F348981
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 236 | 166 | 236 | 284 |
Family's Representative Sequence
| Representative Sequence | 3300006847|Ga0075431_100134922|Ga0075431_1001349222 |
| Length | 341 |
| Sequence | MTPTLRSNDINASTTKTFGQFVNSTVLSIAGAWGQRPAAKAAPVTVPHIRLQPSKGWVSLKLDELWAYRELLYFLTWREVKVRYKQTVMGASWAIIQPFFTMVVFSLFFGKLARIPSDGIPYPIFSFAALVPWTFFANGISNSGMSLVASHNLIKKVYFPRLVIPISSVTSGLIDFALAFVVLMGMMVYFAFLAPLHNVWTPSIVASAFAHQTVQVAFTANLLFVIPLLGLAFITALGVGLWLSAMNVQFRDVRYIIPFLVQFWMFATPIAYPSTLLPEPWRTLYGLNPMAGVIEGFRWALLGTNTAPGPMIWVSAVMAVLLLISGAFYFRRMEKSFADVV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 73 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 75 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 103 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 107 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 109 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 110 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 111 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 112 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 113 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 114 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 115 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 116 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 117 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 118 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 119 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 120 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 122 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 123 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 124 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 125 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 126 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 127 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 128 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 129 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 131 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 132 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 135 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 136 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 137 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 138 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 146 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 147 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 148 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 149 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 152 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 153 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 154 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 155 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 156 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 157 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 166 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.19 |
| Metatranscriptomes | 3.81 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.81 |
| Rhizosphere | 93.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1000010 | 3300002074 | Bacteria | 166979 |
| 2 | JGI24034J26672_10000001 | 3300002239 | Bacteria | 1118280 |
| 3 | rootH2_10037264 | 3300003320 | Bacteria | 8992 |
| 4 | rootH1_10056873 | 3300003323 | Bacteria | 4496 |
| 5 | rootH1_10058041 | 3300003323 | Bacteria | 6277 |
| 6 | Ga0058861_10063590 | 3300004800 | Bacteria | 3515 |
| 7 | Ga0058862_10285242 | 3300004803 | Bacteria | 1362 |
| 8 | Ga0065707_10016330 | 3300005295 | Bacteria | 2627 |
| 9 | Ga0070658_10142981 | 3300005327 | Bacteria | 1999 |
| 10 | Ga0070676_10197171 | 3300005328 | Bacteria | 1318 |
| 11 | Ga0070683_100000959 | 3300005329 | Bacteria | 21436 |
| 12 | Ga0070683_100003769 | 3300005329 | Bacteria | 12376 |
| 13 | Ga0070683_100252063 | 3300005329 | Unclassified | 1679 |
| 14 | Ga0070690_100000647 | 3300005330 | Bacteria | 17732 |
| 15 | Ga0070690_100005715 | 3300005330 | Bacteria | 7006 |
| 16 | Ga0070680_100174992 | 3300005336 | Bacteria | 1807 |
| 17 | Ga0068868_100023856 | 3300005338 | Bacteria | 4634 |
| 18 | Ga0070687_100006350 | 3300005343 | Bacteria | 4840 |
| 19 | Ga0070669_100008059 | 3300005353 | Bacteria | 7523 |
| 20 | Ga0070669_100096007 | 3300005353 | Bacteria | 2230 |
| 21 | Ga0070669_100424730 | 3300005353 | Bacteria | 1091 |
| 22 | Ga0070674_100328795 | 3300005356 | Bacteria | 1228 |
| 23 | Ga0070673_100477874 | 3300005364 | Unclassified | 1124 |
| 24 | Ga0070713_100216502 | 3300005436 | Bacteria | 1736 |
| 25 | Ga0070710_10176361 | 3300005437 | Bacteria | 1335 |
| 26 | Ga0070701_10084467 | 3300005438 | Bacteria | 1726 |
| 27 | Ga0070700_100223116 | 3300005441 | Unclassified | 1336 |
| 28 | Ga0070694_100099830 | 3300005444 | Bacteria | 2052 |
| 29 | Ga0070694_100242029 | 3300005444 | Bacteria | 1361 |
| 30 | Ga0070708_100045904 | 3300005445 | Bacteria | 3852 |
| 31 | Ga0070662_100201553 | 3300005457 | Bacteria | 1579 |
| 32 | Ga0070681_10000921 | 3300005458 | Bacteria | 24871 |
| 33 | Ga0070681_10006011 | 3300005458 | Bacteria | 11761 |
| 34 | Ga0070681_10008633 | 3300005458 | Bacteria | 9988 |
| 35 | Ga0068867_100043178 | 3300005459 | Bacteria | 3300 |
| 36 | Ga0068867_100225015 | 3300005459 | Bacteria | 1514 |
| 37 | Ga0070706_100100933 | 3300005467 | Bacteria | 2682 |
| 38 | Ga0070698_100001023 | 3300005471 | Bacteria | 30748 |
| 39 | Ga0070698_100097561 | 3300005471 | Viruses | 2915 |
| 40 | Ga0070699_100026037 | 3300005518 | Bacteria | 5045 |
| 41 | Ga0070679_100010227 | 3300005530 | Bacteria | 8895 |
| 42 | Ga0070697_100016858 | 3300005536 | Bacteria | 5744 |
| 43 | Ga0070686_100109017 | 3300005544 | Bacteria | 1883 |
| 44 | Ga0070695_100134226 | 3300005545 | Unclassified | 1709 |
| 45 | Ga0070695_100208570 | 3300005545 | Bacteria | 1401 |
| 46 | Ga0070693_100000653 | 3300005547 | Bacteria | 15287 |
| 47 | Ga0070665_100000519 | 3300005548 | Bacteria | 54796 |
| 48 | Ga0070665_100001000 | 3300005548 | Bacteria | 35859 |
| 49 | Ga0070704_100008857 | 3300005549 | Bacteria | 6058 |
| 50 | Ga0070704_100058364 | 3300005549 | Bacteria | 2749 |
| 51 | Ga0068855_100000901 | 3300005563 | Bacteria | 36814 |
| 52 | Ga0070664_100043199 | 3300005564 | Bacteria | 3802 |
| 53 | Ga0068854_100218298 | 3300005578 | Bacteria | 1507 |
| 54 | Ga0068859_100030094 | 3300005617 | Bacteria | 5447 |
| 55 | Ga0068861_100460573 | 3300005719 | Bacteria | 1141 |
| 56 | Ga0068863_100503402 | 3300005841 | Bacteria | 1193 |
| 57 | Ga0068858_100000005 | 3300005842 | Bacteria | 305830 |
| 58 | Ga0068858_100182414 | 3300005842 | Bacteria | 1982 |
| 59 | Ga0068860_100003871 | 3300005843 | Bacteria | 15378 |
| 60 | Ga0068860_100064939 | 3300005843 | Bacteria | 3466 |
| 61 | Ga0068862_100065608 | 3300005844 | Bacteria | 3127 |
| 62 | Ga0070717_10167996 | 3300006028 | Bacteria | 1906 |
| 63 | Ga0070716_100000001 | 3300006173 | Bacteria | 400668 |
| 64 | Ga0097621_100042436 | 3300006237 | Bacteria | 3664 |
| 65 | Ga0075430_100001319 | 3300006846 | Bacteria | 20034 |
| 66 | Ga0075431_100134922 | 3300006847 | Unclassified | 2544 |
| 67 | Ga0075433_10036558 | 3300006852 | Bacteria | 4231 |
| 68 | Ga0075434_100052418 | 3300006871 | Bacteria | 4054 |
| 69 | Ga0075429_100001229 | 3300006880 | Bacteria | 20798 |
| 70 | Ga0068865_100096921 | 3300006881 | Bacteria | 2152 |
| 71 | Ga0097620_100030095 | 3300006931 | Bacteria | 5447 |
| 72 | Ga0111539_10051412 | 3300009094 | Bacteria | 4908 |
| 73 | Ga0111539_10139303 | 3300009094 | Viruses | 2841 |
| 74 | Ga0111539_10519528 | 3300009094 | Bacteria | 1387 |
| 75 | Ga0105247_10000002 | 3300009101 | Bacteria | 724587 |
| 76 | Ga0114129_10017837 | 3300009147 | Bacteria | 10107 |
| 77 | Ga0114129_10060682 | 3300009147 | Bacteria | 5287 |
| 78 | Ga0114129_10063637 | 3300009147 | Bacteria | 5150 |
| 79 | Ga0114129_10131736 | 3300009147 | Bacteria | 3433 |
| 80 | Ga0114129_10165369 | 3300009147 | Bacteria | 3020 |
| 81 | Ga0114129_10179175 | 3300009147 | Bacteria | 2885 |
| 82 | Ga0114129_10705279 | 3300009147 | Bacteria | 1296 |
| 83 | Ga0105241_10005587 | 3300009174 | Bacteria | 9284 |
| 84 | Ga0105242_10127797 | 3300009176 | Bacteria | 2190 |
| 85 | Ga0105242_10271131 | 3300009176 | Bacteria | 1537 |
| 86 | Ga0105237_10050784 | 3300009545 | Bacteria | 4167 |
| 87 | Ga0105249_10003166 | 3300009553 | Bacteria | 14235 |
| 88 | Ga0105249_10101822 | 3300009553 | Bacteria | 2702 |
| 89 | Ga0157373_10387943 | 3300013100 | Bacteria | 1000 |
| 90 | Ga0157374_10482449 | 3300013296 | Bacteria | 1243 |
| 91 | Ga0157378_10012062 | 3300013297 | Bacteria | 7566 |
| 92 | Ga0157378_10041581 | 3300013297 | Unclassified | 4078 |
| 93 | Ga0157378_10276066 | 3300013297 | Bacteria | 1618 |
| 94 | Ga0157375_10013687 | 3300013308 | Bacteria | 7232 |
| 95 | Ga0157375_10042970 | 3300013308 | Unclassified | 4379 |
| 96 | Ga0157380_10000240 | 3300014326 | Bacteria | 32944 |
| 97 | Ga0157380_10003433 | 3300014326 | Bacteria | 10881 |
| 98 | Ga0163161_10219235 | 3300017792 | Unclassified | 1472 |
| 99 | Ga0197907_10615817 | 3300020069 | Bacteria | 3626 |
| 100 | Ga0197907_10652581 | 3300020069 | Bacteria | 3728 |
| 101 | Ga0206356_10518523 | 3300020070 | Unclassified | 2103 |
| 102 | Ga0206349_1028721 | 3300020075 | Bacteria | 3327 |
| 103 | Ga0206355_1434889 | 3300020076 | Bacteria | 1071 |
| 104 | Ga0206350_10874752 | 3300020080 | Bacteria | 2734 |
| 105 | Ga0213876_10175197 | 3300021384 | Unclassified | 1141 |
| 106 | Ga0224712_10008724 | 3300022467 | Bacteria | 3021 |
| 107 | Ga0207672_1000034 | 3300025223 | Bacteria | 17673 |
| 108 | Ga0207710_10000002 | 3300025900 | Bacteria | 1251998 |
| 109 | Ga0207647_10145080 | 3300025904 | Bacteria | 1390 |
| 110 | Ga0207705_10195349 | 3300025909 | Bacteria | 1532 |
| 111 | Ga0207684_10046390 | 3300025910 | Bacteria | 3686 |
| 112 | Ga0207684_10135352 | 3300025910 | Bacteria | 2116 |
| 113 | Ga0207654_10008256 | 3300025911 | Bacteria | 5256 |
| 114 | Ga0207707_10003635 | 3300025912 | Bacteria | 13674 |
| 115 | Ga0207707_10018407 | 3300025912 | Bacteria | 6090 |
| 116 | Ga0207693_10276101 | 3300025915 | Unclassified | 1317 |
| 117 | Ga0207660_10025964 | 3300025917 | Bacteria | 3984 |
| 118 | Ga0207662_10012671 | 3300025918 | Bacteria | 4699 |
| 119 | Ga0207662_10049259 | 3300025918 | Bacteria | 2499 |
| 120 | Ga0207646_10386878 | 3300025922 | Bacteria | 1263 |
| 121 | Ga0207681_10021127 | 3300025923 | Unclassified | 4133 |
| 122 | Ga0207681_10178906 | 3300025923 | Bacteria | 1614 |
| 123 | Ga0207659_10400313 | 3300025926 | Bacteria | 1148 |
| 124 | Ga0207700_10231007 | 3300025928 | Bacteria | 1573 |
| 125 | Ga0207644_10000210 | 3300025931 | Bacteria | 40409 |
| 126 | Ga0207706_10117654 | 3300025933 | Bacteria | 2337 |
| 127 | Ga0207706_10271973 | 3300025933 | Bacteria | 1478 |
| 128 | Ga0207706_10430382 | 3300025933 | Bacteria | 1143 |
| 129 | Ga0207665_10000002 | 3300025939 | Bacteria | 267895 |
| 130 | Ga0207661_10024292 | 3300025944 | Bacteria | 4591 |
| 131 | Ga0207661_10347785 | 3300025944 | Unclassified | 1337 |
| 132 | Ga0207667_10000979 | 3300025949 | Bacteria | 36475 |
| 133 | Ga0207712_10013243 | 3300025961 | Bacteria | 5286 |
| 134 | Ga0207712_10068354 | 3300025961 | Bacteria | 2545 |
| 135 | Ga0207640_10138388 | 3300025981 | Bacteria | 1771 |
| 136 | Ga0207703_10000914 | 3300026035 | Bacteria | 28751 |
| 137 | Ga0207703_10149201 | 3300026035 | Bacteria | 2037 |
| 138 | Ga0207708_10011552 | 3300026075 | Bacteria | 6579 |
| 139 | Ga0207708_10054970 | 3300026075 | Bacteria | 3035 |
| 140 | Ga0207708_10066624 | 3300026075 | Bacteria | 2753 |
| 141 | Ga0207648_10058950 | 3300026089 | Bacteria | 3348 |
| 142 | Ga0207675_100011350 | 3300026118 | Bacteria | 8337 |
| 143 | Ga0207675_100096163 | 3300026118 | Bacteria | 2788 |
| 144 | Ga0209974_10006245 | 3300027876 | Unclassified | 4167 |
| 145 | Ga0207428_10297030 | 3300027907 | Bacteria | 1196 |
| 146 | Ga0268266_10000192 | 3300028379 | Bacteria | 107069 |
| 147 | Ga0268266_10001536 | 3300028379 | Bacteria | 27006 |
| 148 | Ga0268265_10100863 | 3300028380 | Bacteria | 2331 |
| 149 | Ga0268264_10076026 | 3300028381 | Bacteria | 2856 |
| 150 | Ga0268264_10109272 | 3300028381 | Bacteria | 2419 |
| 151 | Ga0265323_10036101 | 3300028653 | Bacteria | 1819 |
| 152 | Ga0265323_10042405 | 3300028653 | Bacteria | 1648 |
| 153 | Ga0265338_10009056 | 3300028800 | Bacteria | 11975 |
| 154 | Ga0307408_100026128 | 3300031548 | Unclassified | 4005 |
| 155 | Ga0307408_100380158 | 3300031548 | Bacteria | 1207 |
| 156 | Ga0307516_10045726 | 3300031730 | Bacteria | 4322 |
| 157 | Ga0307413_10032028 | 3300031824 | Bacteria | 2974 |
| 158 | Ga0307413_10048097 | 3300031824 | Bacteria | 2547 |
| 159 | Ga0307413_10209577 | 3300031824 | Bacteria | 1414 |
| 160 | Ga0307410_10004626 | 3300031852 | Bacteria | 7145 |
| 161 | Ga0307410_10023779 | 3300031852 | Bacteria | 3817 |
| 162 | Ga0307406_10051851 | 3300031901 | Bacteria | 2607 |
| 163 | Ga0307407_10007843 | 3300031903 | Bacteria | 4861 |
| 164 | Ga0307407_10037938 | 3300031903 | Bacteria | 2666 |
| 165 | Ga0307409_100001857 | 3300031995 | Bacteria | 10746 |
| 166 | Ga0307409_100017640 | 3300031995 | Bacteria | 4766 |
| 167 | Ga0307409_100114729 | 3300031995 | Bacteria | 2267 |
| 168 | Ga0307409_100347158 | 3300031995 | Bacteria | 1399 |
| 169 | Ga0307416_100021588 | 3300032002 | Unclassified | 4626 |
| 170 | Ga0307416_100028246 | 3300032002 | Bacteria | 4168 |
| 171 | Ga0307416_100079773 | 3300032002 | Bacteria | 2760 |
| 172 | Ga0307411_10057847 | 3300032005 | Unclassified | 2563 |
| 173 | Ga0307411_10113335 | 3300032005 | Bacteria | 1946 |
| 174 | Ga0307415_100002924 | 3300032126 | Bacteria | 8567 |
| 175 | Ga0307415_100015978 | 3300032126 | Bacteria | 4459 |
| 176 | Ga0373929_0000004 | 3300035085 | Bacteria | 462745 |
| 177 | Ga0316574_0090407 | 3300035398 | Bacteria | 1951 |
| 178 | Ga0373937_0104829 | 3300036401 | Bacteria | 2627 |
| 179 | Ga0395905_0433647 | 3300037471 | Bacteria | 1211 |
| 180 | Ga0395901_0044946 | 3300038443 | Bacteria | 4582 |
| 181 | Ga0395901_0215847 | 3300038443 | Bacteria | 2007 |
| 182 | Ga0436365_1590701 | 3300039437 | Bacteria | 12204 |
| 183 | Ga0466972_0007110 | 3300044658 | Bacteria | 5620 |
| 184 | Ga0466965_0058179 | 3300044683 | Bacteria | 1927 |
| 185 | Ga0453684_0002236 | 3300044712 | Bacteria | 48011 |
| 186 | Ga0453684_0158120 | 3300044712 | Bacteria | 2684 |
| 187 | Ga0466968_0000289 | 3300044735 | Bacteria | 16020 |
| 188 | Ga0466960_0038838 | 3300044901 | Bacteria | 2241 |
| 189 | Ga0495586_0072765 | 3300046535 | Bacteria | 1880 |
| 190 | Ga0496104_0264051 | 3300048907 | Bacteria | 1634 |
| 191 | Ga0496106_0101309 | 3300048909 | Bacteria | 2234 |
| 192 | Ga0496108_0441042 | 3300048911 | Bacteria | 1137 |
| 193 | Ga0496109_0415283 | 3300048912 | Bacteria | 1271 |
| 194 | Ga0496111_0065478 | 3300048914 | Bacteria | 2638 |
| 195 | Ga0496111_0202440 | 3300048914 | Bacteria | 1476 |
| 196 | Ga0496112_0036859 | 3300048915 | Bacteria | 4771 |
| 197 | Ga0496112_0211753 | 3300048915 | Bacteria | 1895 |
| 198 | Ga0496114_0215235 | 3300048917 | Bacteria | 1686 |
| 199 | Ga0501292_001586 | 3300049515 | Bacteria | 2818 |
| 200 | Ga0501036_0130612 | 3300049572 | Bacteria | 2121 |
| 201 | Ga0501041_0068744 | 3300049577 | Bacteria | 2172 |
| 202 | Ga0501046_0138447 | 3300049580 | Bacteria | 1843 |
| 203 | Ga0501067_0084414 | 3300049583 | Bacteria | 1761 |
| 204 | Ga0501069_0017958 | 3300049585 | Bacteria | 3815 |
| 205 | Ga0501072_0521011 | 3300049588 | Bacteria | 940 |
| 206 | Ga0501076_0039926 | 3300049592 | Bacteria | 3686 |
| 207 | Ga0501230_010356 | 3300049667 | Bacteria | 1454 |
| 208 | Ga0501235_004475 | 3300049669 | Bacteria | 3021 |
| 209 | Ga0501247_007765 | 3300049677 | Bacteria | 1239 |
| 210 | Ga0501249_011817 | 3300049679 | Bacteria | 1838 |
| 211 | Ga0501079_0164646 | 3300049741 | Bacteria | 1729 |
| 212 | Ga0501081_0067803 | 3300049743 | Bacteria | 2483 |
| 213 | Ga0501262_001811 | 3300049759 | Bacteria | 2399 |
| 214 | Ga0501263_000114 | 3300049760 | Bacteria | 4368 |
| 215 | Ga0501268_002321 | 3300049765 | Bacteria | 2496 |
| 216 | Ga0501268_034472 | 3300049765 | Bacteria | 930 |
| 217 | Ga0501273_000190 | 3300049770 | Bacteria | 4405 |
| 218 | Ga0501274_001995 | 3300049771 | Bacteria | 1581 |
| 219 | Ga0501283_001814 | 3300049779 | Bacteria | 2764 |
| 220 | Ga0501283_015037 | 3300049779 | Bacteria | 1188 |
| 221 | Ga0501035_0366998 | 3300049822 | Unclassified | 1202 |
| 222 | Ga0501045_0009821 | 3300049824 | Bacteria | 6697 |
| 223 | nmdc:mga05p37_159381_c1 | 3300050507 | Bacteria | 2756 |
| 224 | nmdc:mga05p37_45949_c1 | 3300050507 | Bacteria | 5370 |
| 225 | nmdc:mga05p37_58031_c1 | 3300050507 | Bacteria | 4767 |
| 226 | nmdc:mga05p37_96146_c1 | 3300050507 | Bacteria | 3649 |
| 227 | nmdc:mga09592_1577_c1 | 3300050508 | Bacteria | 18351 |
| 228 | nmdc:mga0qj67_1767_c1 | 3300050509 | Bacteria | 15297 |
| 229 | nmdc:mga08y16_31458_c1 | 3300050511 | Bacteria | 5581 |
| 230 | nmdc:mga08y16_322996_c1 | 3300050511 | Bacteria | 1589 |
| 231 | nmdc:mga0a205_12681_c2 | 3300050515 | Bacteria | 4232 |
| 232 | nmdc:mga0a205_8444_c1 | 3300050515 | Bacteria | 9372 |
| 233 | Ga0501084_0019208 | 3300054114 | Bacteria | 5692 |
| 234 | Ga0466962_0053805 | 3300061719 | Bacteria | 1923 |
| 235 | Ga0530510_0014947 | 3300061734 | Bacteria | 5481 |
| 236 | Ga0530510_0226078 | 3300061734 | Bacteria | 1392 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049577 | Ga0501041_0068744 | Ga0501041_0068744_45_761 | 226 |
| 2 | 3300049824 | Ga0501045_0009821 | Ga0501045_0009821_120_836 | 226 |
| 3 | 3300049588 | Ga0501072_0521011 | Ga0501072_0521011_134_910 | 227 |
| 4 | 3300005563 | Ga0068855_100000901 | Ga0068855_10000090123 | 231 |
| 5 | 3300025949 | Ga0207667_10000979 | Ga0207667_1000097927 | 231 |
| 6 | 3300005518 | Ga0070699_100026037 | Ga0070699_1000260374 | 236 |
| 7 | 3300013297 | Ga0157378_10012062 | Ga0157378_100120621 | 237 |
| 8 | 3300025933 | Ga0207706_10117654 | Ga0207706_101176543 | 237 |
| 9 | 3300050508 | nmdc:mga09592_1577_c1 | nmdc:mga09592_1577_c1_5858_6643 | 240 |
| 10 | 3300050509 | nmdc:mga0qj67_1767_c1 | nmdc:mga0qj67_1767_c1_9042_9827 | 240 |
| 11 | 3300009176 | Ga0105242_10127797 | Ga0105242_101277973 | 243 |
| 12 | 3300025904 | Ga0207647_10145080 | Ga0207647_101450801 | 243 |
| 13 | 3300005441 | Ga0070700_100223116 | Ga0070700_1002231162 | 247 |
| 14 | 3300005457 | Ga0070662_100201553 | Ga0070662_1002015532 | 247 |
| 15 | 3300005471 | Ga0070698_100097561 | Ga0070698_1000975612 | 247 |
| 16 | 3300005545 | Ga0070695_100134226 | Ga0070695_1001342261 | 247 |
| 17 | 3300009094 | Ga0111539_10051412 | Ga0111539_100514123 | 247 |
| 18 | 3300027907 | Ga0207428_10297030 | Ga0207428_102970301 | 247 |
| 19 | 3300050511 | nmdc:mga08y16_322996_c1 | nmdc:mga08y16_322996_c1_110_892 | 247 |
| 20 | 3300005467 | Ga0070706_100100933 | Ga0070706_1001009333 | 248 |
| 21 | 3300025910 | Ga0207684_10135352 | Ga0207684_101353522 | 248 |
| 22 | 3300005330 | Ga0070690_100005715 | Ga0070690_1000057156 | 250 |
| 23 | 3300005343 | Ga0070687_100006350 | Ga0070687_1000063505 | 250 |
| 24 | 3300005353 | Ga0070669_100424730 | Ga0070669_1004247301 | 250 |
| 25 | 3300005364 | Ga0070673_100477874 | Ga0070673_1004778741 | 250 |
| 26 | 3300005444 | Ga0070694_100242029 | Ga0070694_1002420291 | 250 |
| 27 | 3300005459 | Ga0068867_100043178 | Ga0068867_1000431783 | 250 |
| 28 | 3300005544 | Ga0070686_100109017 | Ga0070686_1001090171 | 250 |
| 29 | 3300005549 | Ga0070704_100058364 | Ga0070704_1000583642 | 250 |
| 30 | 3300005843 | Ga0068860_100064939 | Ga0068860_1000649393 | 250 |
| 31 | 3300025918 | Ga0207662_10012671 | Ga0207662_100126714 | 250 |
| 32 | 3300026089 | Ga0207648_10058950 | Ga0207648_100589503 | 250 |
| 33 | 3300026118 | Ga0207675_100096163 | Ga0207675_1000961632 | 250 |
| 34 | 3300028381 | Ga0268264_10109272 | Ga0268264_101092723 | 250 |
| 35 | 3300017792 | Ga0163161_10219235 | Ga0163161_102192352 | 252 |
| 36 | 3300006028 | Ga0070717_10167996 | Ga0070717_101679962 | 254 |
| 37 | 3300005329 | Ga0070683_100000959 | Ga0070683_10000095911 | 255 |
| 38 | 3300005338 | Ga0068868_100023856 | Ga0068868_1000238565 | 255 |
| 39 | 3300005547 | Ga0070693_100000653 | Ga0070693_1000006533 | 255 |
| 40 | 3300025944 | Ga0207661_10024292 | Ga0207661_100242922 | 255 |
| 41 | 3300025926 | Ga0207659_10400313 | Ga0207659_104003131 | 257 |
| 42 | 3300049779 | Ga0501283_001814 | Ga0501283_001814_205_1020 | 257 |
| 43 | 3300005548 | Ga0070665_100001000 | Ga0070665_10000100021 | 258 |
| 44 | 3300006237 | Ga0097621_100042436 | Ga0097621_1000424363 | 258 |
| 45 | 3300009553 | Ga0105249_10101822 | Ga0105249_101018222 | 258 |
| 46 | 3300013296 | Ga0157374_10482449 | Ga0157374_104824492 | 258 |
| 47 | 3300025961 | Ga0207712_10068354 | Ga0207712_100683542 | 258 |
| 48 | 3300028379 | Ga0268266_10001536 | Ga0268266_1000153618 | 258 |
| 49 | 3300028653 | Ga0265323_10042405 | Ga0265323_100424051 | 258 |
| 50 | 3300031730 | Ga0307516_10045726 | Ga0307516_100457265 | 258 |
| 51 | 3300035398 | Ga0316574_0090407 | Ga0316574_0090407_420_1229 | 258 |
| 52 | 3300009147 | Ga0114129_10165369 | Ga0114129_101653693 | 260 |
| 53 | 3300049583 | Ga0501067_0084414 | Ga0501067_0084414_22_903 | 260 |
| 54 | 3300049585 | Ga0501069_0017958 | Ga0501069_0017958_1413_2294 | 260 |
| 55 | 3300003323 | rootH1_10056873 | rootH1_100568735 | 261 |
| 56 | 3300048914 | Ga0496111_0065478 | Ga0496111_0065478_588_1415 | 261 |
| 57 | 3300048915 | Ga0496112_0211753 | Ga0496112_0211753_376_1203 | 261 |
| 58 | 3300005445 | Ga0070708_100045904 | Ga0070708_1000459044 | 262 |
| 59 | 3300005536 | Ga0070697_100016858 | Ga0070697_1000168585 | 262 |
| 60 | 3300009147 | Ga0114129_10179175 | Ga0114129_101791752 | 262 |
| 61 | 3300028800 | Ga0265338_10009056 | Ga0265338_100090564 | 262 |
| 62 | 3300005458 | Ga0070681_10000921 | Ga0070681_100009216 | 263 |
| 63 | 3300006871 | Ga0075434_100052418 | Ga0075434_1000524184 | 263 |
| 64 | 3300025912 | Ga0207707_10018407 | Ga0207707_100184073 | 263 |
| 65 | 3300050515 | nmdc:mga0a205_8444_c1 | nmdc:mga0a205_8444_c1_2259_3128 | 263 |
| 66 | 3300031548 | Ga0307408_100380158 | Ga0307408_1003801581 | 264 |
| 67 | 3300031995 | Ga0307409_100347158 | Ga0307409_1003471582 | 264 |
| 68 | 3300061734 | Ga0530510_0226078 | Ga0530510_0226078_381_1217 | 264 |
| 69 | 3300006852 | Ga0075433_10036558 | Ga0075433_100365583 | 265 |
| 70 | 3300009147 | Ga0114129_10131736 | Ga0114129_101317362 | 265 |
| 71 | 3300044712 | Ga0453684_0002236 | Ga0453684_0002236_967_1806 | 265 |
| 72 | 3300050507 | nmdc:mga05p37_96146_c1 | nmdc:mga05p37_96146_c1_910_1770 | 265 |
| 73 | 3300050515 | nmdc:mga0a205_12681_c2 | nmdc:mga0a205_12681_c2_1297_2157 | 265 |
| 74 | 3300003320 | rootH2_10037264 | rootH2_100372648 | 266 |
| 75 | 3300003323 | rootH1_10058041 | rootH1_100580415 | 266 |
| 76 | 3300009094 | Ga0111539_10139303 | Ga0111539_101393033 | 266 |
| 77 | 3300009147 | Ga0114129_10017837 | Ga0114129_100178374 | 266 |
| 78 | 3300031548 | Ga0307408_100026128 | Ga0307408_1000261283 | 266 |
| 79 | 3300031824 | Ga0307413_10032028 | Ga0307413_100320282 | 266 |
| 80 | 3300031824 | Ga0307413_10209577 | Ga0307413_102095772 | 266 |
| 81 | 3300031852 | Ga0307410_10004626 | Ga0307410_100046262 | 266 |
| 82 | 3300031852 | Ga0307410_10023779 | Ga0307410_100237793 | 266 |
| 83 | 3300031903 | Ga0307407_10007843 | Ga0307407_100078436 | 266 |
| 84 | 3300031903 | Ga0307407_10037938 | Ga0307407_100379382 | 266 |
| 85 | 3300031995 | Ga0307409_100001857 | Ga0307409_1000018573 | 266 |
| 86 | 3300031995 | Ga0307409_100017640 | Ga0307409_1000176402 | 266 |
| 87 | 3300031995 | Ga0307409_100114729 | Ga0307409_1001147292 | 266 |
| 88 | 3300032002 | Ga0307416_100021588 | Ga0307416_1000215882 | 266 |
| 89 | 3300032002 | Ga0307416_100028246 | Ga0307416_1000282463 | 266 |
| 90 | 3300032002 | Ga0307416_100079773 | Ga0307416_1000797731 | 266 |
| 91 | 3300032005 | Ga0307411_10057847 | Ga0307411_100578471 | 266 |
| 92 | 3300032126 | Ga0307415_100002924 | Ga0307415_1000029245 | 266 |
| 93 | 3300032126 | Ga0307415_100015978 | Ga0307415_1000159783 | 266 |
| 94 | 3300036401 | Ga0373937_0104829 | Ga0373937_0104829_524_1402 | 266 |
| 95 | 3300044658 | Ga0466972_0007110 | Ga0466972_0007110_2966_3892 | 266 |
| 96 | 3300044683 | Ga0466965_0058179 | Ga0466965_0058179_823_1749 | 266 |
| 97 | 3300044735 | Ga0466968_0000289 | Ga0466968_0000289_6814_7740 | 266 |
| 98 | 3300044901 | Ga0466960_0038838 | Ga0466960_0038838_34_960 | 266 |
| 99 | 3300046535 | Ga0495586_0072765 | Ga0495586_0072765_961_1821 | 266 |
| 100 | 3300049515 | Ga0501292_001586 | Ga0501292_001586_899_1741 | 266 |
| 101 | 3300049667 | Ga0501230_010356 | Ga0501230_010356_45_887 | 266 |
| 102 | 3300049669 | Ga0501235_004475 | Ga0501235_004475_566_1408 | 266 |
| 103 | 3300049677 | Ga0501247_007765 | Ga0501247_007765_169_1011 | 266 |
| 104 | 3300049679 | Ga0501249_011817 | Ga0501249_011817_18_860 | 266 |
| 105 | 3300049759 | Ga0501262_001811 | Ga0501262_001811_1041_1883 | 266 |
| 106 | 3300049760 | Ga0501263_000114 | Ga0501263_000114_1391_2233 | 266 |
| 107 | 3300049765 | Ga0501268_002321 | Ga0501268_002321_1346_2188 | 266 |
| 108 | 3300049765 | Ga0501268_034472 | Ga0501268_034472_63_905 | 266 |
| 109 | 3300049770 | Ga0501273_000190 | Ga0501273_000190_2667_3509 | 266 |
| 110 | 3300049771 | Ga0501274_001995 | Ga0501274_001995_584_1426 | 266 |
| 111 | 3300049779 | Ga0501283_015037 | Ga0501283_015037_94_936 | 266 |
| 112 | 3300050507 | nmdc:mga05p37_58031_c1 | nmdc:mga05p37_58031_c1_2428_3309 | 266 |
| 113 | 3300028653 | Ga0265323_10036101 | Ga0265323_100361012 | 267 |
| 114 | 3300048911 | Ga0496108_0441042 | Ga0496108_0441042_150_995 | 267 |
| 115 | 3300048912 | Ga0496109_0415283 | Ga0496109_0415283_59_904 | 267 |
| 116 | 3300048914 | Ga0496111_0202440 | Ga0496111_0202440_618_1463 | 267 |
| 117 | 3300048917 | Ga0496114_0215235 | Ga0496114_0215235_581_1426 | 267 |
| 118 | 3300005329 | Ga0070683_100252063 | Ga0070683_1002520631 | 268 |
| 119 | 3300009147 | Ga0114129_10060682 | Ga0114129_100606823 | 268 |
| 120 | 3300009147 | Ga0114129_10063637 | Ga0114129_100636372 | 268 |
| 121 | 3300025910 | Ga0207684_10046390 | Ga0207684_100463904 | 268 |
| 122 | 3300025922 | Ga0207646_10386878 | Ga0207646_103868781 | 268 |
| 123 | 3300025944 | Ga0207661_10347785 | Ga0207661_103477852 | 268 |
| 124 | 3300037471 | Ga0395905_0433647 | Ga0395905_0433647_329_1171 | 268 |
| 125 | 3300050507 | nmdc:mga05p37_159381_c1 | nmdc:mga05p37_159381_c1_1507_2361 | 268 |
| 126 | 3300050507 | nmdc:mga05p37_45949_c1 | nmdc:mga05p37_45949_c1_1668_2510 | 268 |
| 127 | 3300006846 | Ga0075430_100001319 | Ga0075430_10000131911 | 269 |
| 128 | 3300006880 | Ga0075429_100001229 | Ga0075429_10000122911 | 269 |
| 129 | 3300025915 | Ga0207693_10276101 | Ga0207693_102761011 | 269 |
| 130 | 3300027876 | Ga0209974_10006245 | Ga0209974_100062452 | 269 |
| 131 | 3300032005 | Ga0307411_10113335 | Ga0307411_101133352 | 269 |
| 132 | 3300004800 | Ga0058861_10063590 | Ga0058861_100635902 | 270 |
| 133 | 3300005458 | Ga0070681_10008633 | Ga0070681_100086336 | 270 |
| 134 | 3300035085 | Ga0373929_0000004 | Ga0373929_0000004_251862_252734 | 270 |
| 135 | 3300044712 | Ga0453684_0158120 | Ga0453684_0158120_396_1268 | 270 |
| 136 | 3300048907 | Ga0496104_0264051 | Ga0496104_0264051_598_1476 | 270 |
| 137 | 3300048909 | Ga0496106_0101309 | Ga0496106_0101309_853_1731 | 270 |
| 138 | 3300048915 | Ga0496112_0036859 | Ga0496112_0036859_926_1804 | 270 |
| 139 | 3300005328 | Ga0070676_10197171 | Ga0070676_101971711 | 271 |
| 140 | 3300005330 | Ga0070690_100000647 | Ga0070690_10000064717 | 271 |
| 141 | 3300005353 | Ga0070669_100096007 | Ga0070669_1000960072 | 271 |
| 142 | 3300005444 | Ga0070694_100099830 | Ga0070694_1000998302 | 271 |
| 143 | 3300005459 | Ga0068867_100225015 | Ga0068867_1002250152 | 271 |
| 144 | 3300005545 | Ga0070695_100208570 | Ga0070695_1002085702 | 271 |
| 145 | 3300005548 | Ga0070665_100000519 | Ga0070665_10000051928 | 271 |
| 146 | 3300005549 | Ga0070704_100008857 | Ga0070704_1000088572 | 271 |
| 147 | 3300005578 | Ga0068854_100218298 | Ga0068854_1002182982 | 271 |
| 148 | 3300006881 | Ga0068865_100096921 | Ga0068865_1000969212 | 271 |
| 149 | 3300009176 | Ga0105242_10271131 | Ga0105242_102711312 | 271 |
| 150 | 3300009553 | Ga0105249_10003166 | Ga0105249_100031664 | 271 |
| 151 | 3300013297 | Ga0157378_10276066 | Ga0157378_102760662 | 271 |
| 152 | 3300013308 | Ga0157375_10042970 | Ga0157375_100429704 | 271 |
| 153 | 3300014326 | Ga0157380_10000240 | Ga0157380_1000024011 | 271 |
| 154 | 3300014326 | Ga0157380_10003433 | Ga0157380_100034339 | 271 |
| 155 | 3300025909 | Ga0207705_10195349 | Ga0207705_101953492 | 271 |
| 156 | 3300025918 | Ga0207662_10049259 | Ga0207662_100492592 | 271 |
| 157 | 3300025923 | Ga0207681_10178906 | Ga0207681_101789061 | 271 |
| 158 | 3300025933 | Ga0207706_10271973 | Ga0207706_102719732 | 271 |
| 159 | 3300025981 | Ga0207640_10138388 | Ga0207640_101383882 | 271 |
| 160 | 3300026075 | Ga0207708_10066624 | Ga0207708_100666242 | 271 |
| 161 | 3300028379 | Ga0268266_10000192 | Ga0268266_100001926 | 271 |
| 162 | 3300031901 | Ga0307406_10051851 | Ga0307406_100518512 | 271 |
| 163 | 3300050511 | nmdc:mga08y16_31458_c1 | nmdc:mga08y16_31458_c1_1007_1861 | 271 |
| 164 | 3300006847 | Ga0075431_100134922 | Ga0075431_1001349222 | 272 |
| 165 | 3300020069 | Ga0197907_10615817 | Ga0197907_106158172 | 272 |
| 166 | 3300031824 | Ga0307413_10048097 | Ga0307413_100480972 | 272 |
| 167 | 3300005841 | Ga0068863_100503402 | Ga0068863_1005034022 | 273 |
| 168 | 3300005844 | Ga0068862_100065608 | Ga0068862_1000656082 | 273 |
| 169 | 3300028380 | Ga0268265_10100863 | Ga0268265_101008631 | 273 |
| 170 | 3300049592 | Ga0501076_0039926 | Ga0501076_0039926_1322_2206 | 273 |
| 171 | 3300005329 | Ga0070683_100003769 | Ga0070683_1000037698 | 274 |
| 172 | 3300005436 | Ga0070713_100216502 | Ga0070713_1002165022 | 274 |
| 173 | 3300009094 | Ga0111539_10519528 | Ga0111539_105195281 | 274 |
| 174 | 3300009147 | Ga0114129_10705279 | Ga0114129_107052792 | 274 |
| 175 | 3300025928 | Ga0207700_10231007 | Ga0207700_102310072 | 274 |
| 176 | 3300049572 | Ga0501036_0130612 | Ga0501036_0130612_1144_2028 | 274 |
| 177 | 3300049580 | Ga0501046_0138447 | Ga0501046_0138447_242_1126 | 274 |
| 178 | 3300049741 | Ga0501079_0164646 | Ga0501079_0164646_412_1296 | 274 |
| 179 | 3300049743 | Ga0501081_0067803 | Ga0501081_0067803_1306_2190 | 274 |
| 180 | 3300049822 | Ga0501035_0366998 | Ga0501035_0366998_107_991 | 274 |
| 181 | 3300054114 | Ga0501084_0019208 | Ga0501084_0019208_3236_4120 | 274 |
| 182 | 3300061719 | Ga0466962_0053805 | Ga0466962_0053805_256_1140 | 274 |
| 183 | 3300061734 | Ga0530510_0014947 | Ga0530510_0014947_1271_2155 | 274 |
| 184 | 3300005471 | Ga0070698_100001023 | Ga0070698_1000010235 | 275 |
| 185 | 3300013297 | Ga0157378_10041581 | Ga0157378_100415814 | 276 |
| 186 | 3300026075 | Ga0207708_10054970 | Ga0207708_100549702 | 276 |
| 187 | 3300005356 | Ga0070674_100328795 | Ga0070674_1003287951 | 277 |
| 188 | 3300005437 | Ga0070710_10176361 | Ga0070710_101763612 | 277 |
| 189 | 3300005564 | Ga0070664_100043199 | Ga0070664_1000431992 | 277 |
| 190 | 3300013100 | Ga0157373_10387943 | Ga0157373_103879431 | 277 |
| 191 | 3300021384 | Ga0213876_10175197 | Ga0213876_101751972 | 277 |
| 192 | 3300039437 | Ga0436365_1590701 | Ga0436365_1590701_2891_3784 | 277 |
| 193 | 3300004803 | Ga0058862_10285242 | Ga0058862_102852422 | 278 |
| 194 | 3300005327 | Ga0070658_10142981 | Ga0070658_101429812 | 278 |
| 195 | 3300005336 | Ga0070680_100174992 | Ga0070680_1001749922 | 278 |
| 196 | 3300005458 | Ga0070681_10006011 | Ga0070681_100060118 | 278 |
| 197 | 3300005530 | Ga0070679_100010227 | Ga0070679_1000102275 | 278 |
| 198 | 3300020069 | Ga0197907_10652581 | Ga0197907_106525812 | 278 |
| 199 | 3300020070 | Ga0206356_10518523 | Ga0206356_105185232 | 278 |
| 200 | 3300020075 | Ga0206349_1028721 | Ga0206349_10287212 | 278 |
| 201 | 3300020076 | Ga0206355_1434889 | Ga0206355_14348892 | 278 |
| 202 | 3300020080 | Ga0206350_10874752 | Ga0206350_108747522 | 278 |
| 203 | 3300022467 | Ga0224712_10008724 | Ga0224712_100087242 | 278 |
| 204 | 3300025912 | Ga0207707_10003635 | Ga0207707_100036355 | 278 |
| 205 | 3300025917 | Ga0207660_10025964 | Ga0207660_100259642 | 278 |
| 206 | 3300038443 | Ga0395901_0215847 | Ga0395901_0215847_1049_1945 | 278 |
| 207 | 3300038443 | Ga0395901_0044946 | Ga0395901_0044946_663_1565 | 280 |
| 208 | 3300005295 | Ga0065707_10016330 | Ga0065707_100163303 | 281 |
| 209 | 3300005438 | Ga0070701_10084467 | Ga0070701_100844672 | 284 |
| 210 | 3300005617 | Ga0068859_100030094 | Ga0068859_1000300942 | 284 |
| 211 | 3300005719 | Ga0068861_100460573 | Ga0068861_1004605731 | 284 |
| 212 | 3300005842 | Ga0068858_100182414 | Ga0068858_1001824142 | 284 |
| 213 | 3300005843 | Ga0068860_100003871 | Ga0068860_1000038715 | 284 |
| 214 | 3300006173 | Ga0070716_100000001 | Ga0070716_100000001353 | 284 |
| 215 | 3300006931 | Ga0097620_100030095 | Ga0097620_1000300952 | 284 |
| 216 | 3300009174 | Ga0105241_10005587 | Ga0105241_100055874 | 284 |
| 217 | 3300025911 | Ga0207654_10008256 | Ga0207654_100082564 | 284 |
| 218 | 3300025939 | Ga0207665_10000002 | Ga0207665_10000002225 | 284 |
| 219 | 3300026035 | Ga0207703_10149201 | Ga0207703_101492012 | 284 |
| 220 | 3300028381 | Ga0268264_10076026 | Ga0268264_100760263 | 284 |
| 221 | 3300009545 | Ga0105237_10050784 | Ga0105237_100507842 | 285 |
| 222 | 3300013308 | Ga0157375_10013687 | Ga0157375_100136874 | 285 |
| 223 | 3300005353 | Ga0070669_100008059 | Ga0070669_1000080592 | 286 |
| 224 | 3300025923 | Ga0207681_10021127 | Ga0207681_100211271 | 286 |
| 225 | 3300025933 | Ga0207706_10430382 | Ga0207706_104303821 | 286 |
| 226 | 3300025961 | Ga0207712_10013243 | Ga0207712_100132435 | 286 |
| 227 | 3300026075 | Ga0207708_10011552 | Ga0207708_100115524 | 286 |
| 228 | 3300026118 | Ga0207675_100011350 | Ga0207675_1000113508 | 286 |
| 229 | 3300002074 | JGI24748J21848_1000010 | JGI24748J21848_100001025 | 291 |
| 230 | 3300002239 | JGI24034J26672_10000001 | JGI24034J26672_10000001657 | 291 |
| 231 | 3300005842 | Ga0068858_100000005 | Ga0068858_10000000582 | 291 |
| 232 | 3300009101 | Ga0105247_10000002 | Ga0105247_10000002339 | 291 |
| 233 | 3300025223 | Ga0207672_1000034 | Ga0207672_100003412 | 291 |
| 234 | 3300025900 | Ga0207710_10000002 | Ga0207710_10000002339 | 291 |
| 235 | 3300025931 | Ga0207644_10000210 | Ga0207644_1000021018 | 291 |
| 236 | 3300026035 | Ga0207703_10000914 | Ga0207703_100009146 | 291 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7k2t-assembly1.cif.gz_B | mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs | 0.8619 | 56 | 289 |
| 6jbh-assembly1.cif.gz_D | cryo-em structure and transport mechanism of a wall teichoic acid abc transporter | 0.851 | 48 | 289 |
| 6m96-assembly1.cif.gz_B-2 | atp-bound conformation of the wzmwzt o antigen abc transporter | 0.8345 | 56 | 289 |
| 8dku-assembly1.cif.gz_B | cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen | 0.8258 | 56 | 288 |
| 7k2t-assembly1.cif.gz_B | mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs | 0.814 | 56 | 289 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.7399 | 108 | 278 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6157 | 82 | 278 | 3.40.1710.10 |
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.5655 | 102 | 278 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.4629 | 108 | 278 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.4407 | 82 | 278 | 3.40.1710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A518F1A7-F1-model_v4 | Transport permease protein | 0.9423 | 48 | 291 |
GO:0005886
GO:0015920 GO:0140359 |
| AF-A0A2V6HWZ8-F1-model_v4 | Phosphate ABC transporter permease | 0.9387 | 83 | 291 |
GO:0015920
GO:0016020 GO:0140359 |
| AF-A0A225DQG3-F1-model_v4 | Transport permease protein | 0.9376 | 47 | 291 |
GO:0015920
GO:0043190 GO:0140359 |
| AF-A0A524I813-F1-model_v4 | Transport permease protein | 0.9365 | 35 | 291 |
GO:0005886
GO:0015920 GO:0140359 |
| AF-A0A7C7H4P4-F1-model_v4 | Transport permease protein | 0.9354 | 47 | 291 |
GO:0005886
GO:0015920 GO:0140359 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar