F355053

General Info

Members Datasets Scaffolds Average Seq Length
242 151 239 120

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0378801|Ga0501038_0378801_678_1070
Length 130
Sequence MRLTLLKSKIHRATVTDADLNYEGSVSIDPALCEAAHLLPFERVEIYNCTNGERFATYVIHGKSGEICLNGAAARRVHRGDLVIIAAYADFDAEEAFTHKPQLVMVDGQNRIKHIHNDYSAGTSPKPVQV

Samples

Sample ID Description Type Environment
1 2738543023 Pedobacter sp. OK628 Isolate Unclassified
2 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
3 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
86 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
102 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
103 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
104 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
105 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
106 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
107 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
108 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
109 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
123 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
124 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
130 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
131 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
132 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
143 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
144 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
145 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
146 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
147 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
148 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
151 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 3.31
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.61
Nodule 0
Rhizoplane 3.31
Rhizosphere 80.99
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10144175 3300003316 Bacteria 2061
2 rootH2_10018562 3300003320 Bacteria 22451
3 rootH2_10096762 3300003320 Bacteria 5593
4 rootL2_10002231 3300003322 Bacteria 22272
5 rootL2_10083076 3300003322 Bacteria 2773
6 rootH1_10022147 3300003323 Bacteria 28450
7 rootH1_10027324 3300003323 Bacteria 28607
8 rootH1_10056248 3300003323 Unclassified 1664
9 Ga0055530_10057069 3300003791 Bacteria 883
10 Ga0065165_1000814 3300005262 Bacteria 41379
11 Ga0065707_10601730 3300005295 Bacteria 689
12 Ga0070658_10005569 3300005327 Bacteria 10215
13 Ga0070690_100934715 3300005330 Bacteria 680
14 Ga0070666_10021703 3300005335 Bacteria 4161
15 Ga0070680_101086874 3300005336 Bacteria 691
16 Ga0070682_100757347 3300005337 Unclassified 785
17 Ga0070689_100838533 3300005340 Bacteria 810
18 Ga0070687_100154326 3300005343 Bacteria 1351
19 Ga0070668_100454376 3300005347 Bacteria 1102
20 Ga0070669_100000028 3300005353 Bacteria 165168
21 Ga0070669_100284597 3300005353 Bacteria 1326
22 Ga0070673_100331639 3300005364 Bacteria 1346
23 Ga0070688_100388523 3300005365 Bacteria 1030
24 Ga0068867_101625223 3300005459 Unclassified 604
25 Ga0070685_10001867 3300005466 Bacteria 10999
26 Ga0070698_100205227 3300005471 Bacteria 1906
27 Ga0068853_101713307 3300005539 Bacteria 609
28 Ga0070693_100419332 3300005547 Bacteria 932
29 Ga0070665_100000122 3300005548 Bacteria 147483
30 Ga0070665_100091942 3300005548 Bacteria 3039
31 Ga0068855_100583205 3300005563 Bacteria 1207
32 Ga0068855_101577475 3300005563 Bacteria 672
33 Ga0070664_101493379 3300005564 Bacteria 639
34 Ga0068854_100493429 3300005578 Bacteria 1030
35 Ga0068864_100210323 3300005618 Unclassified 1791
36 Ga0068864_101404102 3300005618 Bacteria 700
37 Ga0068861_102163773 3300005719 Bacteria 557
38 Ga0068860_100470817 3300005843 Bacteria 1251
39 Ga0070717_10321273 3300006028 Bacteria 1379
40 Ga0070716_100395546 3300006173 Bacteria 992
41 Ga0075366_10635824 3300006195 Unclassified 662
42 Ga0075366_10760295 3300006195 Bacteria 602
43 Ga0097621_100214645 3300006237 Unclassified 1675
44 Ga0068871_101648709 3300006358 Unclassified 608
45 Ga0075428_100133493 3300006844 Bacteria 2699
46 Ga0075431_100997723 3300006847 Bacteria 804
47 Ga0075433_10287428 3300006852 Bacteria 1456
48 Ga0075434_100005640 3300006871 Bacteria 11417
49 Ga0075434_100239059 3300006871 Bacteria 1836
50 Ga0075434_100239971 3300006871 Bacteria 1832
51 Ga0075429_100094315 3300006880 Bacteria 2610
52 Ga0099795_10225569 3300007788 Bacteria 799
53 Ga0105240_10260306 3300009093 Bacteria 2001
54 Ga0111539_10004460 3300009094 Bacteria 18303
55 Ga0111539_10555679 3300009094 Bacteria 1337
56 Ga0111539_11143646 3300009094 Unclassified 904
57 Ga0105237_11872801 3300009545 Unclassified 608
58 Ga0105237_12317730 3300009545 Bacteria 547
59 Ga0105249_10189880 3300009553 Bacteria 2005
60 Ga0157371_10108465 3300013102 Bacteria 1970
61 Ga0157370_10756853 3300013104 Bacteria 885
62 Ga0157378_10623094 3300013297 Bacteria 1092
63 Ga0157375_10504034 3300013308 Bacteria 1374
64 Ga0157380_10076517 3300014326 Bacteria 2724
65 Ga0157380_10115828 3300014326 Bacteria 2261
66 Ga0157380_10233194 3300014326 Bacteria 1654
67 Ga0182008_10025547 3300014497 Bacteria 2999
68 Ga0209050_1003753 3300025298 Bacteria 10893
69 Ga0209050_1005223 3300025298 Bacteria 8294
70 Ga0209257_1027405 3300025304 Bacteria 1897
71 Ga0207680_10089395 3300025903 Bacteria 1955
72 Ga0207645_10019242 3300025907 Bacteria 4478
73 Ga0207705_10031012 3300025909 Bacteria 3815
74 Ga0207660_10860434 3300025917 Bacteria 740
75 Ga0207662_10362736 3300025918 Bacteria 975
76 Ga0207681_10000006 3300025923 Bacteria 496979
77 Ga0207681_10540022 3300025923 Bacteria 958
78 Ga0207670_10541876 3300025936 Bacteria 950
79 Ga0207665_10419010 3300025939 Bacteria 1023
80 Ga0207679_11130573 3300025945 Bacteria 719
81 Ga0207667_11511526 3300025949 Bacteria 642
82 Ga0207712_10224311 3300025961 Bacteria 1504
83 Ga0207668_10192649 3300025972 Bacteria 1617
84 Ga0207640_10440022 3300025981 Bacteria 1072
85 Ga0207702_12002450 3300026078 Bacteria 570
86 Ga0207641_10132691 3300026088 Bacteria 2238
87 Ga0207648_10765882 3300026089 Bacteria 897
88 Ga0207676_10175489 3300026095 Bacteria 1871
89 Ga0207675_102653935 3300026118 Bacteria 510
90 Ga0207428_10015366 3300027907 Bacteria 6624
91 Ga0268266_10001137 3300028379 Bacteria 33094
92 Ga0265318_10236874 3300028577 Unclassified 666
93 Ga0265330_10122316 3300031235 Bacteria 1109
94 Ga0265327_10492194 3300031251 Bacteria 529
95 Ga0265316_10207986 3300031344 Bacteria 1448
96 Ga0307513_10163964 3300031456 Bacteria 2110
97 Ga0307509_10246433 3300031507 Unclassified 1574
98 Ga0307509_10404496 3300031507 Bacteria 1071
99 Ga0307408_102024942 3300031548 Bacteria 554
100 Ga0265342_10186139 3300031712 Bacteria 1135
101 Ga0316576_10228591 3300031727 Bacteria 1399
102 Ga0316576_11057370 3300031727 Bacteria 577
103 Ga0316576_11162274 3300031727 Bacteria 546
104 Ga0316578_10041194 3300031728 Unclassified 2674
105 Ga0307516_10571028 3300031730 Bacteria 785
106 Ga0307405_10498691 3300031731 Bacteria 975
107 Ga0307409_102162060 3300031995 Bacteria 586
108 Ga0307416_101244241 3300032002 Unclassified 850
109 Ga0307414_10000040 3300032004 Bacteria 148876
110 Ga0307414_10091526 3300032004 Bacteria 2261
111 Ga0307411_10001491 3300032005 Bacteria 9616
112 Ga0316593_10075667 3300032168 Bacteria 1169
113 Ga0316593_10081628 3300032168 Bacteria 1129
114 Ga0316593_10153990 3300032168 Bacteria 837
115 Ga0316593_10197297 3300032168 Bacteria 743
116 Ga0316593_10377207 3300032168 Bacteria 546
117 Ga0316587_1108651 3300033529 Bacteria 537
118 Ga0373941_0045106 3300035115 Bacteria 1379
119 Ga0373931_0138619 3300035691 Unclassified 1407
120 Ga0373927_0033073 3300035695 Bacteria 3367
121 Ga0316582_0699977 3300036647 Bacteria 696
122 Ga0316584_0093487 3300036712 Bacteria 2251
123 Ga0316584_0323266 3300036712 Unclassified 1113
124 Ga0395905_0000146 3300037471 Bacteria 116742
125 Ga0400488_63292 3300038741 Unclassified 1429
126 Ga0400483_006213 3300039062 Bacteria 91642
127 Ga0451797_0820587 3300041453 Bacteria 558
128 Ga0451795_0279524 3300041456 Bacteria 829
129 Ga0451795_1264014 3300041456 Bacteria 1118
130 Ga0451795_1552704 3300041456 Bacteria 1125
131 Ga0451802_0749708 3300041460 Bacteria 936
132 Ga0451802_0872764 3300041460 Bacteria 557
133 Ga0451837_0459374 3300041494 Bacteria 692
134 Ga0451837_0560668 3300041494 Bacteria 1805
135 Ga0451837_0700923 3300041494 Bacteria 1312
136 Ga0451837_1140678 3300041494 Unclassified 825
137 Ga0451837_1409648 3300041494 Bacteria 2172
138 Ga0451855_1994868 3300041511 Unclassified 1429
139 Ga0450923_065663 3300042125 Bacteria 798
140 Ga0450903_047809 3300042138 Bacteria 629
141 Ga0451577_0038408 3300042876 Bacteria 4307
142 Ga0451577_0041738 3300042876 Bacteria 4118
143 Ga0451577_0053103 3300042876 Bacteria 3618
144 Ga0451577_0081650 3300042876 Bacteria 2883
145 Ga0451577_0094656 3300042876 Bacteria 2667
146 Ga0451577_0127472 3300042876 Bacteria 2281
147 Ga0451577_0216890 3300042876 Bacteria 1729
148 Ga0451577_0434208 3300042876 Bacteria 1192
149 Ga0451577_0711782 3300042876 Bacteria 909
150 Ga0451577_0724052 3300042876 Bacteria 900
151 Ga0451577_0784610 3300042876 Bacteria 861
152 Ga0451577_0906030 3300042876 Bacteria 794
153 Ga0451577_1819985 3300042876 Bacteria 534
154 Ga0451577_1904285 3300042876 Unclassified 521
155 Ga0466982_0179615 3300044672 Bacteria 1280
156 Ga0453683_0000079 3300044673 Bacteria 145949
157 Ga0453683_0000092 3300044673 Bacteria 136648
158 Ga0453683_0003424 3300044673 Bacteria 11699
159 Ga0453683_0036337 3300044673 Unclassified 3100
160 Ga0453683_0037441 3300044673 Bacteria 3051
161 Ga0453683_0048070 3300044673 Bacteria 2676
162 Ga0453683_0094501 3300044673 Bacteria 1875
163 Ga0453683_0215951 3300044673 Bacteria 1219
164 Ga0453683_0244308 3300044673 Bacteria 1143
165 Ga0453683_0254082 3300044673 Bacteria 1120
166 Ga0453683_0328100 3300044673 Unclassified 981
167 Ga0453683_0388918 3300044673 Bacteria 898
168 Ga0453683_0707450 3300044673 Bacteria 660
169 Ga0453684_0000337 3300044712 Bacteria 195296
170 Ga0453684_0001331 3300044712 Bacteria 72658
171 Ga0453684_0001471 3300044712 Bacteria 66489
172 Ga0453684_0004621 3300044712 Bacteria 28641
173 Ga0453684_0010620 3300044712 Bacteria 15692
174 Ga0453684_0016021 3300044712 Bacteria 11771
175 Ga0453684_0044420 3300044712 Bacteria 5946
176 Ga0453684_0077219 3300044712 Bacteria 4177
177 Ga0453684_0079912 3300044712 Bacteria 4086
178 Ga0453684_0085528 3300044712 Bacteria 3918
179 Ga0453684_0103694 3300044712 Bacteria 3474
180 Ga0453684_0214543 3300044712 Bacteria 2234
181 Ga0453684_0340931 3300044712 Bacteria 1692
182 Ga0453684_0377951 3300044712 Bacteria 1591
183 Ga0453684_0442817 3300044712 Bacteria 1447
184 Ga0453684_0913650 3300044712 Bacteria 939
185 Ga0453684_1116916 3300044712 Bacteria 832
186 Ga0453684_1205492 3300044712 Unclassified 794
187 Ga0453684_1250594 3300044712 Bacteria 777
188 Ga0453684_1503747 3300044712 Bacteria 694
189 Ga0453684_1987915 3300044712 Unclassified 586
190 Ga0453684_2510884 3300044712 Bacteria 508
191 Ga0451576_0000369 3300045051 Bacteria 107433
192 Ga0451576_0000638 3300045051 Bacteria 72729
193 Ga0451576_0001334 3300045051 Bacteria 42651
194 Ga0451576_0018376 3300045051 Bacteria 7666
195 Ga0451576_0023258 3300045051 Bacteria 6712
196 Ga0451576_0059733 3300045051 Unclassified 3979
197 Ga0451576_0069371 3300045051 Bacteria 3668
198 Ga0451576_0074336 3300045051 Bacteria 3537
199 Ga0451576_0822928 3300045051 Bacteria 975
200 Ga0451576_2051728 3300045051 Bacteria 589
201 Ga0495638_0000004 3300046460 Bacteria 700795
202 Ga0495597_0112425 3300046542 Bacteria 1141
203 Ga0495600_0796128 3300046809 Bacteria 563
204 Ga0495660_0200540 3300046810 Bacteria 953
205 Ga0496104_1263374 3300048907 Bacteria 641
206 Ga0496115_0720176 3300048918 Bacteria 783
207 Ga0501307_039988 3300049162 Bacteria 678
208 Ga0501290_007517 3300049513 Bacteria 1367
209 Ga0501298_016269 3300049521 Bacteria 1346
210 Ga0501312_091306 3300049528 Bacteria 562
211 Ga0501034_0371660 3300049571 Unclassified 1356
212 Ga0501038_0378801 3300049574 Bacteria 1098
213 Ga0501040_0412550 3300049576 Bacteria 970
214 Ga0501043_0232225 3300049579 Bacteria 1425
215 Ga0501222_006221 3300049662 Bacteria 1603
216 Ga0501238_016900 3300049671 Unclassified 1014
217 Ga0501257_000614 3300049686 Bacteria 7072
218 Ga0501261_054965 3300049690 Bacteria 662
219 Ga0501081_0408050 3300049743 Bacteria 1006
220 Ga0501083_0001663 3300049744 Bacteria 15176
221 Ga0501035_1304320 3300049822 Bacteria 560
222 Ga0501044_0103663 3300049823 Bacteria 2859
223 nmdc:mga09592_124845_c1 3300050508 Bacteria 2212
224 nmdc:mga08y16_4116_c1 3300050511 Bacteria 15175
225 nmdc:mga0n895_28015_c1 3300050512 Bacteria 5356
226 nmdc:mga0n895_53324_c1 3300050512 Bacteria 3974
227 nmdc:mga0rr50_278196_c1 3300050513 Bacteria 1396
228 nmdc:mga0rr50_352907_c1 3300050513 Bacteria 1237
229 nmdc:mga0a205_1199626_c1 3300050515 Bacteria 607
230 Ga0495655_0081055 3300053083 Bacteria 928
231 Ga0500556_0007168 3300053104 Bacteria 3186
232 Ga0500557_020601 3300053105 Bacteria 1878
233 Ga0500562_006209 3300053108 Bacteria 3015
234 Ga0500655_003685 3300053133 Bacteria 2760
235 Ga0500577_0056146 3300053142 Bacteria 1498
236 Ga0500604_0002490 3300053151 Bacteria 5020
237 Ga0500616_0000015 3300053153 Bacteria 633259
238 Ga0500622_0000182 3300053156 Bacteria 67645
239 Ga0500627_0137562 3300053158 Bacteria 1103

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0720176 Ga0496115_0720176_109_447 111
2 iso_pu_bacteria 2833640130 2833641411 111
3 iso_pu_bacteria 2738543023 2739304314 112
4 3300036712 Ga0316584_0323266 Ga0316584_0323266_663_1007 114
5 3300003320 rootH2_10018562 rootH2_100185625 115
6 3300003320 rootH2_10096762 rootH2_100967626 115
7 3300003322 rootL2_10002231 rootL2_1000223116 115
8 3300003322 rootL2_10083076 rootL2_100830762 115
9 3300003323 rootH1_10022147 rootH1_1002214729 115
10 3300003323 rootH1_10027324 rootH1_100273244 115
11 3300003323 rootH1_10056248 rootH1_100562482 115
12 3300003791 Ga0055530_10057069 Ga0055530_100570692 115
13 3300005262 Ga0065165_1000814 Ga0065165_100081410 115
14 3300005459 Ga0068867_101625223 Ga0068867_1016252231 115
15 3300005539 Ga0068853_101713307 Ga0068853_1017133071 115
16 3300005548 Ga0070665_100091942 Ga0070665_1000919422 115
17 3300005563 Ga0068855_100583205 Ga0068855_1005832052 115
18 3300005618 Ga0068864_100210323 Ga0068864_1002103232 115
19 3300005618 Ga0068864_101404102 Ga0068864_1014041022 115
20 3300006028 Ga0070717_10321273 Ga0070717_103212732 115
21 3300006195 Ga0075366_10635824 Ga0075366_106358242 115
22 3300006195 Ga0075366_10760295 Ga0075366_107602951 115
23 3300006237 Ga0097621_100214645 Ga0097621_1002146452 115
24 3300006358 Ga0068871_101648709 Ga0068871_1016487092 115
25 3300006844 Ga0075428_100133493 Ga0075428_1001334933 115
26 3300006847 Ga0075431_100997723 Ga0075431_1009977232 115
27 3300006880 Ga0075429_100094315 Ga0075429_1000943154 115
28 3300007788 Ga0099795_10225569 Ga0099795_102255692 115
29 3300009093 Ga0105240_10260306 Ga0105240_102603062 115
30 3300009094 Ga0111539_10004460 Ga0111539_100044608 115
31 3300009094 Ga0111539_11143646 Ga0111539_111436462 115
32 3300009545 Ga0105237_11872801 Ga0105237_118728012 115
33 3300009545 Ga0105237_12317730 Ga0105237_123177301 115
34 3300014326 Ga0157380_10076517 Ga0157380_100765173 115
35 3300014326 Ga0157380_10233194 Ga0157380_102331943 115
36 3300025298 Ga0209050_1003753 Ga0209050_10037532 115
37 3300025298 Ga0209050_1005223 Ga0209050_10052237 115
38 3300025304 Ga0209257_1027405 Ga0209257_10274052 115
39 3300025949 Ga0207667_11511526 Ga0207667_115115262 115
40 3300026088 Ga0207641_10132691 Ga0207641_101326913 115
41 3300026089 Ga0207648_10765882 Ga0207648_107658822 115
42 3300026095 Ga0207676_10175489 Ga0207676_101754893 115
43 3300027907 Ga0207428_10015366 Ga0207428_100153667 115
44 3300031235 Ga0265330_10122316 Ga0265330_101223161 115
45 3300031344 Ga0265316_10207986 Ga0265316_102079862 115
46 3300031456 Ga0307513_10163964 Ga0307513_101639641 115
47 3300031507 Ga0307509_10246433 Ga0307509_102464332 115
48 3300031507 Ga0307509_10404496 Ga0307509_104044962 115
49 3300031548 Ga0307408_102024942 Ga0307408_1020249422 115
50 3300031712 Ga0265342_10186139 Ga0265342_101861392 115
51 3300031727 Ga0316576_10228591 Ga0316576_102285912 115
52 3300031727 Ga0316576_11057370 Ga0316576_110573702 115
53 3300031727 Ga0316576_11162274 Ga0316576_111622741 115
54 3300031728 Ga0316578_10041194 Ga0316578_100411942 115
55 3300031730 Ga0307516_10571028 Ga0307516_105710281 115
56 3300031995 Ga0307409_102162060 Ga0307409_1021620602 115
57 3300032004 Ga0307414_10000040 Ga0307414_10000040101 115
58 3300032004 Ga0307414_10091526 Ga0307414_100915263 115
59 3300035691 Ga0373931_0138619 Ga0373931_0138619_378_725 115
60 3300035695 Ga0373927_0033073 Ga0373927_0033073_1674_2021 115
61 3300036712 Ga0316584_0093487 Ga0316584_0093487_1590_1940 115
62 3300039062 Ga0400483_006213 Ga0400483_006213_62875_63225 115
63 3300041456 Ga0451795_0279524 Ga0451795_0279524_113_460 115
64 3300041460 Ga0451802_0872764 Ga0451802_0872764_54_401 115
65 3300041494 Ga0451837_0459374 Ga0451837_0459374_182_529 115
66 3300041494 Ga0451837_0700923 Ga0451837_0700923_676_1023 115
67 3300041494 Ga0451837_1409648 Ga0451837_1409648_82_432 115
68 3300042125 Ga0450923_065663 Ga0450923_065663_399_746 115
69 3300042876 Ga0451577_0038408 Ga0451577_0038408_1070_1420 115
70 3300042876 Ga0451577_0041738 Ga0451577_0041738_2216_2566 115
71 3300042876 Ga0451577_0053103 Ga0451577_0053103_1119_1469 115
72 3300042876 Ga0451577_0081650 Ga0451577_0081650_1302_1652 115
73 3300042876 Ga0451577_0094656 Ga0451577_0094656_1203_1553 115
74 3300042876 Ga0451577_0127472 Ga0451577_0127472_1239_1589 115
75 3300042876 Ga0451577_0216890 Ga0451577_0216890_1104_1454 115
76 3300042876 Ga0451577_0434208 Ga0451577_0434208_736_1086 115
77 3300042876 Ga0451577_0711782 Ga0451577_0711782_189_539 115
78 3300042876 Ga0451577_0724052 Ga0451577_0724052_125_475 115
79 3300042876 Ga0451577_0784610 Ga0451577_0784610_20_370 115
80 3300042876 Ga0451577_0906030 Ga0451577_0906030_39_389 115
81 3300042876 Ga0451577_1819985 Ga0451577_1819985_72_419 115
82 3300042876 Ga0451577_1904285 Ga0451577_1904285_25_375 115
83 3300044672 Ga0466982_0179615 Ga0466982_0179615_647_994 115
84 3300044673 Ga0453683_0000079 Ga0453683_0000079_144727_145077 115
85 3300044673 Ga0453683_0000092 Ga0453683_0000092_33468_33818 115
86 3300044673 Ga0453683_0003424 Ga0453683_0003424_9635_9985 115
87 3300044673 Ga0453683_0036337 Ga0453683_0036337_2380_2730 115
88 3300044673 Ga0453683_0037441 Ga0453683_0037441_713_1063 115
89 3300044673 Ga0453683_0048070 Ga0453683_0048070_319_669 115
90 3300044673 Ga0453683_0094501 Ga0453683_0094501_1153_1509 115
91 3300044673 Ga0453683_0215951 Ga0453683_0215951_253_600 115
92 3300044673 Ga0453683_0244308 Ga0453683_0244308_380_730 115
93 3300044673 Ga0453683_0254082 Ga0453683_0254082_629_979 115
94 3300044673 Ga0453683_0328100 Ga0453683_0328100_112_462 115
95 3300044673 Ga0453683_0388918 Ga0453683_0388918_331_681 115
96 3300044673 Ga0453683_0707450 Ga0453683_0707450_119_469 115
97 3300044712 Ga0453684_0000337 Ga0453684_0000337_75205_75555 115
98 3300044712 Ga0453684_0001331 Ga0453684_0001331_5103_5453 115
99 3300044712 Ga0453684_0001471 Ga0453684_0001471_19550_19900 115
100 3300044712 Ga0453684_0004621 Ga0453684_0004621_16939_17286 115
101 3300044712 Ga0453684_0010620 Ga0453684_0010620_5476_5826 115
102 3300044712 Ga0453684_0016021 Ga0453684_0016021_7849_8199 115
103 3300044712 Ga0453684_0044420 Ga0453684_0044420_2077_2427 115
104 3300044712 Ga0453684_0077219 Ga0453684_0077219_2264_2614 115
105 3300044712 Ga0453684_0079912 Ga0453684_0079912_1535_1885 115
106 3300044712 Ga0453684_0103694 Ga0453684_0103694_1168_1518 115
107 3300044712 Ga0453684_0214543 Ga0453684_0214543_629_979 115
108 3300044712 Ga0453684_0340931 Ga0453684_0340931_155_502 115
109 3300044712 Ga0453684_0377951 Ga0453684_0377951_857_1207 115
110 3300044712 Ga0453684_0442817 Ga0453684_0442817_844_1194 115
111 3300044712 Ga0453684_0913650 Ga0453684_0913650_234_584 115
112 3300044712 Ga0453684_1116916 Ga0453684_1116916_30_380 115
113 3300044712 Ga0453684_1205492 Ga0453684_1205492_94_441 115
114 3300044712 Ga0453684_1250594 Ga0453684_1250594_161_511 115
115 3300044712 Ga0453684_1503747 Ga0453684_1503747_49_399 115
116 3300044712 Ga0453684_1987915 Ga0453684_1987915_190_540 115
117 3300045051 Ga0451576_0000369 Ga0451576_0000369_97347_97697 115
118 3300045051 Ga0451576_0000638 Ga0451576_0000638_67277_67627 115
119 3300045051 Ga0451576_0001334 Ga0451576_0001334_32530_32880 115
120 3300045051 Ga0451576_0018376 Ga0451576_0018376_4137_4487 115
121 3300045051 Ga0451576_0023258 Ga0451576_0023258_3176_3526 115
122 3300045051 Ga0451576_0059733 Ga0451576_0059733_2501_2851 115
123 3300045051 Ga0451576_0069371 Ga0451576_0069371_1212_1562 115
124 3300045051 Ga0451576_0074336 Ga0451576_0074336_292_639 115
125 3300045051 Ga0451576_0822928 Ga0451576_0822928_216_566 115
126 3300045051 Ga0451576_2051728 Ga0451576_2051728_14_361 115
127 3300046460 Ga0495638_0000004 Ga0495638_0000004_657901_658248 115
128 3300046542 Ga0495597_0112425 Ga0495597_0112425_239_586 115
129 3300046809 Ga0495600_0796128 Ga0495600_0796128_68_415 115
130 3300046810 Ga0495660_0200540 Ga0495660_0200540_179_526 115
131 3300049162 Ga0501307_039988 Ga0501307_039988_265_612 115
132 3300049513 Ga0501290_007517 Ga0501290_007517_198_545 115
133 3300049521 Ga0501298_016269 Ga0501298_016269_907_1254 115
134 3300049528 Ga0501312_091306 Ga0501312_091306_76_423 115
135 3300049576 Ga0501040_0412550 Ga0501040_0412550_365_715 115
136 3300049662 Ga0501222_006221 Ga0501222_006221_231_578 115
137 3300049671 Ga0501238_016900 Ga0501238_016900_558_905 115
138 3300049686 Ga0501257_000614 Ga0501257_000614_890_1237 115
139 3300049690 Ga0501261_054965 Ga0501261_054965_198_545 115
140 3300050508 nmdc:mga09592_124845_c1 nmdc:mga09592_124845_c1_225_572 115
141 3300050511 nmdc:mga08y16_4116_c1 nmdc:mga08y16_4116_c1_4416_4763 115
142 3300053104 Ga0500556_0007168 Ga0500556_0007168_904_1251 115
143 3300053105 Ga0500557_020601 Ga0500557_020601_244_591 115
144 3300053108 Ga0500562_006209 Ga0500562_006209_1428_1775 115
145 3300053133 Ga0500655_003685 Ga0500655_003685_2349_2696 115
146 3300053142 Ga0500577_0056146 Ga0500577_0056146_439_786 115
147 3300053151 Ga0500604_0002490 Ga0500604_0002490_2803_3150 115
148 3300053153 Ga0500616_0000015 Ga0500616_0000015_172588_172935 115
149 3300053156 Ga0500622_0000182 Ga0500622_0000182_38895_39242 115
150 3300053158 Ga0500627_0137562 Ga0500627_0137562_132_479 115
151 3300005353 Ga0070669_100284597 Ga0070669_1002845972 116
152 3300005563 Ga0068855_101577475 Ga0068855_1015774751 116
153 3300005564 Ga0070664_101493379 Ga0070664_1014933791 116
154 3300009553 Ga0105249_10189880 Ga0105249_101898802 116
155 3300013102 Ga0157371_10108465 Ga0157371_101084652 116
156 3300013104 Ga0157370_10756853 Ga0157370_107568532 116
157 3300014326 Ga0157380_10115828 Ga0157380_101158282 116
158 3300014497 Ga0182008_10025547 Ga0182008_100255474 116
159 3300025923 Ga0207681_10540022 Ga0207681_105400222 116
160 3300025945 Ga0207679_11130573 Ga0207679_111305732 116
161 3300025961 Ga0207712_10224311 Ga0207712_102243112 116
162 3300031251 Ga0265327_10492194 Ga0265327_104921942 116
163 3300031731 Ga0307405_10498691 Ga0307405_104986912 116
164 3300032005 Ga0307411_10001491 Ga0307411_100014916 116
165 3300032168 Ga0316593_10075667 Ga0316593_100756672 116
166 3300033529 Ga0316587_1108651 Ga0316587_11086512 116
167 3300041456 Ga0451795_1264014 Ga0451795_1264014_362_715 116
168 3300041456 Ga0451795_1552704 Ga0451795_1552704_166_519 116
169 3300044712 Ga0453684_0085528 Ga0453684_0085528_1641_1994 116
170 3300032002 Ga0307416_101244241 Ga0307416_1012442412 117
171 3300050513 nmdc:mga0rr50_352907_c1 nmdc:mga0rr50_352907_c1_860_1213 117
172 3300044712 Ga0453684_2510884 Ga0453684_2510884_74_436 118
173 3300013297 Ga0157378_10623094 Ga0157378_106230942 119
174 3300032168 Ga0316593_10081628 Ga0316593_100816282 120
175 3300032168 Ga0316593_10153990 Ga0316593_101539901 120
176 3300032168 Ga0316593_10197297 Ga0316593_101972972 120
177 3300032168 Ga0316593_10377207 Ga0316593_103772072 120
178 3300036647 Ga0316582_0699977 Ga0316582_0699977_179_544 120
179 3300037471 Ga0395905_0000146 Ga0395905_0000146_110671_111036 120
180 3300038741 Ga0400488_63292 Ga0400488_63292_726_1091 120
181 3300049571 Ga0501034_0371660 Ga0501034_0371660_607_1053 121
182 3300042138 Ga0450903_047809 Ga0450903_047809_30_401 122
183 iso_pu_bacteria 2916971899 2916974302 122
184 3300005336 Ga0070680_101086874 Ga0070680_1010868742 125
185 3300005343 Ga0070687_100154326 Ga0070687_1001543262 125
186 3300005364 Ga0070673_100331639 Ga0070673_1003316392 125
187 3300009094 Ga0111539_10555679 Ga0111539_105556791 125
188 3300025917 Ga0207660_10860434 Ga0207660_108604342 125
189 3300025918 Ga0207662_10362736 Ga0207662_103627362 125
190 3300049822 Ga0501035_1304320 Ga0501035_1304320_88_465 125
191 3300041511 Ga0451855_1994868 Ga0451855_1994868_41_451 126
192 3300041460 Ga0451802_0749708 Ga0451802_0749708_467_892 127
193 3300041494 Ga0451837_1140678 Ga0451837_1140678_183_608 127
194 3300005471 Ga0070698_100205227 Ga0070698_1002052273 128
195 3300041494 Ga0451837_0560668 Ga0451837_0560668_814_1206 128
196 3300049574 Ga0501038_0378801 Ga0501038_0378801_678_1070 128
197 3300049579 Ga0501043_0232225 Ga0501043_0232225_537_929 128
198 3300049823 Ga0501044_0103663 Ga0501044_0103663_1096_1488 128
199 3300003316 rootH1_10144175 rootH1_101441753 131
200 3300005295 Ga0065707_10601730 Ga0065707_106017302 131
201 3300005327 Ga0070658_10005569 Ga0070658_100055696 131
202 3300005330 Ga0070690_100934715 Ga0070690_1009347151 131
203 3300005335 Ga0070666_10021703 Ga0070666_100217033 131
204 3300005337 Ga0070682_100757347 Ga0070682_1007573471 131
205 3300005340 Ga0070689_100838533 Ga0070689_1008385332 131
206 3300005347 Ga0070668_100454376 Ga0070668_1004543762 131
207 3300005353 Ga0070669_100000028 Ga0070669_10000002891 131
208 3300005365 Ga0070688_100388523 Ga0070688_1003885232 131
209 3300005466 Ga0070685_10001867 Ga0070685_100018676 131
210 3300005547 Ga0070693_100419332 Ga0070693_1004193322 131
211 3300005548 Ga0070665_100000122 Ga0070665_100000122120 131
212 3300005578 Ga0068854_100493429 Ga0068854_1004934292 131
213 3300005719 Ga0068861_102163773 Ga0068861_1021637731 131
214 3300005843 Ga0068860_100470817 Ga0068860_1004708172 131
215 3300006173 Ga0070716_100395546 Ga0070716_1003955462 131
216 3300006852 Ga0075433_10287428 Ga0075433_102874282 131
217 3300006871 Ga0075434_100005640 Ga0075434_1000056407 131
218 3300006871 Ga0075434_100239059 Ga0075434_1002390593 131
219 3300006871 Ga0075434_100239971 Ga0075434_1002399713 131
220 3300013308 Ga0157375_10504034 Ga0157375_105040343 131
221 3300025903 Ga0207680_10089395 Ga0207680_100893952 131
222 3300025907 Ga0207645_10019242 Ga0207645_100192423 131
223 3300025909 Ga0207705_10031012 Ga0207705_100310122 131
224 3300025923 Ga0207681_10000006 Ga0207681_10000006405 131
225 3300025936 Ga0207670_10541876 Ga0207670_105418762 131
226 3300025939 Ga0207665_10419010 Ga0207665_104190102 131
227 3300025972 Ga0207668_10192649 Ga0207668_101926491 131
228 3300025981 Ga0207640_10440022 Ga0207640_104400222 131
229 3300026078 Ga0207702_12002450 Ga0207702_120024502 131
230 3300026118 Ga0207675_102653935 Ga0207675_1026539352 131
231 3300028379 Ga0268266_10001137 Ga0268266_1000113721 131
232 3300028577 Ga0265318_10236874 Ga0265318_102368742 131
233 3300035115 Ga0373941_0045106 Ga0373941_0045106_340_741 131
234 3300041453 Ga0451797_0820587 Ga0451797_0820587_45_455 131
235 3300048907 Ga0496104_1263374 Ga0496104_1263374_229_624 131
236 3300049743 Ga0501081_0408050 Ga0501081_0408050_188_586 131
237 3300049744 Ga0501083_0001663 Ga0501083_0001663_5631_6044 131
238 3300050512 nmdc:mga0n895_28015_c1 nmdc:mga0n895_28015_c1_138_533 131
239 3300050512 nmdc:mga0n895_53324_c1 nmdc:mga0n895_53324_c1_1829_2227 131
240 3300050513 nmdc:mga0rr50_278196_c1 nmdc:mga0rr50_278196_c1_569_967 131
241 3300050515 nmdc:mga0a205_1199626_c1 nmdc:mga0a205_1199626_c1_164_562 131
242 3300053083 Ga0495655_0081055 Ga0495655_0081055_412_807 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02261

Asp_decarbox

Aspartate decarboxylase

1

113

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oz8-assembly1.cif.gz_D crystal structure of mtb aspartate decarboxylase in active form 0.9888 27 116
1pt1-assembly1.cif.gz_A unprocessed pyruvoyl dependent aspartate decarboxylase with histidine 11 mutated to alanine 0.9876 1 114
1pqf-assembly1.cif.gz_B-2 glycine 24 to serine mutation of aspartate decarboxylase 0.9869 1 114
1pyq-assembly1.cif.gz_A unprocessed aspartate decarboxylase mutant, with alanine inserted at position 24 0.9866 1 114
2c45-assembly1.cif.gz_C native precursor of pyruvoyl dependent aspartate decarboxylase 0.9843 1 113
ID Description Score Start End Superfamily
4aonE00 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9859 26 114 2.40.40.20
2c45C00 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9843 1 113 2.40.40.20
2eeoB00 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9789 27 120 2.40.40.20
1pqhA00 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9721 1 114 2.40.40.20
3plxB00 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9719 27 121 2.40.40.20
ID Description Score Start End GO Terms
AF-A0A124FIJ7-F1-model_v4 Aspartate 1-decarboxylase (EC 4.1.1.11) 1.004 5 91 GO:0004068
GO:0005829
GO:0006523
GO:0015940
AF-A0A3D6DN83-F1-model_v4 Aspartate 1-decarboxylase (EC 4.1.1.11) 1.003 1 89 GO:0004068
GO:0005829
GO:0006523
GO:0015940
AF-A0A535F1Z3-F1-model_v4 Aspartate 1-decarboxylase (EC 4.1.1.11) (Aspartate alpha-decarboxylase) [Cleaved into: Aspartate 1-decarboxylase beta chain; Aspartate 1-decarboxylase alpha chain] 1.002 1 130 GO:0004068
GO:0005829
GO:0006523
GO:0015940
AF-A0A4Q4CZT1-F1-model_v4 Aspartate 1-decarboxylase (EC 4.1.1.11) 1.002 1 95 GO:0004068
GO:0005829
GO:0006523
GO:0015940
AF-A0A150RXD4-F1-model_v4 Aspartate 1-decarboxylase (EC 4.1.1.11) 1.001 1 99 GO:0004068
GO:0005829
GO:0006523
GO:0015940

Feature Viewer

pLDDT pTM Quality
96.51 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map