F355053
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 242 | 151 | 239 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300049574|Ga0501038_0378801|Ga0501038_0378801_678_1070 |
| Length | 130 |
| Sequence | MRLTLLKSKIHRATVTDADLNYEGSVSIDPALCEAAHLLPFERVEIYNCTNGERFATYVIHGKSGEICLNGAAARRVHRGDLVIIAAYADFDAEEAFTHKPQLVMVDGQNRIKHIHNDYSAGTSPKPVQV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 2 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 3 | 2916971899 | Alkalihalobacillus miscanthi AK13 | Isolate | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 40 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 41 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 44 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 55 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 76 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 78 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 79 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 80 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 81 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 82 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 83 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 84 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 85 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 86 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 87 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 88 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 89 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 90 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 91 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 92 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 93 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 94 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 96 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 97 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 98 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 99 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 100 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 101 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 102 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 103 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 104 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 105 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 106 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 107 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 108 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 109 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 110 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 111 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 112 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 113 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 114 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 115 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 120 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 121 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 123 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 124 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 130 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 131 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 132 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 133 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 144 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 145 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 146 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 147 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 148 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 149 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 150 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 151 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.45 |
| Metatranscriptomes | 3.31 |
| Isolates | 1.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.61 |
| Nodule | 0 |
| Rhizoplane | 3.31 |
| Rhizosphere | 80.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10144175 | 3300003316 | Bacteria | 2061 |
| 2 | rootH2_10018562 | 3300003320 | Bacteria | 22451 |
| 3 | rootH2_10096762 | 3300003320 | Bacteria | 5593 |
| 4 | rootL2_10002231 | 3300003322 | Bacteria | 22272 |
| 5 | rootL2_10083076 | 3300003322 | Bacteria | 2773 |
| 6 | rootH1_10022147 | 3300003323 | Bacteria | 28450 |
| 7 | rootH1_10027324 | 3300003323 | Bacteria | 28607 |
| 8 | rootH1_10056248 | 3300003323 | Unclassified | 1664 |
| 9 | Ga0055530_10057069 | 3300003791 | Bacteria | 883 |
| 10 | Ga0065165_1000814 | 3300005262 | Bacteria | 41379 |
| 11 | Ga0065707_10601730 | 3300005295 | Bacteria | 689 |
| 12 | Ga0070658_10005569 | 3300005327 | Bacteria | 10215 |
| 13 | Ga0070690_100934715 | 3300005330 | Bacteria | 680 |
| 14 | Ga0070666_10021703 | 3300005335 | Bacteria | 4161 |
| 15 | Ga0070680_101086874 | 3300005336 | Bacteria | 691 |
| 16 | Ga0070682_100757347 | 3300005337 | Unclassified | 785 |
| 17 | Ga0070689_100838533 | 3300005340 | Bacteria | 810 |
| 18 | Ga0070687_100154326 | 3300005343 | Bacteria | 1351 |
| 19 | Ga0070668_100454376 | 3300005347 | Bacteria | 1102 |
| 20 | Ga0070669_100000028 | 3300005353 | Bacteria | 165168 |
| 21 | Ga0070669_100284597 | 3300005353 | Bacteria | 1326 |
| 22 | Ga0070673_100331639 | 3300005364 | Bacteria | 1346 |
| 23 | Ga0070688_100388523 | 3300005365 | Bacteria | 1030 |
| 24 | Ga0068867_101625223 | 3300005459 | Unclassified | 604 |
| 25 | Ga0070685_10001867 | 3300005466 | Bacteria | 10999 |
| 26 | Ga0070698_100205227 | 3300005471 | Bacteria | 1906 |
| 27 | Ga0068853_101713307 | 3300005539 | Bacteria | 609 |
| 28 | Ga0070693_100419332 | 3300005547 | Bacteria | 932 |
| 29 | Ga0070665_100000122 | 3300005548 | Bacteria | 147483 |
| 30 | Ga0070665_100091942 | 3300005548 | Bacteria | 3039 |
| 31 | Ga0068855_100583205 | 3300005563 | Bacteria | 1207 |
| 32 | Ga0068855_101577475 | 3300005563 | Bacteria | 672 |
| 33 | Ga0070664_101493379 | 3300005564 | Bacteria | 639 |
| 34 | Ga0068854_100493429 | 3300005578 | Bacteria | 1030 |
| 35 | Ga0068864_100210323 | 3300005618 | Unclassified | 1791 |
| 36 | Ga0068864_101404102 | 3300005618 | Bacteria | 700 |
| 37 | Ga0068861_102163773 | 3300005719 | Bacteria | 557 |
| 38 | Ga0068860_100470817 | 3300005843 | Bacteria | 1251 |
| 39 | Ga0070717_10321273 | 3300006028 | Bacteria | 1379 |
| 40 | Ga0070716_100395546 | 3300006173 | Bacteria | 992 |
| 41 | Ga0075366_10635824 | 3300006195 | Unclassified | 662 |
| 42 | Ga0075366_10760295 | 3300006195 | Bacteria | 602 |
| 43 | Ga0097621_100214645 | 3300006237 | Unclassified | 1675 |
| 44 | Ga0068871_101648709 | 3300006358 | Unclassified | 608 |
| 45 | Ga0075428_100133493 | 3300006844 | Bacteria | 2699 |
| 46 | Ga0075431_100997723 | 3300006847 | Bacteria | 804 |
| 47 | Ga0075433_10287428 | 3300006852 | Bacteria | 1456 |
| 48 | Ga0075434_100005640 | 3300006871 | Bacteria | 11417 |
| 49 | Ga0075434_100239059 | 3300006871 | Bacteria | 1836 |
| 50 | Ga0075434_100239971 | 3300006871 | Bacteria | 1832 |
| 51 | Ga0075429_100094315 | 3300006880 | Bacteria | 2610 |
| 52 | Ga0099795_10225569 | 3300007788 | Bacteria | 799 |
| 53 | Ga0105240_10260306 | 3300009093 | Bacteria | 2001 |
| 54 | Ga0111539_10004460 | 3300009094 | Bacteria | 18303 |
| 55 | Ga0111539_10555679 | 3300009094 | Bacteria | 1337 |
| 56 | Ga0111539_11143646 | 3300009094 | Unclassified | 904 |
| 57 | Ga0105237_11872801 | 3300009545 | Unclassified | 608 |
| 58 | Ga0105237_12317730 | 3300009545 | Bacteria | 547 |
| 59 | Ga0105249_10189880 | 3300009553 | Bacteria | 2005 |
| 60 | Ga0157371_10108465 | 3300013102 | Bacteria | 1970 |
| 61 | Ga0157370_10756853 | 3300013104 | Bacteria | 885 |
| 62 | Ga0157378_10623094 | 3300013297 | Bacteria | 1092 |
| 63 | Ga0157375_10504034 | 3300013308 | Bacteria | 1374 |
| 64 | Ga0157380_10076517 | 3300014326 | Bacteria | 2724 |
| 65 | Ga0157380_10115828 | 3300014326 | Bacteria | 2261 |
| 66 | Ga0157380_10233194 | 3300014326 | Bacteria | 1654 |
| 67 | Ga0182008_10025547 | 3300014497 | Bacteria | 2999 |
| 68 | Ga0209050_1003753 | 3300025298 | Bacteria | 10893 |
| 69 | Ga0209050_1005223 | 3300025298 | Bacteria | 8294 |
| 70 | Ga0209257_1027405 | 3300025304 | Bacteria | 1897 |
| 71 | Ga0207680_10089395 | 3300025903 | Bacteria | 1955 |
| 72 | Ga0207645_10019242 | 3300025907 | Bacteria | 4478 |
| 73 | Ga0207705_10031012 | 3300025909 | Bacteria | 3815 |
| 74 | Ga0207660_10860434 | 3300025917 | Bacteria | 740 |
| 75 | Ga0207662_10362736 | 3300025918 | Bacteria | 975 |
| 76 | Ga0207681_10000006 | 3300025923 | Bacteria | 496979 |
| 77 | Ga0207681_10540022 | 3300025923 | Bacteria | 958 |
| 78 | Ga0207670_10541876 | 3300025936 | Bacteria | 950 |
| 79 | Ga0207665_10419010 | 3300025939 | Bacteria | 1023 |
| 80 | Ga0207679_11130573 | 3300025945 | Bacteria | 719 |
| 81 | Ga0207667_11511526 | 3300025949 | Bacteria | 642 |
| 82 | Ga0207712_10224311 | 3300025961 | Bacteria | 1504 |
| 83 | Ga0207668_10192649 | 3300025972 | Bacteria | 1617 |
| 84 | Ga0207640_10440022 | 3300025981 | Bacteria | 1072 |
| 85 | Ga0207702_12002450 | 3300026078 | Bacteria | 570 |
| 86 | Ga0207641_10132691 | 3300026088 | Bacteria | 2238 |
| 87 | Ga0207648_10765882 | 3300026089 | Bacteria | 897 |
| 88 | Ga0207676_10175489 | 3300026095 | Bacteria | 1871 |
| 89 | Ga0207675_102653935 | 3300026118 | Bacteria | 510 |
| 90 | Ga0207428_10015366 | 3300027907 | Bacteria | 6624 |
| 91 | Ga0268266_10001137 | 3300028379 | Bacteria | 33094 |
| 92 | Ga0265318_10236874 | 3300028577 | Unclassified | 666 |
| 93 | Ga0265330_10122316 | 3300031235 | Bacteria | 1109 |
| 94 | Ga0265327_10492194 | 3300031251 | Bacteria | 529 |
| 95 | Ga0265316_10207986 | 3300031344 | Bacteria | 1448 |
| 96 | Ga0307513_10163964 | 3300031456 | Bacteria | 2110 |
| 97 | Ga0307509_10246433 | 3300031507 | Unclassified | 1574 |
| 98 | Ga0307509_10404496 | 3300031507 | Bacteria | 1071 |
| 99 | Ga0307408_102024942 | 3300031548 | Bacteria | 554 |
| 100 | Ga0265342_10186139 | 3300031712 | Bacteria | 1135 |
| 101 | Ga0316576_10228591 | 3300031727 | Bacteria | 1399 |
| 102 | Ga0316576_11057370 | 3300031727 | Bacteria | 577 |
| 103 | Ga0316576_11162274 | 3300031727 | Bacteria | 546 |
| 104 | Ga0316578_10041194 | 3300031728 | Unclassified | 2674 |
| 105 | Ga0307516_10571028 | 3300031730 | Bacteria | 785 |
| 106 | Ga0307405_10498691 | 3300031731 | Bacteria | 975 |
| 107 | Ga0307409_102162060 | 3300031995 | Bacteria | 586 |
| 108 | Ga0307416_101244241 | 3300032002 | Unclassified | 850 |
| 109 | Ga0307414_10000040 | 3300032004 | Bacteria | 148876 |
| 110 | Ga0307414_10091526 | 3300032004 | Bacteria | 2261 |
| 111 | Ga0307411_10001491 | 3300032005 | Bacteria | 9616 |
| 112 | Ga0316593_10075667 | 3300032168 | Bacteria | 1169 |
| 113 | Ga0316593_10081628 | 3300032168 | Bacteria | 1129 |
| 114 | Ga0316593_10153990 | 3300032168 | Bacteria | 837 |
| 115 | Ga0316593_10197297 | 3300032168 | Bacteria | 743 |
| 116 | Ga0316593_10377207 | 3300032168 | Bacteria | 546 |
| 117 | Ga0316587_1108651 | 3300033529 | Bacteria | 537 |
| 118 | Ga0373941_0045106 | 3300035115 | Bacteria | 1379 |
| 119 | Ga0373931_0138619 | 3300035691 | Unclassified | 1407 |
| 120 | Ga0373927_0033073 | 3300035695 | Bacteria | 3367 |
| 121 | Ga0316582_0699977 | 3300036647 | Bacteria | 696 |
| 122 | Ga0316584_0093487 | 3300036712 | Bacteria | 2251 |
| 123 | Ga0316584_0323266 | 3300036712 | Unclassified | 1113 |
| 124 | Ga0395905_0000146 | 3300037471 | Bacteria | 116742 |
| 125 | Ga0400488_63292 | 3300038741 | Unclassified | 1429 |
| 126 | Ga0400483_006213 | 3300039062 | Bacteria | 91642 |
| 127 | Ga0451797_0820587 | 3300041453 | Bacteria | 558 |
| 128 | Ga0451795_0279524 | 3300041456 | Bacteria | 829 |
| 129 | Ga0451795_1264014 | 3300041456 | Bacteria | 1118 |
| 130 | Ga0451795_1552704 | 3300041456 | Bacteria | 1125 |
| 131 | Ga0451802_0749708 | 3300041460 | Bacteria | 936 |
| 132 | Ga0451802_0872764 | 3300041460 | Bacteria | 557 |
| 133 | Ga0451837_0459374 | 3300041494 | Bacteria | 692 |
| 134 | Ga0451837_0560668 | 3300041494 | Bacteria | 1805 |
| 135 | Ga0451837_0700923 | 3300041494 | Bacteria | 1312 |
| 136 | Ga0451837_1140678 | 3300041494 | Unclassified | 825 |
| 137 | Ga0451837_1409648 | 3300041494 | Bacteria | 2172 |
| 138 | Ga0451855_1994868 | 3300041511 | Unclassified | 1429 |
| 139 | Ga0450923_065663 | 3300042125 | Bacteria | 798 |
| 140 | Ga0450903_047809 | 3300042138 | Bacteria | 629 |
| 141 | Ga0451577_0038408 | 3300042876 | Bacteria | 4307 |
| 142 | Ga0451577_0041738 | 3300042876 | Bacteria | 4118 |
| 143 | Ga0451577_0053103 | 3300042876 | Bacteria | 3618 |
| 144 | Ga0451577_0081650 | 3300042876 | Bacteria | 2883 |
| 145 | Ga0451577_0094656 | 3300042876 | Bacteria | 2667 |
| 146 | Ga0451577_0127472 | 3300042876 | Bacteria | 2281 |
| 147 | Ga0451577_0216890 | 3300042876 | Bacteria | 1729 |
| 148 | Ga0451577_0434208 | 3300042876 | Bacteria | 1192 |
| 149 | Ga0451577_0711782 | 3300042876 | Bacteria | 909 |
| 150 | Ga0451577_0724052 | 3300042876 | Bacteria | 900 |
| 151 | Ga0451577_0784610 | 3300042876 | Bacteria | 861 |
| 152 | Ga0451577_0906030 | 3300042876 | Bacteria | 794 |
| 153 | Ga0451577_1819985 | 3300042876 | Bacteria | 534 |
| 154 | Ga0451577_1904285 | 3300042876 | Unclassified | 521 |
| 155 | Ga0466982_0179615 | 3300044672 | Bacteria | 1280 |
| 156 | Ga0453683_0000079 | 3300044673 | Bacteria | 145949 |
| 157 | Ga0453683_0000092 | 3300044673 | Bacteria | 136648 |
| 158 | Ga0453683_0003424 | 3300044673 | Bacteria | 11699 |
| 159 | Ga0453683_0036337 | 3300044673 | Unclassified | 3100 |
| 160 | Ga0453683_0037441 | 3300044673 | Bacteria | 3051 |
| 161 | Ga0453683_0048070 | 3300044673 | Bacteria | 2676 |
| 162 | Ga0453683_0094501 | 3300044673 | Bacteria | 1875 |
| 163 | Ga0453683_0215951 | 3300044673 | Bacteria | 1219 |
| 164 | Ga0453683_0244308 | 3300044673 | Bacteria | 1143 |
| 165 | Ga0453683_0254082 | 3300044673 | Bacteria | 1120 |
| 166 | Ga0453683_0328100 | 3300044673 | Unclassified | 981 |
| 167 | Ga0453683_0388918 | 3300044673 | Bacteria | 898 |
| 168 | Ga0453683_0707450 | 3300044673 | Bacteria | 660 |
| 169 | Ga0453684_0000337 | 3300044712 | Bacteria | 195296 |
| 170 | Ga0453684_0001331 | 3300044712 | Bacteria | 72658 |
| 171 | Ga0453684_0001471 | 3300044712 | Bacteria | 66489 |
| 172 | Ga0453684_0004621 | 3300044712 | Bacteria | 28641 |
| 173 | Ga0453684_0010620 | 3300044712 | Bacteria | 15692 |
| 174 | Ga0453684_0016021 | 3300044712 | Bacteria | 11771 |
| 175 | Ga0453684_0044420 | 3300044712 | Bacteria | 5946 |
| 176 | Ga0453684_0077219 | 3300044712 | Bacteria | 4177 |
| 177 | Ga0453684_0079912 | 3300044712 | Bacteria | 4086 |
| 178 | Ga0453684_0085528 | 3300044712 | Bacteria | 3918 |
| 179 | Ga0453684_0103694 | 3300044712 | Bacteria | 3474 |
| 180 | Ga0453684_0214543 | 3300044712 | Bacteria | 2234 |
| 181 | Ga0453684_0340931 | 3300044712 | Bacteria | 1692 |
| 182 | Ga0453684_0377951 | 3300044712 | Bacteria | 1591 |
| 183 | Ga0453684_0442817 | 3300044712 | Bacteria | 1447 |
| 184 | Ga0453684_0913650 | 3300044712 | Bacteria | 939 |
| 185 | Ga0453684_1116916 | 3300044712 | Bacteria | 832 |
| 186 | Ga0453684_1205492 | 3300044712 | Unclassified | 794 |
| 187 | Ga0453684_1250594 | 3300044712 | Bacteria | 777 |
| 188 | Ga0453684_1503747 | 3300044712 | Bacteria | 694 |
| 189 | Ga0453684_1987915 | 3300044712 | Unclassified | 586 |
| 190 | Ga0453684_2510884 | 3300044712 | Bacteria | 508 |
| 191 | Ga0451576_0000369 | 3300045051 | Bacteria | 107433 |
| 192 | Ga0451576_0000638 | 3300045051 | Bacteria | 72729 |
| 193 | Ga0451576_0001334 | 3300045051 | Bacteria | 42651 |
| 194 | Ga0451576_0018376 | 3300045051 | Bacteria | 7666 |
| 195 | Ga0451576_0023258 | 3300045051 | Bacteria | 6712 |
| 196 | Ga0451576_0059733 | 3300045051 | Unclassified | 3979 |
| 197 | Ga0451576_0069371 | 3300045051 | Bacteria | 3668 |
| 198 | Ga0451576_0074336 | 3300045051 | Bacteria | 3537 |
| 199 | Ga0451576_0822928 | 3300045051 | Bacteria | 975 |
| 200 | Ga0451576_2051728 | 3300045051 | Bacteria | 589 |
| 201 | Ga0495638_0000004 | 3300046460 | Bacteria | 700795 |
| 202 | Ga0495597_0112425 | 3300046542 | Bacteria | 1141 |
| 203 | Ga0495600_0796128 | 3300046809 | Bacteria | 563 |
| 204 | Ga0495660_0200540 | 3300046810 | Bacteria | 953 |
| 205 | Ga0496104_1263374 | 3300048907 | Bacteria | 641 |
| 206 | Ga0496115_0720176 | 3300048918 | Bacteria | 783 |
| 207 | Ga0501307_039988 | 3300049162 | Bacteria | 678 |
| 208 | Ga0501290_007517 | 3300049513 | Bacteria | 1367 |
| 209 | Ga0501298_016269 | 3300049521 | Bacteria | 1346 |
| 210 | Ga0501312_091306 | 3300049528 | Bacteria | 562 |
| 211 | Ga0501034_0371660 | 3300049571 | Unclassified | 1356 |
| 212 | Ga0501038_0378801 | 3300049574 | Bacteria | 1098 |
| 213 | Ga0501040_0412550 | 3300049576 | Bacteria | 970 |
| 214 | Ga0501043_0232225 | 3300049579 | Bacteria | 1425 |
| 215 | Ga0501222_006221 | 3300049662 | Bacteria | 1603 |
| 216 | Ga0501238_016900 | 3300049671 | Unclassified | 1014 |
| 217 | Ga0501257_000614 | 3300049686 | Bacteria | 7072 |
| 218 | Ga0501261_054965 | 3300049690 | Bacteria | 662 |
| 219 | Ga0501081_0408050 | 3300049743 | Bacteria | 1006 |
| 220 | Ga0501083_0001663 | 3300049744 | Bacteria | 15176 |
| 221 | Ga0501035_1304320 | 3300049822 | Bacteria | 560 |
| 222 | Ga0501044_0103663 | 3300049823 | Bacteria | 2859 |
| 223 | nmdc:mga09592_124845_c1 | 3300050508 | Bacteria | 2212 |
| 224 | nmdc:mga08y16_4116_c1 | 3300050511 | Bacteria | 15175 |
| 225 | nmdc:mga0n895_28015_c1 | 3300050512 | Bacteria | 5356 |
| 226 | nmdc:mga0n895_53324_c1 | 3300050512 | Bacteria | 3974 |
| 227 | nmdc:mga0rr50_278196_c1 | 3300050513 | Bacteria | 1396 |
| 228 | nmdc:mga0rr50_352907_c1 | 3300050513 | Bacteria | 1237 |
| 229 | nmdc:mga0a205_1199626_c1 | 3300050515 | Bacteria | 607 |
| 230 | Ga0495655_0081055 | 3300053083 | Bacteria | 928 |
| 231 | Ga0500556_0007168 | 3300053104 | Bacteria | 3186 |
| 232 | Ga0500557_020601 | 3300053105 | Bacteria | 1878 |
| 233 | Ga0500562_006209 | 3300053108 | Bacteria | 3015 |
| 234 | Ga0500655_003685 | 3300053133 | Bacteria | 2760 |
| 235 | Ga0500577_0056146 | 3300053142 | Bacteria | 1498 |
| 236 | Ga0500604_0002490 | 3300053151 | Bacteria | 5020 |
| 237 | Ga0500616_0000015 | 3300053153 | Bacteria | 633259 |
| 238 | Ga0500622_0000182 | 3300053156 | Bacteria | 67645 |
| 239 | Ga0500627_0137562 | 3300053158 | Bacteria | 1103 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048918 | Ga0496115_0720176 | Ga0496115_0720176_109_447 | 111 |
| 2 | iso_pu_bacteria | 2833640130 | 2833641411 | 111 |
| 3 | iso_pu_bacteria | 2738543023 | 2739304314 | 112 |
| 4 | 3300036712 | Ga0316584_0323266 | Ga0316584_0323266_663_1007 | 114 |
| 5 | 3300003320 | rootH2_10018562 | rootH2_100185625 | 115 |
| 6 | 3300003320 | rootH2_10096762 | rootH2_100967626 | 115 |
| 7 | 3300003322 | rootL2_10002231 | rootL2_1000223116 | 115 |
| 8 | 3300003322 | rootL2_10083076 | rootL2_100830762 | 115 |
| 9 | 3300003323 | rootH1_10022147 | rootH1_1002214729 | 115 |
| 10 | 3300003323 | rootH1_10027324 | rootH1_100273244 | 115 |
| 11 | 3300003323 | rootH1_10056248 | rootH1_100562482 | 115 |
| 12 | 3300003791 | Ga0055530_10057069 | Ga0055530_100570692 | 115 |
| 13 | 3300005262 | Ga0065165_1000814 | Ga0065165_100081410 | 115 |
| 14 | 3300005459 | Ga0068867_101625223 | Ga0068867_1016252231 | 115 |
| 15 | 3300005539 | Ga0068853_101713307 | Ga0068853_1017133071 | 115 |
| 16 | 3300005548 | Ga0070665_100091942 | Ga0070665_1000919422 | 115 |
| 17 | 3300005563 | Ga0068855_100583205 | Ga0068855_1005832052 | 115 |
| 18 | 3300005618 | Ga0068864_100210323 | Ga0068864_1002103232 | 115 |
| 19 | 3300005618 | Ga0068864_101404102 | Ga0068864_1014041022 | 115 |
| 20 | 3300006028 | Ga0070717_10321273 | Ga0070717_103212732 | 115 |
| 21 | 3300006195 | Ga0075366_10635824 | Ga0075366_106358242 | 115 |
| 22 | 3300006195 | Ga0075366_10760295 | Ga0075366_107602951 | 115 |
| 23 | 3300006237 | Ga0097621_100214645 | Ga0097621_1002146452 | 115 |
| 24 | 3300006358 | Ga0068871_101648709 | Ga0068871_1016487092 | 115 |
| 25 | 3300006844 | Ga0075428_100133493 | Ga0075428_1001334933 | 115 |
| 26 | 3300006847 | Ga0075431_100997723 | Ga0075431_1009977232 | 115 |
| 27 | 3300006880 | Ga0075429_100094315 | Ga0075429_1000943154 | 115 |
| 28 | 3300007788 | Ga0099795_10225569 | Ga0099795_102255692 | 115 |
| 29 | 3300009093 | Ga0105240_10260306 | Ga0105240_102603062 | 115 |
| 30 | 3300009094 | Ga0111539_10004460 | Ga0111539_100044608 | 115 |
| 31 | 3300009094 | Ga0111539_11143646 | Ga0111539_111436462 | 115 |
| 32 | 3300009545 | Ga0105237_11872801 | Ga0105237_118728012 | 115 |
| 33 | 3300009545 | Ga0105237_12317730 | Ga0105237_123177301 | 115 |
| 34 | 3300014326 | Ga0157380_10076517 | Ga0157380_100765173 | 115 |
| 35 | 3300014326 | Ga0157380_10233194 | Ga0157380_102331943 | 115 |
| 36 | 3300025298 | Ga0209050_1003753 | Ga0209050_10037532 | 115 |
| 37 | 3300025298 | Ga0209050_1005223 | Ga0209050_10052237 | 115 |
| 38 | 3300025304 | Ga0209257_1027405 | Ga0209257_10274052 | 115 |
| 39 | 3300025949 | Ga0207667_11511526 | Ga0207667_115115262 | 115 |
| 40 | 3300026088 | Ga0207641_10132691 | Ga0207641_101326913 | 115 |
| 41 | 3300026089 | Ga0207648_10765882 | Ga0207648_107658822 | 115 |
| 42 | 3300026095 | Ga0207676_10175489 | Ga0207676_101754893 | 115 |
| 43 | 3300027907 | Ga0207428_10015366 | Ga0207428_100153667 | 115 |
| 44 | 3300031235 | Ga0265330_10122316 | Ga0265330_101223161 | 115 |
| 45 | 3300031344 | Ga0265316_10207986 | Ga0265316_102079862 | 115 |
| 46 | 3300031456 | Ga0307513_10163964 | Ga0307513_101639641 | 115 |
| 47 | 3300031507 | Ga0307509_10246433 | Ga0307509_102464332 | 115 |
| 48 | 3300031507 | Ga0307509_10404496 | Ga0307509_104044962 | 115 |
| 49 | 3300031548 | Ga0307408_102024942 | Ga0307408_1020249422 | 115 |
| 50 | 3300031712 | Ga0265342_10186139 | Ga0265342_101861392 | 115 |
| 51 | 3300031727 | Ga0316576_10228591 | Ga0316576_102285912 | 115 |
| 52 | 3300031727 | Ga0316576_11057370 | Ga0316576_110573702 | 115 |
| 53 | 3300031727 | Ga0316576_11162274 | Ga0316576_111622741 | 115 |
| 54 | 3300031728 | Ga0316578_10041194 | Ga0316578_100411942 | 115 |
| 55 | 3300031730 | Ga0307516_10571028 | Ga0307516_105710281 | 115 |
| 56 | 3300031995 | Ga0307409_102162060 | Ga0307409_1021620602 | 115 |
| 57 | 3300032004 | Ga0307414_10000040 | Ga0307414_10000040101 | 115 |
| 58 | 3300032004 | Ga0307414_10091526 | Ga0307414_100915263 | 115 |
| 59 | 3300035691 | Ga0373931_0138619 | Ga0373931_0138619_378_725 | 115 |
| 60 | 3300035695 | Ga0373927_0033073 | Ga0373927_0033073_1674_2021 | 115 |
| 61 | 3300036712 | Ga0316584_0093487 | Ga0316584_0093487_1590_1940 | 115 |
| 62 | 3300039062 | Ga0400483_006213 | Ga0400483_006213_62875_63225 | 115 |
| 63 | 3300041456 | Ga0451795_0279524 | Ga0451795_0279524_113_460 | 115 |
| 64 | 3300041460 | Ga0451802_0872764 | Ga0451802_0872764_54_401 | 115 |
| 65 | 3300041494 | Ga0451837_0459374 | Ga0451837_0459374_182_529 | 115 |
| 66 | 3300041494 | Ga0451837_0700923 | Ga0451837_0700923_676_1023 | 115 |
| 67 | 3300041494 | Ga0451837_1409648 | Ga0451837_1409648_82_432 | 115 |
| 68 | 3300042125 | Ga0450923_065663 | Ga0450923_065663_399_746 | 115 |
| 69 | 3300042876 | Ga0451577_0038408 | Ga0451577_0038408_1070_1420 | 115 |
| 70 | 3300042876 | Ga0451577_0041738 | Ga0451577_0041738_2216_2566 | 115 |
| 71 | 3300042876 | Ga0451577_0053103 | Ga0451577_0053103_1119_1469 | 115 |
| 72 | 3300042876 | Ga0451577_0081650 | Ga0451577_0081650_1302_1652 | 115 |
| 73 | 3300042876 | Ga0451577_0094656 | Ga0451577_0094656_1203_1553 | 115 |
| 74 | 3300042876 | Ga0451577_0127472 | Ga0451577_0127472_1239_1589 | 115 |
| 75 | 3300042876 | Ga0451577_0216890 | Ga0451577_0216890_1104_1454 | 115 |
| 76 | 3300042876 | Ga0451577_0434208 | Ga0451577_0434208_736_1086 | 115 |
| 77 | 3300042876 | Ga0451577_0711782 | Ga0451577_0711782_189_539 | 115 |
| 78 | 3300042876 | Ga0451577_0724052 | Ga0451577_0724052_125_475 | 115 |
| 79 | 3300042876 | Ga0451577_0784610 | Ga0451577_0784610_20_370 | 115 |
| 80 | 3300042876 | Ga0451577_0906030 | Ga0451577_0906030_39_389 | 115 |
| 81 | 3300042876 | Ga0451577_1819985 | Ga0451577_1819985_72_419 | 115 |
| 82 | 3300042876 | Ga0451577_1904285 | Ga0451577_1904285_25_375 | 115 |
| 83 | 3300044672 | Ga0466982_0179615 | Ga0466982_0179615_647_994 | 115 |
| 84 | 3300044673 | Ga0453683_0000079 | Ga0453683_0000079_144727_145077 | 115 |
| 85 | 3300044673 | Ga0453683_0000092 | Ga0453683_0000092_33468_33818 | 115 |
| 86 | 3300044673 | Ga0453683_0003424 | Ga0453683_0003424_9635_9985 | 115 |
| 87 | 3300044673 | Ga0453683_0036337 | Ga0453683_0036337_2380_2730 | 115 |
| 88 | 3300044673 | Ga0453683_0037441 | Ga0453683_0037441_713_1063 | 115 |
| 89 | 3300044673 | Ga0453683_0048070 | Ga0453683_0048070_319_669 | 115 |
| 90 | 3300044673 | Ga0453683_0094501 | Ga0453683_0094501_1153_1509 | 115 |
| 91 | 3300044673 | Ga0453683_0215951 | Ga0453683_0215951_253_600 | 115 |
| 92 | 3300044673 | Ga0453683_0244308 | Ga0453683_0244308_380_730 | 115 |
| 93 | 3300044673 | Ga0453683_0254082 | Ga0453683_0254082_629_979 | 115 |
| 94 | 3300044673 | Ga0453683_0328100 | Ga0453683_0328100_112_462 | 115 |
| 95 | 3300044673 | Ga0453683_0388918 | Ga0453683_0388918_331_681 | 115 |
| 96 | 3300044673 | Ga0453683_0707450 | Ga0453683_0707450_119_469 | 115 |
| 97 | 3300044712 | Ga0453684_0000337 | Ga0453684_0000337_75205_75555 | 115 |
| 98 | 3300044712 | Ga0453684_0001331 | Ga0453684_0001331_5103_5453 | 115 |
| 99 | 3300044712 | Ga0453684_0001471 | Ga0453684_0001471_19550_19900 | 115 |
| 100 | 3300044712 | Ga0453684_0004621 | Ga0453684_0004621_16939_17286 | 115 |
| 101 | 3300044712 | Ga0453684_0010620 | Ga0453684_0010620_5476_5826 | 115 |
| 102 | 3300044712 | Ga0453684_0016021 | Ga0453684_0016021_7849_8199 | 115 |
| 103 | 3300044712 | Ga0453684_0044420 | Ga0453684_0044420_2077_2427 | 115 |
| 104 | 3300044712 | Ga0453684_0077219 | Ga0453684_0077219_2264_2614 | 115 |
| 105 | 3300044712 | Ga0453684_0079912 | Ga0453684_0079912_1535_1885 | 115 |
| 106 | 3300044712 | Ga0453684_0103694 | Ga0453684_0103694_1168_1518 | 115 |
| 107 | 3300044712 | Ga0453684_0214543 | Ga0453684_0214543_629_979 | 115 |
| 108 | 3300044712 | Ga0453684_0340931 | Ga0453684_0340931_155_502 | 115 |
| 109 | 3300044712 | Ga0453684_0377951 | Ga0453684_0377951_857_1207 | 115 |
| 110 | 3300044712 | Ga0453684_0442817 | Ga0453684_0442817_844_1194 | 115 |
| 111 | 3300044712 | Ga0453684_0913650 | Ga0453684_0913650_234_584 | 115 |
| 112 | 3300044712 | Ga0453684_1116916 | Ga0453684_1116916_30_380 | 115 |
| 113 | 3300044712 | Ga0453684_1205492 | Ga0453684_1205492_94_441 | 115 |
| 114 | 3300044712 | Ga0453684_1250594 | Ga0453684_1250594_161_511 | 115 |
| 115 | 3300044712 | Ga0453684_1503747 | Ga0453684_1503747_49_399 | 115 |
| 116 | 3300044712 | Ga0453684_1987915 | Ga0453684_1987915_190_540 | 115 |
| 117 | 3300045051 | Ga0451576_0000369 | Ga0451576_0000369_97347_97697 | 115 |
| 118 | 3300045051 | Ga0451576_0000638 | Ga0451576_0000638_67277_67627 | 115 |
| 119 | 3300045051 | Ga0451576_0001334 | Ga0451576_0001334_32530_32880 | 115 |
| 120 | 3300045051 | Ga0451576_0018376 | Ga0451576_0018376_4137_4487 | 115 |
| 121 | 3300045051 | Ga0451576_0023258 | Ga0451576_0023258_3176_3526 | 115 |
| 122 | 3300045051 | Ga0451576_0059733 | Ga0451576_0059733_2501_2851 | 115 |
| 123 | 3300045051 | Ga0451576_0069371 | Ga0451576_0069371_1212_1562 | 115 |
| 124 | 3300045051 | Ga0451576_0074336 | Ga0451576_0074336_292_639 | 115 |
| 125 | 3300045051 | Ga0451576_0822928 | Ga0451576_0822928_216_566 | 115 |
| 126 | 3300045051 | Ga0451576_2051728 | Ga0451576_2051728_14_361 | 115 |
| 127 | 3300046460 | Ga0495638_0000004 | Ga0495638_0000004_657901_658248 | 115 |
| 128 | 3300046542 | Ga0495597_0112425 | Ga0495597_0112425_239_586 | 115 |
| 129 | 3300046809 | Ga0495600_0796128 | Ga0495600_0796128_68_415 | 115 |
| 130 | 3300046810 | Ga0495660_0200540 | Ga0495660_0200540_179_526 | 115 |
| 131 | 3300049162 | Ga0501307_039988 | Ga0501307_039988_265_612 | 115 |
| 132 | 3300049513 | Ga0501290_007517 | Ga0501290_007517_198_545 | 115 |
| 133 | 3300049521 | Ga0501298_016269 | Ga0501298_016269_907_1254 | 115 |
| 134 | 3300049528 | Ga0501312_091306 | Ga0501312_091306_76_423 | 115 |
| 135 | 3300049576 | Ga0501040_0412550 | Ga0501040_0412550_365_715 | 115 |
| 136 | 3300049662 | Ga0501222_006221 | Ga0501222_006221_231_578 | 115 |
| 137 | 3300049671 | Ga0501238_016900 | Ga0501238_016900_558_905 | 115 |
| 138 | 3300049686 | Ga0501257_000614 | Ga0501257_000614_890_1237 | 115 |
| 139 | 3300049690 | Ga0501261_054965 | Ga0501261_054965_198_545 | 115 |
| 140 | 3300050508 | nmdc:mga09592_124845_c1 | nmdc:mga09592_124845_c1_225_572 | 115 |
| 141 | 3300050511 | nmdc:mga08y16_4116_c1 | nmdc:mga08y16_4116_c1_4416_4763 | 115 |
| 142 | 3300053104 | Ga0500556_0007168 | Ga0500556_0007168_904_1251 | 115 |
| 143 | 3300053105 | Ga0500557_020601 | Ga0500557_020601_244_591 | 115 |
| 144 | 3300053108 | Ga0500562_006209 | Ga0500562_006209_1428_1775 | 115 |
| 145 | 3300053133 | Ga0500655_003685 | Ga0500655_003685_2349_2696 | 115 |
| 146 | 3300053142 | Ga0500577_0056146 | Ga0500577_0056146_439_786 | 115 |
| 147 | 3300053151 | Ga0500604_0002490 | Ga0500604_0002490_2803_3150 | 115 |
| 148 | 3300053153 | Ga0500616_0000015 | Ga0500616_0000015_172588_172935 | 115 |
| 149 | 3300053156 | Ga0500622_0000182 | Ga0500622_0000182_38895_39242 | 115 |
| 150 | 3300053158 | Ga0500627_0137562 | Ga0500627_0137562_132_479 | 115 |
| 151 | 3300005353 | Ga0070669_100284597 | Ga0070669_1002845972 | 116 |
| 152 | 3300005563 | Ga0068855_101577475 | Ga0068855_1015774751 | 116 |
| 153 | 3300005564 | Ga0070664_101493379 | Ga0070664_1014933791 | 116 |
| 154 | 3300009553 | Ga0105249_10189880 | Ga0105249_101898802 | 116 |
| 155 | 3300013102 | Ga0157371_10108465 | Ga0157371_101084652 | 116 |
| 156 | 3300013104 | Ga0157370_10756853 | Ga0157370_107568532 | 116 |
| 157 | 3300014326 | Ga0157380_10115828 | Ga0157380_101158282 | 116 |
| 158 | 3300014497 | Ga0182008_10025547 | Ga0182008_100255474 | 116 |
| 159 | 3300025923 | Ga0207681_10540022 | Ga0207681_105400222 | 116 |
| 160 | 3300025945 | Ga0207679_11130573 | Ga0207679_111305732 | 116 |
| 161 | 3300025961 | Ga0207712_10224311 | Ga0207712_102243112 | 116 |
| 162 | 3300031251 | Ga0265327_10492194 | Ga0265327_104921942 | 116 |
| 163 | 3300031731 | Ga0307405_10498691 | Ga0307405_104986912 | 116 |
| 164 | 3300032005 | Ga0307411_10001491 | Ga0307411_100014916 | 116 |
| 165 | 3300032168 | Ga0316593_10075667 | Ga0316593_100756672 | 116 |
| 166 | 3300033529 | Ga0316587_1108651 | Ga0316587_11086512 | 116 |
| 167 | 3300041456 | Ga0451795_1264014 | Ga0451795_1264014_362_715 | 116 |
| 168 | 3300041456 | Ga0451795_1552704 | Ga0451795_1552704_166_519 | 116 |
| 169 | 3300044712 | Ga0453684_0085528 | Ga0453684_0085528_1641_1994 | 116 |
| 170 | 3300032002 | Ga0307416_101244241 | Ga0307416_1012442412 | 117 |
| 171 | 3300050513 | nmdc:mga0rr50_352907_c1 | nmdc:mga0rr50_352907_c1_860_1213 | 117 |
| 172 | 3300044712 | Ga0453684_2510884 | Ga0453684_2510884_74_436 | 118 |
| 173 | 3300013297 | Ga0157378_10623094 | Ga0157378_106230942 | 119 |
| 174 | 3300032168 | Ga0316593_10081628 | Ga0316593_100816282 | 120 |
| 175 | 3300032168 | Ga0316593_10153990 | Ga0316593_101539901 | 120 |
| 176 | 3300032168 | Ga0316593_10197297 | Ga0316593_101972972 | 120 |
| 177 | 3300032168 | Ga0316593_10377207 | Ga0316593_103772072 | 120 |
| 178 | 3300036647 | Ga0316582_0699977 | Ga0316582_0699977_179_544 | 120 |
| 179 | 3300037471 | Ga0395905_0000146 | Ga0395905_0000146_110671_111036 | 120 |
| 180 | 3300038741 | Ga0400488_63292 | Ga0400488_63292_726_1091 | 120 |
| 181 | 3300049571 | Ga0501034_0371660 | Ga0501034_0371660_607_1053 | 121 |
| 182 | 3300042138 | Ga0450903_047809 | Ga0450903_047809_30_401 | 122 |
| 183 | iso_pu_bacteria | 2916971899 | 2916974302 | 122 |
| 184 | 3300005336 | Ga0070680_101086874 | Ga0070680_1010868742 | 125 |
| 185 | 3300005343 | Ga0070687_100154326 | Ga0070687_1001543262 | 125 |
| 186 | 3300005364 | Ga0070673_100331639 | Ga0070673_1003316392 | 125 |
| 187 | 3300009094 | Ga0111539_10555679 | Ga0111539_105556791 | 125 |
| 188 | 3300025917 | Ga0207660_10860434 | Ga0207660_108604342 | 125 |
| 189 | 3300025918 | Ga0207662_10362736 | Ga0207662_103627362 | 125 |
| 190 | 3300049822 | Ga0501035_1304320 | Ga0501035_1304320_88_465 | 125 |
| 191 | 3300041511 | Ga0451855_1994868 | Ga0451855_1994868_41_451 | 126 |
| 192 | 3300041460 | Ga0451802_0749708 | Ga0451802_0749708_467_892 | 127 |
| 193 | 3300041494 | Ga0451837_1140678 | Ga0451837_1140678_183_608 | 127 |
| 194 | 3300005471 | Ga0070698_100205227 | Ga0070698_1002052273 | 128 |
| 195 | 3300041494 | Ga0451837_0560668 | Ga0451837_0560668_814_1206 | 128 |
| 196 | 3300049574 | Ga0501038_0378801 | Ga0501038_0378801_678_1070 | 128 |
| 197 | 3300049579 | Ga0501043_0232225 | Ga0501043_0232225_537_929 | 128 |
| 198 | 3300049823 | Ga0501044_0103663 | Ga0501044_0103663_1096_1488 | 128 |
| 199 | 3300003316 | rootH1_10144175 | rootH1_101441753 | 131 |
| 200 | 3300005295 | Ga0065707_10601730 | Ga0065707_106017302 | 131 |
| 201 | 3300005327 | Ga0070658_10005569 | Ga0070658_100055696 | 131 |
| 202 | 3300005330 | Ga0070690_100934715 | Ga0070690_1009347151 | 131 |
| 203 | 3300005335 | Ga0070666_10021703 | Ga0070666_100217033 | 131 |
| 204 | 3300005337 | Ga0070682_100757347 | Ga0070682_1007573471 | 131 |
| 205 | 3300005340 | Ga0070689_100838533 | Ga0070689_1008385332 | 131 |
| 206 | 3300005347 | Ga0070668_100454376 | Ga0070668_1004543762 | 131 |
| 207 | 3300005353 | Ga0070669_100000028 | Ga0070669_10000002891 | 131 |
| 208 | 3300005365 | Ga0070688_100388523 | Ga0070688_1003885232 | 131 |
| 209 | 3300005466 | Ga0070685_10001867 | Ga0070685_100018676 | 131 |
| 210 | 3300005547 | Ga0070693_100419332 | Ga0070693_1004193322 | 131 |
| 211 | 3300005548 | Ga0070665_100000122 | Ga0070665_100000122120 | 131 |
| 212 | 3300005578 | Ga0068854_100493429 | Ga0068854_1004934292 | 131 |
| 213 | 3300005719 | Ga0068861_102163773 | Ga0068861_1021637731 | 131 |
| 214 | 3300005843 | Ga0068860_100470817 | Ga0068860_1004708172 | 131 |
| 215 | 3300006173 | Ga0070716_100395546 | Ga0070716_1003955462 | 131 |
| 216 | 3300006852 | Ga0075433_10287428 | Ga0075433_102874282 | 131 |
| 217 | 3300006871 | Ga0075434_100005640 | Ga0075434_1000056407 | 131 |
| 218 | 3300006871 | Ga0075434_100239059 | Ga0075434_1002390593 | 131 |
| 219 | 3300006871 | Ga0075434_100239971 | Ga0075434_1002399713 | 131 |
| 220 | 3300013308 | Ga0157375_10504034 | Ga0157375_105040343 | 131 |
| 221 | 3300025903 | Ga0207680_10089395 | Ga0207680_100893952 | 131 |
| 222 | 3300025907 | Ga0207645_10019242 | Ga0207645_100192423 | 131 |
| 223 | 3300025909 | Ga0207705_10031012 | Ga0207705_100310122 | 131 |
| 224 | 3300025923 | Ga0207681_10000006 | Ga0207681_10000006405 | 131 |
| 225 | 3300025936 | Ga0207670_10541876 | Ga0207670_105418762 | 131 |
| 226 | 3300025939 | Ga0207665_10419010 | Ga0207665_104190102 | 131 |
| 227 | 3300025972 | Ga0207668_10192649 | Ga0207668_101926491 | 131 |
| 228 | 3300025981 | Ga0207640_10440022 | Ga0207640_104400222 | 131 |
| 229 | 3300026078 | Ga0207702_12002450 | Ga0207702_120024502 | 131 |
| 230 | 3300026118 | Ga0207675_102653935 | Ga0207675_1026539352 | 131 |
| 231 | 3300028379 | Ga0268266_10001137 | Ga0268266_1000113721 | 131 |
| 232 | 3300028577 | Ga0265318_10236874 | Ga0265318_102368742 | 131 |
| 233 | 3300035115 | Ga0373941_0045106 | Ga0373941_0045106_340_741 | 131 |
| 234 | 3300041453 | Ga0451797_0820587 | Ga0451797_0820587_45_455 | 131 |
| 235 | 3300048907 | Ga0496104_1263374 | Ga0496104_1263374_229_624 | 131 |
| 236 | 3300049743 | Ga0501081_0408050 | Ga0501081_0408050_188_586 | 131 |
| 237 | 3300049744 | Ga0501083_0001663 | Ga0501083_0001663_5631_6044 | 131 |
| 238 | 3300050512 | nmdc:mga0n895_28015_c1 | nmdc:mga0n895_28015_c1_138_533 | 131 |
| 239 | 3300050512 | nmdc:mga0n895_53324_c1 | nmdc:mga0n895_53324_c1_1829_2227 | 131 |
| 240 | 3300050513 | nmdc:mga0rr50_278196_c1 | nmdc:mga0rr50_278196_c1_569_967 | 131 |
| 241 | 3300050515 | nmdc:mga0a205_1199626_c1 | nmdc:mga0a205_1199626_c1_164_562 | 131 |
| 242 | 3300053083 | Ga0495655_0081055 | Ga0495655_0081055_412_807 | 131 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6oz8-assembly1.cif.gz_D | crystal structure of mtb aspartate decarboxylase in active form | 0.9888 | 27 | 116 |
| 1pt1-assembly1.cif.gz_A | unprocessed pyruvoyl dependent aspartate decarboxylase with histidine 11 mutated to alanine | 0.9876 | 1 | 114 |
| 1pqf-assembly1.cif.gz_B-2 | glycine 24 to serine mutation of aspartate decarboxylase | 0.9869 | 1 | 114 |
| 1pyq-assembly1.cif.gz_A | unprocessed aspartate decarboxylase mutant, with alanine inserted at position 24 | 0.9866 | 1 | 114 |
| 2c45-assembly1.cif.gz_C | native precursor of pyruvoyl dependent aspartate decarboxylase | 0.9843 | 1 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4aonE00 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.9859 | 26 | 114 | 2.40.40.20 |
| 2c45C00 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.9843 | 1 | 113 | 2.40.40.20 |
| 2eeoB00 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.9789 | 27 | 120 | 2.40.40.20 |
| 1pqhA00 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.9721 | 1 | 114 | 2.40.40.20 |
| 3plxB00 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.9719 | 27 | 121 | 2.40.40.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A124FIJ7-F1-model_v4 | Aspartate 1-decarboxylase (EC 4.1.1.11) | 1.004 | 5 | 91 |
GO:0004068
GO:0005829 GO:0006523 GO:0015940 |
| AF-A0A3D6DN83-F1-model_v4 | Aspartate 1-decarboxylase (EC 4.1.1.11) | 1.003 | 1 | 89 |
GO:0004068
GO:0005829 GO:0006523 GO:0015940 |
| AF-A0A535F1Z3-F1-model_v4 | Aspartate 1-decarboxylase (EC 4.1.1.11) (Aspartate alpha-decarboxylase) [Cleaved into: Aspartate 1-decarboxylase beta chain; Aspartate 1-decarboxylase alpha chain] | 1.002 | 1 | 130 |
GO:0004068
GO:0005829 GO:0006523 GO:0015940 |
| AF-A0A4Q4CZT1-F1-model_v4 | Aspartate 1-decarboxylase (EC 4.1.1.11) | 1.002 | 1 | 95 |
GO:0004068
GO:0005829 GO:0006523 GO:0015940 |
| AF-A0A150RXD4-F1-model_v4 | Aspartate 1-decarboxylase (EC 4.1.1.11) | 1.001 | 1 | 99 |
GO:0004068
GO:0005829 GO:0006523 GO:0015940 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar