Ga0070681_10012035 Ga0070681_100120358 172
83 3300005458 Ga0070681_10294776 Ga0070681_102947762 172
84 3300005530 Ga0070679_100018732 Ga0070679_1000187327 172
85 3300005539 Ga0068853_100002901 Ga0068853_1000029012 172
86 3300005539 Ga0068853_100015315 Ga0068853_1000153152 172
87 3300005539 Ga0068853_100017881 Ga0068853_1000178812 172
88 3300005543 Ga0070672_100300146 Ga0070672_1003001462 172
89 3300005563 Ga0068855_100014718 Ga0068855_10001471810 172
90 3300005563 Ga0068855_100067636 Ga0068855_1000676362 172
91 3300005564 Ga0070664_100006407 Ga0070664_1000064074 172
92 3300005577 Ga0068857_100016694 Ga0068857_1000166943 172
93 3300005578 Ga0068854_100053848 Ga0068854_1000538484 172
94 3300005578 Ga0068854_100330147 Ga0068854_1003301472 172
95 3300005617 Ga0068859_100368075 Ga0068859_1003680751 172
96 3300005718 Ga0068866_10105506 Ga0068866_101055062 172
97 3300005843 Ga0068860_100005073 Ga0068860_1000050731 172
98 3300005843 Ga0068860_101469230 Ga0068860_1014692302 172
99 3300005844 Ga0068862_100023316 Ga0068862_1000233161 172
100 3300009093 Ga0105240_10200751 Ga0105240_102007512 172
101 3300009545 Ga0105237_10741881 Ga0105237_107418812 172
102 3300009553 Ga0105249_10020367 Ga0105249_100203673 172
103 3300010375 Ga0105239_10136899 Ga0105239_101368992 172
104 3300010375 Ga0105239_10242410 Ga0105239_102424102 172
105 3300013105 Ga0157369_10035696 Ga0157369_100356963 172
106 3300013105 Ga0157369_10083856 Ga0157369_100838562 172
107 3300013297 Ga0157378_10168304 Ga0157378_101683043 172
108 3300013307 Ga0157372_10008787 Ga0157372_100087879 172
109 3300013307 Ga0157372_10119672 Ga0157372_101196722 172
110 3300014325 Ga0163163_10581898 Ga0163163_105818981 172
111 3300014326 Ga0157380_10003556 Ga0157380_100035566 172
112 3300025261 Ga0209233_1003075 Ga0209233_10030754 172
113 3300025899 Ga0207642_10222990 Ga0207642_102229902 172
114 3300025907 Ga0207645_10077570 Ga0207645_100775703 172
115 3300025912 Ga0207707_10006978 Ga0207707_100069782 172
116 3300025912 Ga0207707_10386455 Ga0207707_103864552 172
117 3300025919 Ga0207657_10070326 Ga0207657_100703262 172
118 3300025920 Ga0207649_10013233 Ga0207649_100132336 172
119 3300025921 Ga0207652_10106148 Ga0207652_101061482 172
120 3300025923 Ga0207681_10006316 Ga0207681_100063163 172
121 3300025932 Ga0207690_10173182 Ga0207690_101731823 172
122 3300025933 Ga0207706_10019383 Ga0207706_100193831 172
123 3300025933 Ga0207706_10232362 Ga0207706_102323623 172
124 3300025945 Ga0207679_10049312 Ga0207679_100493122 172
125 3300025949 Ga0207667_10042173 Ga0207667_100421733 172
126 3300025949 Ga0207667_10107070 Ga0207667_101070702 172
127 3300025961 Ga0207712_10057136 Ga0207712_100571364 172
128 3300025981 Ga0207640_10126785 Ga0207640_101267852 172
129 3300026041 Ga0207639_10006234 Ga0207639_100062342 172
130 3300026041 Ga0207639_10009136 Ga0207639_100091366 172
131 3300026041 Ga0207639_10035780 Ga0207639_100357802 172
132 3300026075 Ga0207708_10014151 Ga0207708_100141513 172
133 3300026078 Ga0207702_11320607 Ga0207702_113206071 172
134 3300026116 Ga0207674_10051206 Ga0207674_100512062 172
135 3300026118 Ga0207675_100046935 Ga0207675_1000469353 172
136 3300026142 Ga0207698_10074748 Ga0207698_100747482 172
137 3300028380 Ga0268265_10007973 Ga0268265_100079733 172
138 3300028381 Ga0268264_10046904 Ga0268264_100469045 172
139 3300028381 Ga0268264_11301870 Ga0268264_113018702 172
140 3300031242 Ga0265329_10092689 Ga0265329_100926892 172
141 3300031731 Ga0307405_10125172 Ga0307405_101251722 172
142 3300031911 Ga0307412_10087475 Ga0307412_100874753 172
143 3300032002 Ga0307416_100185263 Ga0307416_1001852633 172
144 3300032126 Ga0307415_100668469 Ga0307415_1006684692 172
145 3300037853 Ga0436364_1457760 Ga0436364_1457760_603_1139 172
146 3300044712 Ga0453684_0000738 Ga0453684_0000738_86717_87238 172
147 3300044712 Ga0453684_0048312 Ga0453684_0048312_2846_3370 172
148 3300044712 Ga0453684_0283245 Ga0453684_0283245_940_1464 172
149 3300046499 Ga0495594_0069466 Ga0495594_0069466_293_817 172
150 3300046517 Ga0495630_0177516 Ga0495630_0177516_418_942 172
151 3300046526 Ga0495666_0133032 Ga0495666_0133032_569_1093 172
152 3300046690 Ga0495624_0068120 Ga0495624_0068120_863_1387 172
153 3300047321 Ga0495676_0194302 Ga0495676_0194302_519_1043 172
154 3300049661 Ga0501217_014842 Ga0501217_014842_1001_1528 172
155 3300049686 Ga0501257_049995 Ga0501257_049995_224_751 172
156 3300059492 Ga0587073_0014742 Ga0587073_0014742_343_867 172
157 3300059508 Ga0587088_009864 Ga0587088_009864_657_1181 172
158 3300003781 Ga0055536_1022045 Ga0055536_10220451 173
159 3300003791 Ga0055530_10017057 Ga0055530_100170573 173
160 3300003792 Ga0055540_1004778 Ga0055540_10047783 173
161 3300003794 Ga0055531_10032509 Ga0055531_100325094 173
162 3300005331 Ga0070670_101384495 Ga0070670_1013844951 173
163 3300005345 Ga0070692_10607612 Ga0070692_106076121 173
164 3300005468 Ga0070707_100009810 Ga0070707_1000098102 173
165 3300005563 Ga0068855_100073046 Ga0068855_1000730462 173
166 3300005616 Ga0068852_101348904 Ga0068852_1013489041 173
167 3300006038 Ga0075365_10432547 Ga0075365_104325472 173
168 3300006163 Ga0070715_10000068 Ga0070715_100000684 173
169 3300009094 Ga0111539_10471321 Ga0111539_104713212 173
170 3300009545 Ga0105237_10122735 Ga0105237_101227352 173
171 3300009551 Ga0105238_10138702 Ga0105238_101387021 173
172 3300010375 Ga0105239_10127050 Ga0105239_101270502 173
173 3300013306 Ga0163162_10125571 Ga0163162_101255712 173
174 3300025292 Ga0209676_1009744 Ga0209676_10097446 173
175 3300025298 Ga0209050_1000001 Ga0209050_10000013425 173
176 3300025303 Ga0209051_1001284 Ga0209051_100128426 173
177 3300025304 Ga0209257_1000949 Ga0209257_10009497 173
178 3300025905 Ga0207685_10000059 Ga0207685_1000005922 173
179 3300025924 Ga0207694_10236498 Ga0207694_102364982 173
180 3300031456 Ga0307513_10471648 Ga0307513_104716482 173
181 3300031731 Ga0307405_10019269 Ga0307405_100192692 173
182 3300031903 Ga0307407_10498620 Ga0307407_104986202 173
183 3300031911 Ga0307412_10127275 Ga0307412_101272751 173
184 3300032002 Ga0307416_100218787 Ga0307416_1002187872 173
185 3300032004 Ga0307414_10458126 Ga0307414_104581261 173
186 3300032005 Ga0307411_10019979 Ga0307411_100199795 173
187 3300032126 Ga0307415_100028042 Ga0307415_1000280422 173
188 3300041505 Ga0451849_1444298 Ga0451849_1444298_119_652 173
189 3300044842 Ga0466957_0261115 Ga0466957_0261115_80_610 173
190 3300045976 Ga0466967_0427801 Ga0466967_0427801_621_1151 173
191 3300046473 Ga0495582_0497046 Ga0495582_0497046_90_617 173
192 3300046559 Ga0495667_0398323 Ga0495667_0398323_116_643 173
193 3300048908 Ga0496105_0035715 Ga0496105_0035715_259_798 173
194 3300048915 Ga0496112_0658296 Ga0496112_0658296_47_580 173
195 3300048924 Ga0496121_0010969 Ga0496121_0010969_6324_6866 173
196 3300048928 Ga0496125_0453255 Ga0496125_0453255_160_690 173
197 3300049521 Ga0501298_001929 Ga0501298_001929_2528_3061 173
198 3300049523 Ga0501300_040413 Ga0501300_040413_91_624 173
199 3300049683 Ga0501253_001740 Ga0501253_001740_1736_2269 173
200 3300005341 Ga0070691_10000158 Ga0070691_1000015812 174
201 3300005455 Ga0070663_100077674 Ga0070663_1000776743 174
202 3300005616 Ga0068852_100223372 Ga0068852_1002233722 174
203 3300009093 Ga0105240_10326023 Ga0105240_103260232 174
204 3300009093 Ga0105240_11381663 Ga0105240_113816631 174
205 3300013296 Ga0157374_10108673 Ga0157374_101086733 174
206 3300025913 Ga0207695_10154140 Ga0207695_101541403 174
207 3300025913 Ga0207695_10346768 Ga0207695_103467683 174
208 3300026067 Ga0207678_10110501 Ga0207678_101105013 174
209 3300026142 Ga0207698_10190131 Ga0207698_101901313 174
210 3300037471 Ga0395905_0092273 Ga0395905_0092273_2079_2606 174
211 3300038443 Ga0395901_0752301 Ga0395901_0752301_172_699 174
212 2162886006 SwRhRL3b_contig_859472 SwRhRL3b_0827.00000490 176
213 3300005289 Ga0065704_10187020 Ga0065704_101870202 176
214 3300005295 Ga0065707_10160440 Ga0065707_101604402 176
215 3300005340 Ga0070689_100800699 Ga0070689_1008006992 176
216 3300005343 Ga0070687_100096604 Ga0070687_1000966042 176
217 3300005347 Ga0070668_100300051 Ga0070668_1003000511 176
218 3300005459 Ga0068867_100214065 Ga0068867_1002140651 176
219 3300005471 Ga0070698_100004263 Ga0070698_10000426311 176
220 3300005539 Ga0068853_100025051 Ga0068853_1000250512 176
221 3300005617 Ga0068859_101162189 Ga0068859_1011621891 176
222 3300005719 Ga0068861_100027087 Ga0068861_1000270872 176
223 3300005719 Ga0068861_101653412 Ga0068861_1016534121 176
224 3300006844 Ga0075428_100307359 Ga0075428_1003073593 176
225 3300006846 Ga0075430_100148054 Ga0075430_1001480543 176
226 3300006847 Ga0075431_100663078 Ga0075431_1006630782 176
227 3300006880 Ga0075429_100192137 Ga0075429_1001921373 176
228 3300006931 Ga0097620_101162106 Ga0097620_1011621061 176
229 3300009147 Ga0114129_10075732 Ga0114129_100757322 176
230 3300014326 Ga0157380_10173413 Ga0157380_101734133 176
231 3300025907 Ga0207645_10550186 Ga0207645_105501862 176
232 3300026041 Ga0207639_10488420 Ga0207639_104884202 176
233 3300026118 Ga0207675_100012195 Ga0207675_1000121954 176
234 3300028380 Ga0268265_10474432 Ga0268265_104744323 176
235 3300041406 Ga0439439_0024833 Ga0439439_0024833_378_908 176
236 3300041997 Ga0439431_0005150 Ga0439431_0005150_686_1216 176
237 3300042007 Ga0439449_0025391 Ga0439449_0025391_276_806 176
238 3300042134 Ga0450898_001804 Ga0450898_001804_1573_2103 176
239 3300042435 Ga0439434_0007007 Ga0439434_0007007_1769_2299 176
240 3300050507 nmdc:mga05p37_264694_c1 nmdc:mga05p37_264694_c1_81_611 176
241 3300050508 nmdc:mga09592_88245_c1 nmdc:mga09592_88245_c1_150_680 176
242 3300050509 nmdc:mga0qj67_14195_c1 nmdc:mga0qj67_14195_c1_459_989 176
243 3300050510 nmdc:mga06r32_283711_c1 nmdc:mga06r32_283711_c1_324_854 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

7

63

0.95

Feature Viewer

pLDDT pTM Quality
59.01 0.42 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map