F348981

General Info

Members Datasets Scaffolds Average Seq Length
236 166 236 284

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100134922|Ga0075431_1001349222
Length 341
Sequence MTPTLRSNDINASTTKTFGQFVNSTVLSIAGAWGQRPAAKAAPVTVPHIRLQPSKGWVSLKLDELWAYRELLYFLTWREVKVRYKQTVMGASWAIIQPFFTMVVFSLFFGKLARIPSDGIPYPIFSFAALVPWTFFANGISNSGMSLVASHNLIKKVYFPRLVIPISSVTSGLIDFALAFVVLMGMMVYFAFLAPLHNVWTPSIVASAFAHQTVQVAFTANLLFVIPLLGLAFITALGVGLWLSAMNVQFRDVRYIIPFLVQFWMFATPIAYPSTLLPEPWRTLYGLNPMAGVIEGFRWALLGTNTAPGPMIWVSAVMAVLLLISGAFYFRRMEKSFADVV

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
73 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
119 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
146 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
147 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
148 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
152 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
153 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
154 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
155 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
156 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.19
Metatranscriptomes 3.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.81
Rhizosphere 93.64
Stem 0
Stem Tuber 0
Unclassified 2.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000010 3300002074 Bacteria 166979
2 JGI24034J26672_10000001 3300002239 Bacteria 1118280
3 rootH2_10037264 3300003320 Bacteria 8992
4 rootH1_10056873 3300003323 Bacteria 4496
5 rootH1_10058041 3300003323 Bacteria 6277
6 Ga0058861_10063590 3300004800 Bacteria 3515
7 Ga0058862_10285242 3300004803 Bacteria 1362
8 Ga0065707_10016330 3300005295 Bacteria 2627
9 Ga0070658_10142981 3300005327 Bacteria 1999
10 Ga0070676_10197171 3300005328 Bacteria 1318
11 Ga0070683_100000959 3300005329 Bacteria 21436
12 Ga0070683_100003769 3300005329 Bacteria 12376
13 Ga0070683_100252063 3300005329 Unclassified 1679
14 Ga0070690_100000647 3300005330 Bacteria 17732
15 Ga0070690_100005715 3300005330 Bacteria 7006
16 Ga0070680_100174992 3300005336 Bacteria 1807
17 Ga0068868_100023856 3300005338 Bacteria 4634
18 Ga0070687_100006350 3300005343 Bacteria 4840
19 Ga0070669_100008059 3300005353 Bacteria 7523
20 Ga0070669_100096007 3300005353 Bacteria 2230
21 Ga0070669_100424730 3300005353 Bacteria 1091
22 Ga0070674_100328795 3300005356 Bacteria 1228
23 Ga0070673_100477874 3300005364 Unclassified 1124
24 Ga0070713_100216502 3300005436 Bacteria 1736
25 Ga0070710_10176361 3300005437 Bacteria 1335
26 Ga0070701_10084467 3300005438 Bacteria 1726
27 Ga0070700_100223116 3300005441 Unclassified 1336
28 Ga0070694_100099830 3300005444 Bacteria 2052
29 Ga0070694_100242029 3300005444 Bacteria 1361
30 Ga0070708_100045904 3300005445 Bacteria 3852
31 Ga0070662_100201553 3300005457 Bacteria 1579
32 Ga0070681_10000921 3300005458 Bacteria 24871
33 Ga0070681_10006011 3300005458 Bacteria 11761
34 Ga0070681_10008633 3300005458 Bacteria 9988
35 Ga0068867_100043178 3300005459 Bacteria 3300
36 Ga0068867_100225015 3300005459 Bacteria 1514
37 Ga0070706_100100933 3300005467 Bacteria 2682
38 Ga0070698_100001023 3300005471 Bacteria 30748
39 Ga0070698_100097561 3300005471 Viruses 2915
40 Ga0070699_100026037 3300005518 Bacteria 5045
41 Ga0070679_100010227 3300005530 Bacteria 8895
42 Ga0070697_100016858 3300005536 Bacteria 5744
43 Ga0070686_100109017 3300005544 Bacteria 1883
44 Ga0070695_100134226 3300005545 Unclassified 1709
45 Ga0070695_100208570 3300005545 Bacteria 1401
46 Ga0070693_100000653 3300005547 Bacteria 15287
47 Ga0070665_100000519 3300005548 Bacteria 54796
48 Ga0070665_100001000 3300005548 Bacteria 35859
49 Ga0070704_100008857 3300005549 Bacteria 6058
50 Ga0070704_100058364 3300005549 Bacteria 2749
51 Ga0068855_100000901 3300005563 Bacteria 36814
52 Ga0070664_100043199 3300005564 Bacteria 3802
53 Ga0068854_100218298 3300005578 Bacteria 1507
54 Ga0068859_100030094 3300005617 Bacteria 5447
55 Ga0068861_100460573 3300005719 Bacteria 1141
56 Ga0068863_100503402 3300005841 Bacteria 1193
57 Ga0068858_100000005 3300005842 Bacteria 305830
58 Ga0068858_100182414 3300005842 Bacteria 1982
59 Ga0068860_100003871 3300005843 Bacteria 15378
60 Ga0068860_100064939 3300005843 Bacteria 3466
61 Ga0068862_100065608 3300005844 Bacteria 3127
62 Ga0070717_10167996 3300006028 Bacteria 1906
63 Ga0070716_100000001 3300006173 Bacteria 400668
64 Ga0097621_100042436 3300006237 Bacteria 3664
65 Ga0075430_100001319 3300006846 Bacteria 20034
66 Ga0075431_100134922 3300006847 Unclassified 2544
67 Ga0075433_10036558 3300006852 Bacteria 4231
68 Ga0075434_100052418 3300006871 Bacteria 4054
69 Ga0075429_100001229 3300006880 Bacteria 20798
70 Ga0068865_100096921 3300006881 Bacteria 2152
71 Ga0097620_100030095 3300006931 Bacteria 5447
72 Ga0111539_10051412 3300009094 Bacteria 4908
73 Ga0111539_10139303 3300009094 Viruses 2841
74 Ga0111539_10519528 3300009094 Bacteria 1387
75 Ga0105247_10000002 3300009101 Bacteria 724587
76 Ga0114129_10017837 3300009147 Bacteria 10107
77 Ga0114129_10060682 3300009147 Bacteria 5287
78 Ga0114129_10063637 3300009147 Bacteria 5150
79 Ga0114129_10131736 3300009147 Bacteria 3433
80 Ga0114129_10165369 3300009147 Bacteria 3020
81 Ga0114129_10179175 3300009147 Bacteria 2885
82 Ga0114129_10705279 3300009147 Bacteria 1296
83 Ga0105241_10005587 3300009174 Bacteria 9284
84 Ga0105242_10127797 3300009176 Bacteria 2190
85 Ga0105242_10271131 3300009176 Bacteria 1537
86 Ga0105237_10050784 3300009545 Bacteria 4167
87 Ga0105249_10003166 3300009553 Bacteria 14235
88 Ga0105249_10101822 3300009553 Bacteria 2702
89 Ga0157373_10387943 3300013100 Bacteria 1000
90 Ga0157374_10482449 3300013296 Bacteria 1243
91 Ga0157378_10012062 3300013297 Bacteria 7566
92 Ga0157378_10041581 3300013297 Unclassified 4078
93 Ga0157378_10276066 3300013297 Bacteria 1618
94 Ga0157375_10013687 3300013308 Bacteria 7232
95 Ga0157375_10042970 3300013308 Unclassified 4379
96 Ga0157380_10000240 3300014326 Bacteria 32944
97 Ga0157380_10003433 3300014326 Bacteria 10881
98 Ga0163161_10219235 3300017792 Unclassified 1472
99 Ga0197907_10615817 3300020069 Bacteria 3626
100 Ga0197907_10652581 3300020069 Bacteria 3728
101 Ga0206356_10518523 3300020070 Unclassified 2103
102 Ga0206349_1028721 3300020075 Bacteria 3327
103 Ga0206355_1434889 3300020076 Bacteria 1071
104 Ga0206350_10874752 3300020080 Bacteria 2734
105 Ga0213876_10175197 3300021384 Unclassified 1141
106 Ga0224712_10008724 3300022467 Bacteria 3021
107 Ga0207672_1000034 3300025223 Bacteria 17673
108 Ga0207710_10000002 3300025900 Bacteria 1251998
109 Ga0207647_10145080 3300025904 Bacteria 1390
110 Ga0207705_10195349 3300025909 Bacteria 1532
111 Ga0207684_10046390 3300025910 Bacteria 3686
112 Ga0207684_10135352 3300025910 Bacteria 2116
113 Ga0207654_10008256 3300025911 Bacteria 5256
114 Ga0207707_10003635 3300025912 Bacteria 13674
115 Ga0207707_10018407 3300025912 Bacteria 6090
116 Ga0207693_10276101 3300025915 Unclassified 1317
117 Ga0207660_10025964 3300025917 Bacteria 3984
118 Ga0207662_10012671 3300025918 Bacteria 4699
119 Ga0207662_10049259 3300025918 Bacteria 2499
120 Ga0207646_10386878 3300025922 Bacteria 1263
121 Ga0207681_10021127 3300025923 Unclassified 4133
122 Ga0207681_10178906 3300025923 Bacteria 1614
123 Ga0207659_10400313 3300025926 Bacteria 1148
124 Ga0207700_10231007 3300025928 Bacteria 1573
125 Ga0207644_10000210 3300025931 Bacteria 40409
126 Ga0207706_10117654 3300025933 Bacteria 2337
127 Ga0207706_10271973 3300025933 Bacteria 1478
128 Ga0207706_10430382 3300025933 Bacteria 1143
129 Ga0207665_10000002 3300025939 Bacteria 267895
130 Ga0207661_10024292 3300025944 Bacteria 4591
131 Ga0207661_10347785 3300025944 Unclassified 1337
132 Ga0207667_10000979 3300025949 Bacteria 36475
133 Ga0207712_10013243 3300025961 Bacteria 5286
134 Ga0207712_10068354 3300025961 Bacteria 2545
135 Ga0207640_10138388 3300025981 Bacteria 1771
136 Ga0207703_10000914 3300026035 Bacteria 28751
137 Ga0207703_10149201 3300026035 Bacteria 2037
138 Ga0207708_10011552 3300026075 Bacteria 6579
139 Ga0207708_10054970 3300026075 Bacteria 3035
140 Ga0207708_10066624 3300026075 Bacteria 2753
141 Ga0207648_10058950 3300026089 Bacteria 3348
142 Ga0207675_100011350 3300026118 Bacteria 8337
143 Ga0207675_100096163 3300026118 Bacteria 2788
144 Ga0209974_10006245 3300027876 Unclassified 4167
145 Ga0207428_10297030 3300027907 Bacteria 1196
146 Ga0268266_10000192 3300028379 Bacteria 107069
147 Ga0268266_10001536 3300028379 Bacteria 27006
148 Ga0268265_10100863 3300028380 Bacteria 2331
149 Ga0268264_10076026 3300028381 Bacteria 2856
150 Ga0268264_10109272 3300028381 Bacteria 2419
151 Ga0265323_10036101 3300028653 Bacteria 1819
152 Ga0265323_10042405 3300028653 Bacteria 1648
153 Ga0265338_10009056 3300028800 Bacteria 11975
154 Ga0307408_100026128 3300031548 Unclassified 4005
155 Ga0307408_100380158 3300031548 Bacteria 1207
156 Ga0307516_10045726 3300031730 Bacteria 4322
157 Ga0307413_10032028 3300031824 Bacteria 2974
158 Ga0307413_10048097 3300031824 Bacteria 2547
159 Ga0307413_10209577 3300031824 Bacteria 1414
160 Ga0307410_10004626 3300031852 Bacteria 7145
161 Ga0307410_10023779 3300031852 Bacteria 3817
162 Ga0307406_10051851 3300031901 Bacteria 2607
163 Ga0307407_10007843 3300031903 Bacteria 4861
164 Ga0307407_10037938 3300031903 Bacteria 2666
165 Ga0307409_100001857 3300031995 Bacteria 10746
166 Ga0307409_100017640 3300031995 Bacteria 4766
167 Ga0307409_100114729 3300031995 Bacteria 2267
168 Ga0307409_100347158 3300031995 Bacteria 1399
169 Ga0307416_100021588 3300032002 Unclassified 4626
170 Ga0307416_100028246 3300032002 Bacteria 4168
171 Ga0307416_100079773 3300032002 Bacteria 2760
172 Ga0307411_10057847 3300032005 Unclassified 2563
173 Ga0307411_10113335 3300032005 Bacteria 1946
174 Ga0307415_100002924 3300032126 Bacteria 8567
175 Ga0307415_100015978 3300032126 Bacteria 4459
176 Ga0373929_0000004 3300035085 Bacteria 462745
177 Ga0316574_0090407 3300035398 Bacteria 1951
178 Ga0373937_0104829 3300036401 Bacteria 2627
179 Ga0395905_0433647 3300037471 Bacteria 1211
180 Ga0395901_0044946 3300038443 Bacteria 4582
181 Ga0395901_0215847 3300038443 Bacteria 2007
182 Ga0436365_1590701 3300039437 Bacteria 12204
183 Ga0466972_0007110 3300044658 Bacteria 5620
184 Ga0466965_0058179 3300044683 Bacteria 1927
185 Ga0453684_0002236 3300044712 Bacteria 48011
186 Ga0453684_0158120 3300044712 Bacteria 2684
187 Ga0466968_0000289 3300044735 Bacteria 16020
188 Ga0466960_0038838 3300044901 Bacteria 2241
189 Ga0495586_0072765 3300046535 Bacteria 1880
190 Ga0496104_0264051 3300048907 Bacteria 1634
191 Ga0496106_0101309 3300048909 Bacteria 2234
192 Ga0496108_0441042 3300048911 Bacteria 1137
193 Ga0496109_0415283 3300048912 Bacteria 1271
194 Ga0496111_0065478 3300048914 Bacteria 2638
195 Ga0496111_0202440 3300048914 Bacteria 1476
196 Ga0496112_0036859 3300048915 Bacteria 4771
197 Ga0496112_0211753 3300048915 Bacteria 1895
198 Ga0496114_0215235 3300048917 Bacteria 1686
199 Ga0501292_001586 3300049515 Bacteria 2818
200 Ga0501036_0130612 3300049572 Bacteria 2121
201 Ga0501041_0068744 3300049577 Bacteria 2172
202 Ga0501046_0138447 3300049580 Bacteria 1843
203 Ga0501067_0084414 3300049583 Bacteria 1761
204 Ga0501069_0017958 3300049585 Bacteria 3815
205 Ga0501072_0521011 3300049588 Bacteria 940
206 Ga0501076_0039926 3300049592 Bacteria 3686
207 Ga0501230_010356 3300049667 Bacteria 1454
208 Ga0501235_004475 3300049669 Bacteria 3021
209 Ga0501247_007765 3300049677 Bacteria 1239
210 Ga0501249_011817 3300049679 Bacteria 1838
211 Ga0501079_0164646 3300049741 Bacteria 1729
212 Ga0501081_0067803 3300049743 Bacteria 2483
213 Ga0501262_001811 3300049759 Bacteria 2399
214 Ga0501263_000114 3300049760 Bacteria 4368
215 Ga0501268_002321 3300049765 Bacteria 2496
216 Ga0501268_034472 3300049765 Bacteria 930
217 Ga0501273_000190 3300049770 Bacteria 4405
218 Ga0501274_001995 3300049771 Bacteria 1581
219 Ga0501283_001814 3300049779 Bacteria 2764
220 Ga0501283_015037 3300049779 Bacteria 1188
221 Ga0501035_0366998 3300049822 Unclassified 1202
222 Ga0501045_0009821 3300049824 Bacteria 6697
223 nmdc:mga05p37_159381_c1 3300050507 Bacteria 2756
224 nmdc:mga05p37_45949_c1 3300050507 Bacteria 5370
225 nmdc:mga05p37_58031_c1 3300050507 Bacteria 4767
226 nmdc:mga05p37_96146_c1 3300050507 Bacteria 3649
227 nmdc:mga09592_1577_c1 3300050508 Bacteria 18351
228 nmdc:mga0qj67_1767_c1 3300050509 Bacteria 15297
229 nmdc:mga08y16_31458_c1 3300050511 Bacteria 5581
230 nmdc:mga08y16_322996_c1 3300050511 Bacteria 1589
231 nmdc:mga0a205_12681_c2 3300050515 Bacteria 4232
232 nmdc:mga0a205_8444_c1 3300050515 Bacteria 9372
233 Ga0501084_0019208 3300054114 Bacteria 5692
234 Ga0466962_0053805 3300061719 Bacteria 1923
235 Ga0530510_0014947 3300061734 Bacteria 5481
236 Ga0530510_0226078 3300061734 Bacteria 1392

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049577 Ga0501041_0068744 Ga0501041_0068744_45_761 226
2 3300049824 Ga0501045_0009821 Ga0501045_0009821_120_836 226
3 3300049588 Ga0501072_0521011 Ga0501072_0521011_134_910 227
4 3300005563 Ga0068855_100000901 Ga0068855_10000090123 231
5 3300025949 Ga0207667_10000979 Ga0207667_1000097927 231
6 3300005518 Ga0070699_100026037 Ga0070699_1000260374 236
7 3300013297 Ga0157378_10012062 Ga0157378_100120621 237
8 3300025933 Ga0207706_10117654 Ga0207706_101176543 237
9 3300050508 nmdc:mga09592_1577_c1 nmdc:mga09592_1577_c1_5858_6643 240
10 3300050509 nmdc:mga0qj67_1767_c1 nmdc:mga0qj67_1767_c1_9042_9827 240
11 3300009176 Ga0105242_10127797 Ga0105242_101277973 243
12 3300025904 Ga0207647_10145080 Ga0207647_101450801 243
13 3300005441 Ga0070700_100223116 Ga0070700_1002231162 247
14 3300005457 Ga0070662_100201553 Ga0070662_1002015532 247
15 3300005471 Ga0070698_100097561 Ga0070698_1000975612 247
16 3300005545 Ga0070695_100134226 Ga0070695_1001342261 247
17 3300009094 Ga0111539_10051412 Ga0111539_100514123 247
18 3300027907 Ga0207428_10297030 Ga0207428_102970301 247
19 3300050511 nmdc:mga08y16_322996_c1 nmdc:mga08y16_322996_c1_110_892 247
20 3300005467 Ga0070706_100100933 Ga0070706_1001009333 248
21 3300025910 Ga0207684_10135352 Ga0207684_101353522 248
22 3300005330 Ga0070690_100005715 Ga0070690_1000057156 250
23 3300005343 Ga0070687_100006350 Ga0070687_1000063505 250
24 3300005353 Ga0070669_100424730 Ga0070669_1004247301 250
25 3300005364 Ga0070673_100477874 Ga0070673_1004778741 250
26 3300005444 Ga0070694_100242029 Ga0070694_1002420291 250
27 3300005459 Ga0068867_100043178 Ga0068867_1000431783 250
28 3300005544 Ga0070686_100109017 Ga0070686_1001090171 250
29 3300005549 Ga0070704_100058364 Ga0070704_1000583642 250
30 3300005843 Ga0068860_100064939 Ga0068860_1000649393 250
31 3300025918 Ga0207662_10012671 Ga0207662_100126714 250
32 3300026089 Ga0207648_10058950 Ga0207648_100589503 250
33 3300026118 Ga0207675_100096163 Ga0207675_1000961632 250
34 3300028381 Ga0268264_10109272 Ga0268264_101092723 250
35 3300017792 Ga0163161_10219235 Ga0163161_102192352 252
36 3300006028 Ga0070717_10167996 Ga0070717_101679962 254
37 3300005329 Ga0070683_100000959 Ga0070683_10000095911 255
38 3300005338 Ga0068868_100023856 Ga0068868_1000238565 255
39 3300005547 Ga0070693_100000653 Ga0070693_1000006533 255
40 3300025944 Ga0207661_10024292 Ga0207661_100242922 255
41 3300025926 Ga0207659_10400313 Ga0207659_104003131 257
42 3300049779 Ga0501283_001814 Ga0501283_001814_205_1020 257
43 3300005548 Ga0070665_100001000 Ga0070665_10000100021 258
44 3300006237 Ga0097621_100042436 Ga0097621_1000424363 258
45 3300009553 Ga0105249_10101822 Ga0105249_101018222 258
46 3300013296 Ga0157374_10482449 Ga0157374_104824492 258
47 3300025961 Ga0207712_10068354 Ga0207712_100683542 258
48 3300028379 Ga0268266_10001536 Ga0268266_1000153618 258
49 3300028653 Ga0265323_10042405 Ga0265323_100424051 258
50 3300031730 Ga0307516_10045726 Ga0307516_100457265 258
51 3300035398 Ga0316574_0090407 Ga0316574_0090407_420_1229 258
52 3300009147 Ga0114129_10165369 Ga0114129_101653693 260
53 3300049583 Ga0501067_0084414 Ga0501067_0084414_22_903 260
54 3300049585 Ga0501069_0017958 Ga0501069_0017958_1413_2294 260
55 3300003323 rootH1_10056873 rootH1_100568735 261
56 3300048914 Ga0496111_0065478 Ga0496111_0065478_588_1415 261
57 3300048915 Ga0496112_0211753 Ga0496112_0211753_376_1203 261
58 3300005445 Ga0070708_100045904 Ga0070708_1000459044 262
59 3300005536 Ga0070697_100016858 Ga0070697_1000168585 262
60 3300009147 Ga0114129_10179175 Ga0114129_101791752 262
61 3300028800 Ga0265338_10009056 Ga0265338_100090564 262
62 3300005458 Ga0070681_10000921 Ga0070681_100009216 263
63 3300006871 Ga0075434_100052418 Ga0075434_1000524184 263
64 3300025912 Ga0207707_10018407 Ga0207707_100184073 263
65 3300050515 nmdc:mga0a205_8444_c1 nmdc:mga0a205_8444_c1_2259_3128 263
66 3300031548 Ga0307408_100380158 Ga0307408_1003801581 264
67 3300031995 Ga0307409_100347158 Ga0307409_1003471582 264
68 3300061734 Ga0530510_0226078 Ga0530510_0226078_381_1217 264
69 3300006852 Ga0075433_10036558 Ga0075433_100365583 265
70 3300009147 Ga0114129_10131736 Ga0114129_101317362 265
71 3300044712 Ga0453684_0002236 Ga0453684_0002236_967_1806 265
72 3300050507 nmdc:mga05p37_96146_c1 nmdc:mga05p37_96146_c1_910_1770 265
73 3300050515 nmdc:mga0a205_12681_c2 nmdc:mga0a205_12681_c2_1297_2157 265
74 3300003320 rootH2_10037264 rootH2_100372648 266
75 3300003323 rootH1_10058041 rootH1_100580415 266
76 3300009094 Ga0111539_10139303 Ga0111539_101393033 266
77 3300009147 Ga0114129_10017837 Ga0114129_100178374 266
78 3300031548 Ga0307408_100026128 Ga0307408_1000261283 266
79 3300031824 Ga0307413_10032028 Ga0307413_100320282 266
80 3300031824 Ga0307413_10209577 Ga0307413_102095772 266
81 3300031852 Ga0307410_10004626 Ga0307410_100046262 266
82 3300031852 Ga0307410_10023779 Ga0307410_100237793 266
83 3300031903 Ga0307407_10007843 Ga0307407_100078436 266
84 3300031903 Ga0307407_10037938 Ga0307407_100379382 266
85 3300031995 Ga0307409_100001857 Ga0307409_1000018573 266
86 3300031995 Ga0307409_100017640 Ga0307409_1000176402 266
87 3300031995 Ga0307409_100114729 Ga0307409_1001147292 266
88 3300032002 Ga0307416_100021588 Ga0307416_1000215882 266
89 3300032002 Ga0307416_100028246 Ga0307416_1000282463 266
90 3300032002 Ga0307416_100079773 Ga0307416_1000797731 266
91 3300032005 Ga0307411_10057847 Ga0307411_100578471 266
92 3300032126 Ga0307415_100002924 Ga0307415_1000029245 266
93 3300032126 Ga0307415_100015978 Ga0307415_1000159783 266
94 3300036401 Ga0373937_0104829 Ga0373937_0104829_524_1402 266
95 3300044658 Ga0466972_0007110 Ga0466972_0007110_2966_3892 266
96 3300044683 Ga0466965_0058179 Ga0466965_0058179_823_1749 266
97 3300044735 Ga0466968_0000289 Ga0466968_0000289_6814_7740 266
98 3300044901 Ga0466960_0038838 Ga0466960_0038838_34_960 266
99 3300046535 Ga0495586_0072765 Ga0495586_0072765_961_1821 266
100 3300049515 Ga0501292_001586 Ga0501292_001586_899_1741 266
101 3300049667 Ga0501230_010356 Ga0501230_010356_45_887 266
102 3300049669 Ga0501235_004475 Ga0501235_004475_566_1408 266
103 3300049677 Ga0501247_007765 Ga0501247_007765_169_1011 266
104 3300049679 Ga0501249_011817 Ga0501249_011817_18_860 266
105 3300049759 Ga0501262_001811 Ga0501262_001811_1041_1883 266
106 3300049760 Ga0501263_000114 Ga0501263_000114_1391_2233 266
107 3300049765 Ga0501268_002321 Ga0501268_002321_1346_2188 266
108 3300049765 Ga0501268_034472 Ga0501268_034472_63_905 266
109 3300049770 Ga0501273_000190 Ga0501273_000190_2667_3509 266
110 3300049771 Ga0501274_001995 Ga0501274_001995_584_1426 266
111 3300049779 Ga0501283_015037 Ga0501283_015037_94_936 266
112 3300050507 nmdc:mga05p37_58031_c1 nmdc:mga05p37_58031_c1_2428_3309 266
113 3300028653 Ga0265323_10036101 Ga0265323_100361012 267
114 3300048911 Ga0496108_0441042 Ga0496108_0441042_150_995 267
115 3300048912 Ga0496109_0415283 Ga0496109_0415283_59_904 267
116 3300048914 Ga0496111_0202440 Ga0496111_0202440_618_1463 267
117 3300048917 Ga0496114_0215235 Ga0496114_0215235_581_1426 267
118 3300005329 Ga0070683_100252063 Ga0070683_1002520631 268
119 3300009147 Ga0114129_10060682 Ga0114129_100606823 268
120 3300009147 Ga0114129_10063637 Ga0114129_100636372 268
121 3300025910 Ga0207684_10046390 Ga0207684_100463904 268
122 3300025922 Ga0207646_10386878 Ga0207646_103868781 268
123 3300025944 Ga0207661_10347785 Ga0207661_103477852 268
124 3300037471 Ga0395905_0433647 Ga0395905_0433647_329_1171 268
125 3300050507 nmdc:mga05p37_159381_c1 nmdc:mga05p37_159381_c1_1507_2361 268
126 3300050507 nmdc:mga05p37_45949_c1 nmdc:mga05p37_45949_c1_1668_2510 268
127 3300006846 Ga0075430_100001319 Ga0075430_10000131911 269
128 3300006880 Ga0075429_100001229 Ga0075429_10000122911 269
129 3300025915 Ga0207693_10276101 Ga0207693_102761011 269
130 3300027876 Ga0209974_10006245 Ga0209974_100062452 269
131 3300032005 Ga0307411_10113335 Ga0307411_101133352 269
132 3300004800 Ga0058861_10063590 Ga0058861_100635902 270
133 3300005458 Ga0070681_10008633 Ga0070681_100086336 270
134 3300035085 Ga0373929_0000004 Ga0373929_0000004_251862_252734 270
135 3300044712 Ga0453684_0158120 Ga0453684_0158120_396_1268 270
136 3300048907 Ga0496104_0264051 Ga0496104_0264051_598_1476 270
137 3300048909 Ga0496106_0101309 Ga0496106_0101309_853_1731 270
138 3300048915 Ga0496112_0036859 Ga0496112_0036859_926_1804 270
139 3300005328 Ga0070676_10197171 Ga0070676_101971711 271
140 3300005330 Ga0070690_100000647 Ga0070690_10000064717 271
141 3300005353 Ga0070669_100096007 Ga0070669_1000960072 271
142 3300005444 Ga0070694_100099830 Ga0070694_1000998302 271
143 3300005459 Ga0068867_100225015 Ga0068867_1002250152 271
144 3300005545 Ga0070695_100208570 Ga0070695_1002085702 271
145 3300005548 Ga0070665_100000519 Ga0070665_10000051928 271
146 3300005549 Ga0070704_100008857 Ga0070704_1000088572 271
147 3300005578 Ga0068854_100218298 Ga0068854_1002182982 271
148 3300006881 Ga0068865_100096921 Ga0068865_1000969212 271
149 3300009176 Ga0105242_10271131 Ga0105242_102711312 271
150 3300009553 Ga0105249_10003166 Ga0105249_100031664 271
151 3300013297 Ga0157378_10276066 Ga0157378_102760662 271
152 3300013308 Ga0157375_10042970 Ga0157375_100429704 271
153 3300014326 Ga0157380_10000240 Ga0157380_1000024011 271
154 3300014326 Ga0157380_10003433 Ga0157380_100034339 271
155 3300025909 Ga0207705_10195349 Ga0207705_101953492 271
156 3300025918 Ga0207662_10049259 Ga0207662_100492592 271
157 3300025923 Ga0207681_10178906 Ga0207681_101789061 271
158 3300025933 Ga0207706_10271973 Ga0207706_102719732 271
159 3300025981 Ga0207640_10138388 Ga0207640_101383882 271
160 3300026075 Ga0207708_10066624 Ga0207708_100666242 271
161 3300028379 Ga0268266_10000192 Ga0268266_100001926 271
162 3300031901 Ga0307406_10051851 Ga0307406_100518512 271
163 3300050511 nmdc:mga08y16_31458_c1 nmdc:mga08y16_31458_c1_1007_1861 271
164 3300006847 Ga0075431_100134922 Ga0075431_1001349222 272
165 3300020069 Ga0197907_10615817 Ga0197907_106158172 272
166 3300031824 Ga0307413_10048097 Ga0307413_100480972 272
167 3300005841 Ga0068863_100503402 Ga0068863_1005034022 273
168 3300005844 Ga0068862_100065608 Ga0068862_1000656082 273
169 3300028380 Ga0268265_10100863 Ga0268265_101008631 273
170 3300049592 Ga0501076_0039926 Ga0501076_0039926_1322_2206 273
171 3300005329 Ga0070683_100003769 Ga0070683_1000037698 274
172 3300005436 Ga0070713_100216502 Ga0070713_1002165022 274
173 3300009094 Ga0111539_10519528 Ga0111539_105195281 274
174 3300009147 Ga0114129_10705279 Ga0114129_107052792 274
175 3300025928 Ga0207700_10231007 Ga0207700_102310072 274
176 3300049572 Ga0501036_0130612 Ga0501036_0130612_1144_2028 274
177 3300049580 Ga0501046_0138447 Ga0501046_0138447_242_1126 274
178 3300049741 Ga0501079_0164646 Ga0501079_0164646_412_1296 274
179 3300049743 Ga0501081_0067803 Ga0501081_0067803_1306_2190 274
180 3300049822 Ga0501035_0366998 Ga0501035_0366998_107_991 274
181 3300054114 Ga0501084_0019208 Ga0501084_0019208_3236_4120 274
182 3300061719 Ga0466962_0053805 Ga0466962_0053805_256_1140 274
183 3300061734 Ga0530510_0014947 Ga0530510_0014947_1271_2155 274
184 3300005471 Ga0070698_100001023 Ga0070698_1000010235 275
185 3300013297 Ga0157378_10041581 Ga0157378_100415814 276
186 3300026075 Ga0207708_10054970 Ga0207708_100549702 276
187 3300005356 Ga0070674_100328795 Ga0070674_1003287951 277
188 3300005437 Ga0070710_10176361 Ga0070710_101763612 277
189 3300005564 Ga0070664_100043199 Ga0070664_1000431992 277
190 3300013100 Ga0157373_10387943 Ga0157373_103879431 277
191 3300021384 Ga0213876_10175197 Ga0213876_101751972 277
192 3300039437 Ga0436365_1590701 Ga0436365_1590701_2891_3784 277
193 3300004803 Ga0058862_10285242 Ga0058862_102852422 278
194 3300005327 Ga0070658_10142981 Ga0070658_101429812 278
195 3300005336 Ga0070680_100174992 Ga0070680_1001749922 278
196 3300005458 Ga0070681_10006011 Ga0070681_100060118 278
197 3300005530 Ga0070679_100010227 Ga0070679_1000102275 278
198 3300020069 Ga0197907_10652581 Ga0197907_106525812 278
199 3300020070 Ga0206356_10518523 Ga0206356_105185232 278
200 3300020075 Ga0206349_1028721 Ga0206349_10287212 278
201 3300020076 Ga0206355_1434889 Ga0206355_14348892 278
202 3300020080 Ga0206350_10874752 Ga0206350_108747522 278
203 3300022467 Ga0224712_10008724 Ga0224712_100087242 278
204 3300025912 Ga0207707_10003635 Ga0207707_100036355 278
205 3300025917 Ga0207660_10025964 Ga0207660_100259642 278
206 3300038443 Ga0395901_0215847 Ga0395901_0215847_1049_1945 278
207 3300038443 Ga0395901_0044946 Ga0395901_0044946_663_1565 280
208 3300005295 Ga0065707_10016330 Ga0065707_100163303 281
209 3300005438 Ga0070701_10084467 Ga0070701_100844672 284
210 3300005617 Ga0068859_100030094 Ga0068859_1000300942 284
211 3300005719 Ga0068861_100460573 Ga0068861_1004605731 284
212 3300005842 Ga0068858_100182414 Ga0068858_1001824142 284
213 3300005843 Ga0068860_100003871 Ga0068860_1000038715 284
214 3300006173 Ga0070716_100000001 Ga0070716_100000001353 284
215 3300006931 Ga0097620_100030095 Ga0097620_1000300952 284
216 3300009174 Ga0105241_10005587 Ga0105241_100055874 284
217 3300025911 Ga0207654_10008256 Ga0207654_100082564 284
218 3300025939 Ga0207665_10000002 Ga0207665_10000002225 284
219 3300026035 Ga0207703_10149201 Ga0207703_101492012 284
220 3300028381 Ga0268264_10076026 Ga0268264_100760263 284
221 3300009545 Ga0105237_10050784 Ga0105237_100507842 285
222 3300013308 Ga0157375_10013687 Ga0157375_100136874 285
223 3300005353 Ga0070669_100008059 Ga0070669_1000080592 286
224 3300025923 Ga0207681_10021127 Ga0207681_100211271 286
225 3300025933 Ga0207706_10430382 Ga0207706_104303821 286
226 3300025961 Ga0207712_10013243 Ga0207712_100132435 286
227 3300026075 Ga0207708_10011552 Ga0207708_100115524 286
228 3300026118 Ga0207675_100011350 Ga0207675_1000113508 286
229 3300002074 JGI24748J21848_1000010 JGI24748J21848_100001025 291
230 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001657 291
231 3300005842 Ga0068858_100000005 Ga0068858_10000000582 291
232 3300009101 Ga0105247_10000002 Ga0105247_10000002339 291
233 3300025223 Ga0207672_1000034 Ga0207672_100003412 291
234 3300025900 Ga0207710_10000002 Ga0207710_10000002339 291
235 3300025931 Ga0207644_10000210 Ga0207644_1000021018 291
236 3300026035 Ga0207703_10000914 Ga0207703_100009146 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

70

302

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8619 56 289
6jbh-assembly1.cif.gz_D cryo-em structure and transport mechanism of a wall teichoic acid abc transporter 0.851 48 289
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.8345 56 289
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.8258 56 288
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.814 56 289
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7399 108 278 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6157 82 278 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5655 102 278 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4629 108 278 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4407 82 278 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A518F1A7-F1-model_v4 Transport permease protein 0.9423 48 291 GO:0005886
GO:0015920
GO:0140359
AF-A0A2V6HWZ8-F1-model_v4 Phosphate ABC transporter permease 0.9387 83 291 GO:0015920
GO:0016020
GO:0140359
AF-A0A225DQG3-F1-model_v4 Transport permease protein 0.9376 47 291 GO:0015920
GO:0043190
GO:0140359
AF-A0A524I813-F1-model_v4 Transport permease protein 0.9365 35 291 GO:0005886
GO:0015920
GO:0140359
AF-A0A7C7H4P4-F1-model_v4 Transport permease protein 0.9354 47 291 GO:0005886
GO:0015920
GO:0140359

Feature Viewer

pLDDT pTM Quality
75.64 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map