F344416
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 231 | 181 | 222 | 321 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0319570|Ga0496104_0319570_85_1146 |
| Length | 323 |
| Sequence | MTDPQDFQPTQQAQPDPRLEHVVAQVTGELIRDRRNERRWRLFGRIAWFALAVAVVWGLVAQRGHVNAPSGPHTALIEVRGEIAEDQEANAENIVSALRSAFEDKNAQGVVLRFNSPGGSPVQSGIVNDEIKRLRKLHPTKKVYAVCEEMCASGAYYMAVAADEIYVDKASIVGSIGVLMDGFGFTGLMEKAGVERRLITAGSNKGMLDPFSPMTDKQRSYAQAMIDQIHNQFITVVKEGRGQRLHETPDTFSGLFWTGQEAVDQGLADHLGNLDYVAREVIKAEDVIDYTLQENVAERLAKRFGASVGAGAVRALQAPTLPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 2 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 3 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 4 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 5 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 6 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 7 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 8 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 9 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 10 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 11 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 51 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 63 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 106 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 108 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 110 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 111 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 112 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 113 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 114 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 115 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 116 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 117 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 118 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 119 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 120 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 121 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 122 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 123 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 124 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 125 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 126 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 127 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 128 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 129 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 130 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 131 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 132 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 133 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 134 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 135 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 136 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 137 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 138 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 139 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 140 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 141 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 142 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 143 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 144 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 145 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 146 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 147 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 148 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 153 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 155 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 156 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 157 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 158 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 161 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 168 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 169 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 170 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 171 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 175 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 176 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 177 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 179 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 180 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 181 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.24 |
| Metatranscriptomes | 0.87 |
| Isolates | 3.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.18 |
| Nodule | 1.3 |
| Rhizoplane | 1.3 |
| Rhizosphere | 67.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1017323 | 3300002705 | Bacteria | 1367 |
| 2 | JGI25164J39214_1002826 | 3300002772 | Bacteria | 2435 |
| 3 | rootH1_10009114 | 3300003316 | Bacteria | 1473 |
| 4 | rootH1_10027106 | 3300003316 | Bacteria | 6706 |
| 5 | rootH2_10016099 | 3300003320 | Bacteria | 4138 |
| 6 | rootL2_10001664 | 3300003322 | Bacteria | 70373 |
| 7 | rootH1_10006143 | 3300003323 | Bacteria | 26652 |
| 8 | rootH1_10034501 | 3300003323 | Bacteria | 5762 |
| 9 | Ga0055539_1000689 | 3300003752 | Bacteria | 8764 |
| 10 | Ga0055533_1000053 | 3300003756 | Bacteria | 199478 |
| 11 | Ga0055525_1000004 | 3300003759 | Bacteria | 888039 |
| 12 | Ga0055525_1000613 | 3300003759 | Bacteria | 14860 |
| 13 | Ga0055529_1000219 | 3300003763 | Bacteria | 74582 |
| 14 | Ga0055526_1004642 | 3300003771 | Bacteria | 8170 |
| 15 | Ga0055524_1000311 | 3300003775 | Bacteria | 46317 |
| 16 | Ga0055524_1025015 | 3300003775 | Bacteria | 1879 |
| 17 | Ga0055531_10011106 | 3300003794 | Bacteria | 4391 |
| 18 | Ga0055543_1018316 | 3300004625 | Bacteria | 1308 |
| 19 | Ga0065165_1000016 | 3300005262 | Bacteria | 286248 |
| 20 | Ga0065165_1000942 | 3300005262 | Bacteria | 37104 |
| 21 | Ga0070658_10012596 | 3300005327 | Bacteria | 6784 |
| 22 | Ga0070676_10018035 | 3300005328 | Bacteria | 3909 |
| 23 | Ga0070690_100027032 | 3300005330 | Bacteria | 3544 |
| 24 | Ga0070670_100008956 | 3300005331 | Bacteria | 8549 |
| 25 | Ga0070670_100067230 | 3300005331 | Bacteria | 3076 |
| 26 | Ga0070677_10001953 | 3300005333 | Bacteria | 6538 |
| 27 | Ga0068869_100045588 | 3300005334 | Bacteria | 3157 |
| 28 | Ga0068868_100012907 | 3300005338 | Bacteria | 6113 |
| 29 | Ga0070660_100021543 | 3300005339 | Bacteria | 4755 |
| 30 | Ga0070661_100016478 | 3300005344 | Bacteria | 5226 |
| 31 | Ga0070675_100001865 | 3300005354 | Bacteria | 15533 |
| 32 | Ga0070675_100030521 | 3300005354 | Bacteria | 4352 |
| 33 | Ga0070671_100006074 | 3300005355 | Bacteria | 9625 |
| 34 | Ga0070674_100014647 | 3300005356 | Bacteria | 4878 |
| 35 | Ga0070673_100169263 | 3300005364 | Bacteria | 1864 |
| 36 | Ga0070673_100216726 | 3300005364 | Bacteria | 1655 |
| 37 | Ga0070659_100000701 | 3300005366 | Bacteria | 24367 |
| 38 | Ga0070678_100048121 | 3300005456 | Bacteria | 3068 |
| 39 | Ga0070662_100297526 | 3300005457 | Bacteria | 1310 |
| 40 | Ga0068867_100004166 | 3300005459 | Bacteria | 10173 |
| 41 | Ga0068867_100008603 | 3300005459 | Bacteria | 7206 |
| 42 | Ga0070706_100409261 | 3300005467 | Bacteria | 1263 |
| 43 | Ga0070672_100001038 | 3300005543 | Bacteria | 16915 |
| 44 | Ga0070672_100002031 | 3300005543 | Bacteria | 12729 |
| 45 | Ga0070664_100418584 | 3300005564 | Bacteria | 1227 |
| 46 | Ga0068852_100089938 | 3300005616 | Bacteria | 2744 |
| 47 | Ga0068852_100144242 | 3300005616 | Bacteria | 2207 |
| 48 | Ga0068864_100023041 | 3300005618 | Bacteria | 5227 |
| 49 | Ga0068870_10033670 | 3300005840 | Bacteria | 2616 |
| 50 | Ga0068863_100254423 | 3300005841 | Bacteria | 1697 |
| 51 | Ga0068860_100048804 | 3300005843 | Bacteria | 4034 |
| 52 | Ga0075366_10006382 | 3300006195 | Bacteria | 6459 |
| 53 | Ga0075370_10017759 | 3300006353 | Bacteria | 3848 |
| 54 | Ga0075370_10053927 | 3300006353 | Bacteria | 2282 |
| 55 | Ga0075370_10111718 | 3300006353 | Bacteria | 1587 |
| 56 | Ga0068871_100079080 | 3300006358 | Bacteria | 2720 |
| 57 | Ga0075430_100037022 | 3300006846 | Bacteria | 4136 |
| 58 | Ga0075429_100002479 | 3300006880 | Bacteria | 15530 |
| 59 | Ga0099823_1000021 | 3300006944 | Bacteria | 76133 |
| 60 | Ga0105245_10331195 | 3300009098 | Bacteria | 1503 |
| 61 | Ga0105243_10020922 | 3300009148 | Bacteria | 4964 |
| 62 | Ga0105242_10001240 | 3300009176 | Bacteria | 20102 |
| 63 | Ga0105242_10054416 | 3300009176 | Bacteria | 3271 |
| 64 | Ga0157319_1000008 | 3300012497 | Bacteria | 315600 |
| 65 | Ga0163162_10117079 | 3300013306 | Bacteria | 2766 |
| 66 | Ga0163161_10016764 | 3300017792 | Bacteria | 5120 |
| 67 | Ga0213872_10000339 | 3300021361 | Bacteria | 39618 |
| 68 | Ga0213872_10001347 | 3300021361 | Bacteria | 16224 |
| 69 | Ga0213872_10031504 | 3300021361 | Bacteria | 2431 |
| 70 | Ga0209674_100039 | 3300025226 | Bacteria | 402292 |
| 71 | Ga0209672_103954 | 3300025228 | Bacteria | 2890 |
| 72 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 73 | Ga0209563_100080 | 3300025230 | Bacteria | 199504 |
| 74 | Ga0207427_100662 | 3300025231 | Bacteria | 16501 |
| 75 | Ga0209258_100072 | 3300025242 | Bacteria | 274355 |
| 76 | Ga0209677_100130 | 3300025253 | Bacteria | 72879 |
| 77 | Ga0209677_105283 | 3300025253 | Bacteria | 3415 |
| 78 | Ga0209759_1001834 | 3300025256 | Bacteria | 10650 |
| 79 | Ga0209759_1002774 | 3300025256 | Bacteria | 7419 |
| 80 | Ga0209759_1010054 | 3300025256 | Bacteria | 2805 |
| 81 | Ga0209455_1000053 | 3300025272 | Bacteria | 365949 |
| 82 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 83 | Ga0209050_1002388 | 3300025298 | Bacteria | 16298 |
| 84 | Ga0209050_1003136 | 3300025298 | Bacteria | 12623 |
| 85 | Ga0209256_1000616 | 3300025299 | Bacteria | 49183 |
| 86 | Ga0209256_1001395 | 3300025299 | Bacteria | 25179 |
| 87 | Ga0209051_1001254 | 3300025303 | Bacteria | 22688 |
| 88 | Ga0209051_1005227 | 3300025303 | Bacteria | 7665 |
| 89 | Ga0209051_1007206 | 3300025303 | Bacteria | 6116 |
| 90 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 91 | Ga0209257_1000756 | 3300025304 | Bacteria | 48782 |
| 92 | Ga0209257_1002915 | 3300025304 | Bacteria | 15775 |
| 93 | Ga0207697_10009261 | 3300025315 | Bacteria | 4260 |
| 94 | Ga0207656_10022645 | 3300025321 | Bacteria | 2523 |
| 95 | Ga0207682_10001757 | 3300025893 | Bacteria | 9947 |
| 96 | Ga0207643_10066795 | 3300025908 | Bacteria | 2063 |
| 97 | Ga0207705_10057521 | 3300025909 | Bacteria | 2805 |
| 98 | Ga0207695_10055696 | 3300025913 | Bacteria | 4118 |
| 99 | Ga0207657_10031128 | 3300025919 | Bacteria | 4837 |
| 100 | Ga0207649_10000359 | 3300025920 | Bacteria | 34180 |
| 101 | Ga0207681_10006956 | 3300025923 | Bacteria | 6940 |
| 102 | Ga0207650_10000587 | 3300025925 | Bacteria | 29198 |
| 103 | Ga0207659_10000861 | 3300025926 | Bacteria | 18018 |
| 104 | Ga0207659_10045359 | 3300025926 | Bacteria | 3099 |
| 105 | Ga0207687_10217197 | 3300025927 | Bacteria | 1503 |
| 106 | Ga0207644_10003548 | 3300025931 | Bacteria | 10097 |
| 107 | Ga0207690_10032846 | 3300025932 | Bacteria | 3333 |
| 108 | Ga0207706_10337016 | 3300025933 | Bacteria | 1312 |
| 109 | Ga0207686_10068367 | 3300025934 | Bacteria | 2275 |
| 110 | Ga0207669_10014392 | 3300025937 | Bacteria | 3963 |
| 111 | Ga0207691_10001498 | 3300025940 | Bacteria | 23269 |
| 112 | Ga0207691_10012265 | 3300025940 | Bacteria | 8216 |
| 113 | Ga0207689_10021340 | 3300025942 | Bacteria | 5446 |
| 114 | Ga0207689_10146780 | 3300025942 | Bacteria | 1943 |
| 115 | Ga0207679_10000047 | 3300025945 | Bacteria | 119891 |
| 116 | Ga0207679_10057235 | 3300025945 | Bacteria | 2883 |
| 117 | Ga0207679_10143355 | 3300025945 | Bacteria | 1934 |
| 118 | Ga0207651_10128944 | 3300025960 | Bacteria | 1932 |
| 119 | Ga0207651_10203714 | 3300025960 | Bacteria | 1587 |
| 120 | Ga0207677_10007714 | 3300026023 | Bacteria | 5974 |
| 121 | Ga0207641_10296695 | 3300026088 | Bacteria | 1525 |
| 122 | Ga0207648_10002295 | 3300026089 | Bacteria | 20666 |
| 123 | Ga0207648_10016286 | 3300026089 | Bacteria | 6799 |
| 124 | Ga0207648_10386650 | 3300026089 | Bacteria | 1266 |
| 125 | Ga0207676_10008533 | 3300026095 | Bacteria | 7285 |
| 126 | Ga0207674_10013681 | 3300026116 | Bacteria | 8989 |
| 127 | Ga0207675_100010326 | 3300026118 | Bacteria | 8750 |
| 128 | Ga0207683_10016480 | 3300026121 | Bacteria | 6290 |
| 129 | Ga0207698_10047770 | 3300026142 | Bacteria | 3245 |
| 130 | Ga0209389_1010922 | 3300027296 | Bacteria | 8209 |
| 131 | Ga0209974_10002346 | 3300027876 | Bacteria | 6865 |
| 132 | Ga0265334_10035761 | 3300028573 | Bacteria | 1964 |
| 133 | Ga0265336_10000014 | 3300028666 | Bacteria | 241247 |
| 134 | Ga0307515_10000080 | 3300028794 | Bacteria | 224941 |
| 135 | Ga0307515_10000180 | 3300028794 | Bacteria | 156173 |
| 136 | Ga0307515_10353889 | 3300028794 | Bacteria | 1113 |
| 137 | Ga0265324_10001016 | 3300029957 | Bacteria | 17236 |
| 138 | Ga0307513_10002929 | 3300031456 | Bacteria | 23340 |
| 139 | Ga0307408_100047450 | 3300031548 | Bacteria | 3076 |
| 140 | Ga0307516_10000703 | 3300031730 | Bacteria | 45501 |
| 141 | Ga0307516_10005049 | 3300031730 | Bacteria | 15969 |
| 142 | Ga0307413_10206077 | 3300031824 | Bacteria | 1424 |
| 143 | Ga0307410_10065696 | 3300031852 | Bacteria | 2496 |
| 144 | Ga0307416_100052857 | 3300032002 | Bacteria | 3255 |
| 145 | Ga0307510_10232483 | 3300033180 | Bacteria | 1345 |
| 146 | Ga0373949_0023952 | 3300035090 | Bacteria | 1417 |
| 147 | Ga0373939_0000020 | 3300035114 | Bacteria | 58845 |
| 148 | Ga0373962_0001815 | 3300035242 | Bacteria | 5084 |
| 149 | Ga0373924_0003422 | 3300035410 | Bacteria | 5458 |
| 150 | Ga0373931_0003316 | 3300035691 | Bacteria | 7209 |
| 151 | Ga0395898_0008966 | 3300037466 | Bacteria | 10534 |
| 152 | Ga0395905_0005105 | 3300037471 | Bacteria | 13488 |
| 153 | Ga0395905_0007759 | 3300037471 | Bacteria | 10644 |
| 154 | Ga0395905_0104993 | 3300037471 | Bacteria | 2652 |
| 155 | Ga0395901_0013549 | 3300038443 | Bacteria | 8291 |
| 156 | Ga0436361_0265063 | 3300039447 | Bacteria | 36678 |
| 157 | Ga0436361_0410668 | 3300039447 | Bacteria | 27008 |
| 158 | Ga0436361_0487065 | 3300039447 | Bacteria | 63556 |
| 159 | Ga0451798_0065902 | 3300041458 | Bacteria | 1155 |
| 160 | Ga0439437_001346 | 3300042000 | Bacteria | 2585 |
| 161 | Ga0450917_000469 | 3300042120 | Bacteria | 3038 |
| 162 | Ga0450888_000188 | 3300042126 | Bacteria | 5445 |
| 163 | Ga0450891_000311 | 3300042129 | Bacteria | 4980 |
| 164 | Ga0450892_001152 | 3300042130 | Bacteria | 2740 |
| 165 | Ga0439459_0001105 | 3300042438 | Bacteria | 3883 |
| 166 | Ga0450893_0004106 | 3300042532 | Bacteria | 2315 |
| 167 | Ga0450901_002870 | 3300042533 | Bacteria | 1826 |
| 168 | Ga0451577_0000641 | 3300042876 | Bacteria | 55722 |
| 169 | Ga0451577_0397001 | 3300042876 | Bacteria | 1251 |
| 170 | Ga0466969_0002402 | 3300044656 | Bacteria | 10011 |
| 171 | Ga0466965_0008277 | 3300044683 | Bacteria | 4807 |
| 172 | Ga0466965_0029760 | 3300044683 | Bacteria | 2658 |
| 173 | Ga0466966_0015553 | 3300044684 | Bacteria | 5029 |
| 174 | Ga0466961_0031737 | 3300044693 | Bacteria | 3396 |
| 175 | Ga0466961_0038701 | 3300044693 | Bacteria | 3059 |
| 176 | Ga0466963_0018259 | 3300044694 | Bacteria | 4381 |
| 177 | Ga0466964_0010454 | 3300044706 | Bacteria | 3501 |
| 178 | Ga0453684_0001818 | 3300044712 | Bacteria | 56168 |
| 179 | Ga0453684_0096058 | 3300044712 | Bacteria | 3642 |
| 180 | Ga0466957_0005225 | 3300044842 | Bacteria | 7266 |
| 181 | Ga0466959_0038837 | 3300045049 | Bacteria | 3517 |
| 182 | Ga0466959_0063012 | 3300045049 | Bacteria | 2693 |
| 183 | Ga0451576_0002104 | 3300045051 | Bacteria | 31012 |
| 184 | Ga0466958_0271915 | 3300045836 | Bacteria | 1085 |
| 185 | Ga0495638_0083310 | 3300046460 | Bacteria | 1938 |
| 186 | Ga0495639_0011435 | 3300046475 | Bacteria | 3827 |
| 187 | Ga0495628_0339511 | 3300046516 | Bacteria | 1106 |
| 188 | Ga0495652_0199839 | 3300046529 | Bacteria | 1518 |
| 189 | Ga0496104_0319570 | 3300048907 | Bacteria | 1465 |
| 190 | Ga0496109_0181619 | 3300048912 | Bacteria | 1976 |
| 191 | Ga0496118_0171960 | 3300048921 | Bacteria | 1322 |
| 192 | Ga0496121_0058475 | 3300048924 | Bacteria | 3187 |
| 193 | Ga0496124_0000596 | 3300048927 | Bacteria | 60853 |
| 194 | Ga0496124_0017997 | 3300048927 | Bacteria | 6638 |
| 195 | Ga0496125_0026833 | 3300048928 | Bacteria | 5234 |
| 196 | Ga0501309_004486 | 3300049129 | Bacteria | 1629 |
| 197 | Ga0501310_002319 | 3300049130 | Bacteria | 1799 |
| 198 | Ga0501298_011893 | 3300049521 | Bacteria | 1519 |
| 199 | Ga0501034_0024845 | 3300049571 | Bacteria | 6096 |
| 200 | Ga0501036_0305779 | 3300049572 | Bacteria | 1330 |
| 201 | Ga0501043_0000020 | 3300049579 | Bacteria | 155270 |
| 202 | Ga0501046_0000039 | 3300049580 | Bacteria | 155237 |
| 203 | Ga0501047_0000028 | 3300049581 | Bacteria | 220279 |
| 204 | Ga0501048_0042394 | 3300049582 | Bacteria | 3259 |
| 205 | Ga0501198_000001 | 3300049649 | Bacteria | 234552 |
| 206 | Ga0501222_000013 | 3300049662 | Bacteria | 87490 |
| 207 | Ga0501222_007944 | 3300049662 | Bacteria | 1412 |
| 208 | Ga0501252_007034 | 3300049682 | Bacteria | 1266 |
| 209 | Ga0501221_002898 | 3300049704 | Bacteria | 2827 |
| 210 | Ga0501035_0016072 | 3300049822 | Bacteria | 6906 |
| 211 | Ga0501035_0103460 | 3300049822 | Bacteria | 2498 |
| 212 | Ga0501044_0304709 | 3300049823 | Bacteria | 1521 |
| 213 | Ga0501045_0003924 | 3300049824 | Bacteria | 10247 |
| 214 | Ga0501226_003354 | 3300049853 | Bacteria | 1902 |
| 215 | nmdc:mga0k408_1297_c2 | 3300050493 | Bacteria | 9516 |
| 216 | nmdc:mga07m45_269_c2 | 3300050496 | Bacteria | 19075 |
| 217 | nmdc:mga09592_2859_c1 | 3300050508 | Bacteria | 14008 |
| 218 | Ga0500635_0000074 | 3300053080 | Bacteria | 64642 |
| 219 | Ga0500619_000045 | 3300053154 | Bacteria | 38384 |
| 220 | Ga0500622_0004664 | 3300053156 | Bacteria | 8479 |
| 221 | Ga0466962_0026872 | 3300061719 | Bacteria | 2763 |
| 222 | Ga0466962_0033544 | 3300061719 | Bacteria | 2456 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053154 | Ga0500619_000045 | Ga0500619_000045_3296_4282 | 264 |
| 2 | 3300049649 | Ga0501198_000001 | Ga0501198_000001_158874_159875 | 268 |
| 3 | 3300049662 | Ga0501222_000013 | Ga0501222_000013_11838_12839 | 268 |
| 4 | 3300006846 | Ga0075430_100037022 | Ga0075430_1000370222 | 270 |
| 5 | 3300006880 | Ga0075429_100002479 | Ga0075429_1000024795 | 270 |
| 6 | 3300050508 | nmdc:mga09592_2859_c1 | nmdc:mga09592_2859_c1_3796_4803 | 270 |
| 7 | 3300005616 | Ga0068852_100144242 | Ga0068852_1001442423 | 275 |
| 8 | 3300026142 | Ga0207698_10047770 | Ga0207698_100477703 | 275 |
| 9 | 3300041458 | Ga0451798_0065902 | Ga0451798_0065902_301_1134 | 276 |
| 10 | 3300028794 | Ga0307515_10000080 | Ga0307515_10000080183 | 281 |
| 11 | 3300032002 | Ga0307416_100052857 | Ga0307416_1000528574 | 284 |
| 12 | 3300049662 | Ga0501222_007944 | Ga0501222_007944_235_1266 | 284 |
| 13 | 3300044712 | Ga0453684_0096058 | Ga0453684_0096058_1287_2276 | 285 |
| 14 | 3300049129 | Ga0501309_004486 | Ga0501309_004486_20_1018 | 285 |
| 15 | 3300049130 | Ga0501310_002319 | Ga0501310_002319_533_1531 | 285 |
| 16 | 3300049521 | Ga0501298_011893 | Ga0501298_011893_69_1067 | 285 |
| 17 | 3300049682 | Ga0501252_007034 | Ga0501252_007034_62_1060 | 285 |
| 18 | 3300049704 | Ga0501221_002898 | Ga0501221_002898_147_1145 | 285 |
| 19 | 3300049853 | Ga0501226_003354 | Ga0501226_003354_816_1814 | 285 |
| 20 | 3300021361 | Ga0213872_10031504 | Ga0213872_100315044 | 289 |
| 21 | 3300049572 | Ga0501036_0305779 | Ga0501036_0305779_67_1050 | 289 |
| 22 | 3300003316 | rootH1_10027106 | rootH1_100271067 | 290 |
| 23 | 3300005262 | Ga0065165_1000942 | Ga0065165_100094229 | 290 |
| 24 | 3300005457 | Ga0070662_100297526 | Ga0070662_1002975261 | 290 |
| 25 | 3300021361 | Ga0213872_10000339 | Ga0213872_1000033916 | 290 |
| 26 | 3300025933 | Ga0207706_10337016 | Ga0207706_103370161 | 290 |
| 27 | 3300025945 | Ga0207679_10057235 | Ga0207679_100572351 | 290 |
| 28 | 3300039447 | Ga0436361_0410668 | Ga0436361_0410668_21061_22038 | 291 |
| 29 | 3300049822 | Ga0501035_0103460 | Ga0501035_0103460_194_1117 | 291 |
| 30 | 3300045836 | Ga0466958_0271915 | Ga0466958_0271915_194_1075 | 292 |
| 31 | 3300005843 | Ga0068860_100048804 | Ga0068860_1000488045 | 297 |
| 32 | 3300005331 | Ga0070670_100067230 | Ga0070670_1000672304 | 298 |
| 33 | 3300005354 | Ga0070675_100030521 | Ga0070675_1000305214 | 298 |
| 34 | 3300005459 | Ga0068867_100004166 | Ga0068867_1000041669 | 298 |
| 35 | 3300005543 | Ga0070672_100002031 | Ga0070672_10000203113 | 298 |
| 36 | 3300025908 | Ga0207643_10066795 | Ga0207643_100667953 | 298 |
| 37 | 3300025926 | Ga0207659_10045359 | Ga0207659_100453592 | 298 |
| 38 | 3300025927 | Ga0207687_10217197 | Ga0207687_102171971 | 298 |
| 39 | 3300025940 | Ga0207691_10012265 | Ga0207691_100122654 | 298 |
| 40 | 3300025942 | Ga0207689_10146780 | Ga0207689_101467802 | 298 |
| 41 | 3300026089 | Ga0207648_10002295 | Ga0207648_100022959 | 298 |
| 42 | 3300026116 | Ga0207674_10013681 | Ga0207674_100136815 | 298 |
| 43 | 3300005564 | Ga0070664_100418584 | Ga0070664_1004185842 | 299 |
| 44 | 3300042876 | Ga0451577_0000641 | Ga0451577_0000641_14538_15497 | 299 |
| 45 | 3300044712 | Ga0453684_0001818 | Ga0453684_0001818_40672_41631 | 299 |
| 46 | 3300003323 | rootH1_10034501 | rootH1_100345018 | 300 |
| 47 | 3300003759 | Ga0055525_1000004 | Ga0055525_1000004474 | 301 |
| 48 | 3300025230 | Ga0209563_100013 | Ga0209563_100013474 | 301 |
| 49 | 3300009098 | Ga0105245_10331195 | Ga0105245_103311951 | 304 |
| 50 | 3300031824 | Ga0307413_10206077 | Ga0307413_102060772 | 304 |
| 51 | 3300031852 | Ga0307410_10065696 | Ga0307410_100656962 | 304 |
| 52 | 3300037471 | Ga0395905_0007759 | Ga0395905_0007759_3964_4965 | 304 |
| 53 | 3300037471 | Ga0395905_0005105 | Ga0395905_0005105_3518_4516 | 305 |
| 54 | 3300045051 | Ga0451576_0002104 | Ga0451576_0002104_26512_27471 | 305 |
| 55 | 3300039447 | Ga0436361_0265063 | Ga0436361_0265063_4580_5611 | 306 |
| 56 | 3300033180 | Ga0307510_10232483 | Ga0307510_102324832 | 307 |
| 57 | 3300005328 | Ga0070676_10018035 | Ga0070676_100180352 | 309 |
| 58 | 3300005331 | Ga0070670_100008956 | Ga0070670_1000089566 | 309 |
| 59 | 3300005333 | Ga0070677_10001953 | Ga0070677_100019533 | 309 |
| 60 | 3300005338 | Ga0068868_100012907 | Ga0068868_1000129076 | 309 |
| 61 | 3300005354 | Ga0070675_100001865 | Ga0070675_10000186510 | 309 |
| 62 | 3300005355 | Ga0070671_100006074 | Ga0070671_1000060745 | 309 |
| 63 | 3300005356 | Ga0070674_100014647 | Ga0070674_1000146475 | 309 |
| 64 | 3300005364 | Ga0070673_100216726 | Ga0070673_1002167262 | 309 |
| 65 | 3300005456 | Ga0070678_100048121 | Ga0070678_1000481212 | 309 |
| 66 | 3300005459 | Ga0068867_100008603 | Ga0068867_1000086038 | 309 |
| 67 | 3300005543 | Ga0070672_100001038 | Ga0070672_1000010388 | 309 |
| 68 | 3300005616 | Ga0068852_100089938 | Ga0068852_1000899384 | 309 |
| 69 | 3300005618 | Ga0068864_100023041 | Ga0068864_1000230413 | 309 |
| 70 | 3300005840 | Ga0068870_10033670 | Ga0068870_100336702 | 309 |
| 71 | 3300005841 | Ga0068863_100254423 | Ga0068863_1002544232 | 309 |
| 72 | 3300006358 | Ga0068871_100079080 | Ga0068871_1000790802 | 309 |
| 73 | 3300013306 | Ga0163162_10117079 | Ga0163162_101170794 | 309 |
| 74 | 3300017792 | Ga0163161_10016764 | Ga0163161_100167645 | 309 |
| 75 | 3300025315 | Ga0207697_10009261 | Ga0207697_100092612 | 309 |
| 76 | 3300025321 | Ga0207656_10022645 | Ga0207656_100226453 | 309 |
| 77 | 3300025893 | Ga0207682_10001757 | Ga0207682_100017575 | 309 |
| 78 | 3300025923 | Ga0207681_10006956 | Ga0207681_100069565 | 309 |
| 79 | 3300025925 | Ga0207650_10000587 | Ga0207650_1000058730 | 309 |
| 80 | 3300025926 | Ga0207659_10000861 | Ga0207659_1000086114 | 309 |
| 81 | 3300025931 | Ga0207644_10003548 | Ga0207644_100035485 | 309 |
| 82 | 3300025937 | Ga0207669_10014392 | Ga0207669_100143924 | 309 |
| 83 | 3300025940 | Ga0207691_10001498 | Ga0207691_1000149813 | 309 |
| 84 | 3300025945 | Ga0207679_10143355 | Ga0207679_101433551 | 309 |
| 85 | 3300025960 | Ga0207651_10203714 | Ga0207651_102037142 | 309 |
| 86 | 3300026023 | Ga0207677_10007714 | Ga0207677_100077145 | 309 |
| 87 | 3300026088 | Ga0207641_10296695 | Ga0207641_102966952 | 309 |
| 88 | 3300026089 | Ga0207648_10016286 | Ga0207648_100162865 | 309 |
| 89 | 3300026095 | Ga0207676_10008533 | Ga0207676_100085333 | 309 |
| 90 | 3300026121 | Ga0207683_10016480 | Ga0207683_100164805 | 309 |
| 91 | 3300028794 | Ga0307515_10000180 | Ga0307515_1000018051 | 309 |
| 92 | 3300035410 | Ga0373924_0003422 | Ga0373924_0003422_1099_2040 | 309 |
| 93 | 3300046516 | Ga0495628_0339511 | Ga0495628_0339511_118_1059 | 309 |
| 94 | 3300049571 | Ga0501034_0024845 | Ga0501034_0024845_3789_4742 | 309 |
| 95 | iso_pu_bacteria | 2919704043 | 2919707230 | 309 |
| 96 | 3300021361 | Ga0213872_10001347 | Ga0213872_100013474 | 310 |
| 97 | 3300039447 | Ga0436361_0487065 | Ga0436361_0487065_32908_33903 | 310 |
| 98 | 3300044683 | Ga0466965_0008277 | Ga0466965_0008277_833_1870 | 310 |
| 99 | 3300044693 | Ga0466961_0038701 | Ga0466961_0038701_1482_2519 | 310 |
| 100 | 3300045049 | Ga0466959_0063012 | Ga0466959_0063012_1370_2407 | 310 |
| 101 | 3300049822 | Ga0501035_0016072 | Ga0501035_0016072_492_1475 | 310 |
| 102 | 3300061719 | Ga0466962_0033544 | Ga0466962_0033544_833_1870 | 310 |
| 103 | 3300003316 | rootH1_10009114 | rootH1_100091141 | 311 |
| 104 | 3300003794 | Ga0055531_10011106 | Ga0055531_100111064 | 311 |
| 105 | 3300012497 | Ga0157319_1000008 | Ga0157319_1000008258 | 311 |
| 106 | 3300025304 | Ga0209257_1000756 | Ga0209257_10007565 | 311 |
| 107 | 3300031456 | Ga0307513_10002929 | Ga0307513_100029294 | 311 |
| 108 | 3300042000 | Ga0439437_001346 | Ga0439437_001346_595_1590 | 311 |
| 109 | 3300042120 | Ga0450917_000469 | Ga0450917_000469_1909_2904 | 311 |
| 110 | 3300042126 | Ga0450888_000188 | Ga0450888_000188_4239_5234 | 311 |
| 111 | 3300042129 | Ga0450891_000311 | Ga0450891_000311_2217_3212 | 311 |
| 112 | 3300042130 | Ga0450892_001152 | Ga0450892_001152_914_1909 | 311 |
| 113 | 3300042532 | Ga0450893_0004106 | Ga0450893_0004106_981_1976 | 311 |
| 114 | 3300042533 | Ga0450901_002870 | Ga0450901_002870_219_1214 | 311 |
| 115 | iso_pu_bacteria | 2738541337 | 2739058915 | 311 |
| 116 | iso_pu_bacteria | 2839138175 | 2839142368 | 311 |
| 117 | 3300005467 | Ga0070706_100409261 | Ga0070706_1004092611 | 312 |
| 118 | 3300006195 | Ga0075366_10006382 | Ga0075366_100063824 | 312 |
| 119 | 3300027876 | Ga0209974_10002346 | Ga0209974_100023465 | 312 |
| 120 | 3300048921 | Ga0496118_0171960 | Ga0496118_0171960_124_1128 | 312 |
| 121 | 3300048924 | Ga0496121_0058475 | Ga0496121_0058475_1629_2633 | 312 |
| 122 | 3300048927 | Ga0496124_0000596 | Ga0496124_0000596_46973_47968 | 312 |
| 123 | 3300048928 | Ga0496125_0026833 | Ga0496125_0026833_3314_4309 | 312 |
| 124 | 3300050493 | nmdc:mga0k408_1297_c2 | nmdc:mga0k408_1297_c2_4141_5151 | 312 |
| 125 | iso_pu_bacteria | 2643221544 | 2643744978 | 312 |
| 126 | iso_pu_bacteria | 2643221639 | 2644222828 | 312 |
| 127 | iso_pu_bacteria | 2643221646 | 2644260701 | 312 |
| 128 | 3300004625 | Ga0055543_1018316 | Ga0055543_10183161 | 313 |
| 129 | 3300005262 | Ga0065165_1000016 | Ga0065165_100001646 | 313 |
| 130 | 3300006353 | Ga0075370_10111718 | Ga0075370_101117182 | 313 |
| 131 | 3300042876 | Ga0451577_0397001 | Ga0451577_0397001_172_1188 | 313 |
| 132 | 3300048907 | Ga0496104_0319570 | Ga0496104_0319570_85_1146 | 313 |
| 133 | iso_pu_bacteria | 2643221654 | 2644302866 | 313 |
| 134 | 3300003775 | Ga0055524_1000311 | Ga0055524_10003115 | 314 |
| 135 | 3300005344 | Ga0070661_100016478 | Ga0070661_1000164783 | 314 |
| 136 | 3300005364 | Ga0070673_100169263 | Ga0070673_1001692632 | 314 |
| 137 | 3300005366 | Ga0070659_100000701 | Ga0070659_10000070117 | 314 |
| 138 | 3300006353 | Ga0075370_10017759 | Ga0075370_100177594 | 314 |
| 139 | 3300025299 | Ga0209256_1000616 | Ga0209256_100061642 | 314 |
| 140 | 3300025920 | Ga0207649_10000359 | Ga0207649_1000035933 | 314 |
| 141 | 3300025932 | Ga0207690_10032846 | Ga0207690_100328462 | 314 |
| 142 | 3300025945 | Ga0207679_10000047 | Ga0207679_1000004731 | 314 |
| 143 | 3300025960 | Ga0207651_10128944 | Ga0207651_101289442 | 314 |
| 144 | 3300045049 | Ga0466959_0038837 | Ga0466959_0038837_1077_2123 | 314 |
| 145 | iso_pu_bacteria | 2831864461 | 2831869277 | 314 |
| 146 | iso_pu_bacteria | 2886848708 | 2886854306 | 314 |
| 147 | 3300003322 | rootL2_10001664 | rootL2_100016645 | 315 |
| 148 | 3300025298 | Ga0209050_1003136 | Ga0209050_10031368 | 315 |
| 149 | 3300025303 | Ga0209051_1005227 | Ga0209051_10052275 | 315 |
| 150 | 3300025304 | Ga0209257_1002915 | Ga0209257_10029154 | 315 |
| 151 | 3300035090 | Ga0373949_0023952 | Ga0373949_0023952_22_1014 | 315 |
| 152 | 3300035114 | Ga0373939_0000020 | Ga0373939_0000020_22708_23700 | 315 |
| 153 | 3300035242 | Ga0373962_0001815 | Ga0373962_0001815_2432_3424 | 315 |
| 154 | 3300035691 | Ga0373931_0003316 | Ga0373931_0003316_3041_4033 | 315 |
| 155 | 3300044656 | Ga0466969_0002402 | Ga0466969_0002402_2178_3224 | 315 |
| 156 | 3300044683 | Ga0466965_0029760 | Ga0466965_0029760_180_1226 | 315 |
| 157 | 3300044684 | Ga0466966_0015553 | Ga0466966_0015553_1318_2364 | 315 |
| 158 | 3300044693 | Ga0466961_0031737 | Ga0466961_0031737_1759_2805 | 315 |
| 159 | 3300044706 | Ga0466964_0010454 | Ga0466964_0010454_2358_3404 | 315 |
| 160 | 3300044842 | Ga0466957_0005225 | Ga0466957_0005225_2806_3852 | 315 |
| 161 | 3300046460 | Ga0495638_0083310 | Ga0495638_0083310_513_1592 | 315 |
| 162 | 3300061719 | Ga0466962_0026872 | Ga0466962_0026872_91_1137 | 315 |
| 163 | 3300005339 | Ga0070660_100021543 | Ga0070660_1000215434 | 316 |
| 164 | 3300009148 | Ga0105243_10020922 | Ga0105243_100209223 | 316 |
| 165 | 3300025298 | Ga0209050_1002388 | Ga0209050_100238815 | 316 |
| 166 | 3300025303 | Ga0209051_1007206 | Ga0209051_10072062 | 316 |
| 167 | 3300025304 | Ga0209257_1000021 | Ga0209257_100002198 | 316 |
| 168 | 3300031548 | Ga0307408_100047450 | Ga0307408_1000474502 | 316 |
| 169 | 3300031730 | Ga0307516_10005049 | Ga0307516_1000504914 | 316 |
| 170 | 3300042438 | Ga0439459_0001105 | Ga0439459_0001105_618_1691 | 316 |
| 171 | 3300044694 | Ga0466963_0018259 | Ga0466963_0018259_2055_3101 | 316 |
| 172 | 3300003320 | rootH2_10016099 | rootH2_100160996 | 317 |
| 173 | 3300005327 | Ga0070658_10012596 | Ga0070658_100125964 | 317 |
| 174 | 3300025909 | Ga0207705_10057521 | Ga0207705_100575214 | 317 |
| 175 | 3300025919 | Ga0207657_10031128 | Ga0207657_100311284 | 317 |
| 176 | 3300028794 | Ga0307515_10353889 | Ga0307515_103538891 | 317 |
| 177 | 3300037471 | Ga0395905_0104993 | Ga0395905_0104993_10_1116 | 317 |
| 178 | 3300049579 | Ga0501043_0000020 | Ga0501043_0000020_31844_32854 | 317 |
| 179 | 3300049580 | Ga0501046_0000039 | Ga0501046_0000039_31882_32892 | 317 |
| 180 | 3300049581 | Ga0501047_0000028 | Ga0501047_0000028_31856_32866 | 317 |
| 181 | 3300049582 | Ga0501048_0042394 | Ga0501048_0042394_1011_2021 | 317 |
| 182 | 3300049823 | Ga0501044_0304709 | Ga0501044_0304709_323_1333 | 317 |
| 183 | 3300049824 | Ga0501045_0003924 | Ga0501045_0003924_5663_6673 | 317 |
| 184 | 3300003763 | Ga0055529_1000219 | Ga0055529_100021910 | 318 |
| 185 | 3300003771 | Ga0055526_1004642 | Ga0055526_10046425 | 318 |
| 186 | 3300003775 | Ga0055524_1025015 | Ga0055524_10250152 | 318 |
| 187 | 3300006353 | Ga0075370_10053927 | Ga0075370_100539272 | 318 |
| 188 | 3300006944 | Ga0099823_1000021 | Ga0099823_100002120 | 318 |
| 189 | 3300009176 | Ga0105242_10001240 | Ga0105242_100012408 | 318 |
| 190 | 3300025228 | Ga0209672_103954 | Ga0209672_1039542 | 318 |
| 191 | 3300025242 | Ga0209258_100072 | Ga0209258_10007242 | 318 |
| 192 | 3300025253 | Ga0209677_105283 | Ga0209677_1052834 | 318 |
| 193 | 3300025256 | Ga0209759_1001834 | Ga0209759_10018347 | 318 |
| 194 | 3300025272 | Ga0209455_1000053 | Ga0209455_1000053122 | 318 |
| 195 | 3300025295 | Ga0209564_1000008 | Ga0209564_1000008507 | 318 |
| 196 | 3300025299 | Ga0209256_1001395 | Ga0209256_100139518 | 318 |
| 197 | 3300025303 | Ga0209051_1001254 | Ga0209051_100125415 | 318 |
| 198 | 3300025934 | Ga0207686_10068367 | Ga0207686_100683672 | 318 |
| 199 | 3300027296 | Ga0209389_1010922 | Ga0209389_10109227 | 318 |
| 200 | 3300037466 | Ga0395898_0008966 | Ga0395898_0008966_4539_5606 | 318 |
| 201 | 3300038443 | Ga0395901_0013549 | Ga0395901_0013549_1257_2324 | 318 |
| 202 | 3300048912 | Ga0496109_0181619 | Ga0496109_0181619_107_1186 | 318 |
| 203 | 3300048927 | Ga0496124_0017997 | Ga0496124_0017997_2409_3446 | 318 |
| 204 | 3300050496 | nmdc:mga07m45_269_c2 | nmdc:mga07m45_269_c2_3991_5040 | 318 |
| 205 | 3300053156 | Ga0500622_0004664 | Ga0500622_0004664_3246_4325 | 318 |
| 206 | 3300002772 | JGI25164J39214_1002826 | JGI25164J39214_10028262 | 319 |
| 207 | 3300003323 | rootH1_10006143 | rootH1_1000614320 | 319 |
| 208 | 3300025231 | Ga0207427_100662 | Ga0207427_1006628 | 319 |
| 209 | 3300025913 | Ga0207695_10055696 | Ga0207695_100556964 | 319 |
| 210 | 3300028573 | Ga0265334_10035761 | Ga0265334_100357612 | 319 |
| 211 | 3300028666 | Ga0265336_10000014 | Ga0265336_10000014149 | 319 |
| 212 | 3300029957 | Ga0265324_10001016 | Ga0265324_100010165 | 319 |
| 213 | 3300031730 | Ga0307516_10000703 | Ga0307516_1000070337 | 319 |
| 214 | 3300046475 | Ga0495639_0011435 | Ga0495639_0011435_670_1707 | 319 |
| 215 | 3300046529 | Ga0495652_0199839 | Ga0495652_0199839_365_1402 | 319 |
| 216 | 3300053080 | Ga0500635_0000074 | Ga0500635_0000074_18510_19553 | 319 |
| 217 | 3300003752 | Ga0055539_1000689 | Ga0055539_10006894 | 320 |
| 218 | 3300003756 | Ga0055533_1000053 | Ga0055533_100005367 | 320 |
| 219 | 3300003759 | Ga0055525_1000613 | Ga0055525_10006135 | 320 |
| 220 | 3300005330 | Ga0070690_100027032 | Ga0070690_1000270322 | 320 |
| 221 | 3300005334 | Ga0068869_100045588 | Ga0068869_1000455884 | 320 |
| 222 | 3300009176 | Ga0105242_10054416 | Ga0105242_100544163 | 320 |
| 223 | 3300025226 | Ga0209674_100039 | Ga0209674_100039125 | 320 |
| 224 | 3300025230 | Ga0209563_100080 | Ga0209563_100080125 | 320 |
| 225 | 3300025253 | Ga0209677_100130 | Ga0209677_10013056 | 320 |
| 226 | 3300025256 | Ga0209759_1002774 | Ga0209759_10027746 | 320 |
| 227 | 3300025256 | Ga0209759_1010054 | Ga0209759_10100542 | 320 |
| 228 | 3300025942 | Ga0207689_10021340 | Ga0207689_100213402 | 320 |
| 229 | 3300026089 | Ga0207648_10386650 | Ga0207648_103866502 | 320 |
| 230 | 3300026118 | Ga0207675_100010326 | Ga0207675_1000103266 | 320 |
| 231 | 3300002705 | JGI25156J39149_1017323 | JGI25156J39149_10173231 | 326 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hln-assembly2.cif.gz_T | crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds | 0.8134 | 80 | 275 |
| 4emm-assembly1.cif.gz_C | crystal structure of staphylococcus aureus clpp in compact conformation | 0.8057 | 80 | 276 |
| 6dkf-assembly1.cif.gz_B | caseinolytic protease (clpp) from staphylococcus aureus mutant - v7a | 0.8031 | 80 | 275 |
| 7vp9-assembly1.cif.gz_L | crystal structure of human clpp in complex with zg111 | 0.7984 | 80 | 272 |
| 8i7x-assembly1.cif.gz_L | crystal structure of human clpp in complex with zg36 | 0.7978 | 80 | 272 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kwbC01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8382 | 75 | 300 | 3.90.226.10 |
| 3bezC03 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.7999 | 72 | 295 | 3.90.226.10 |
| 4kwbC01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.7914 | 75 | 300 | 3.90.226.10 |
| af_Q3UVV9_921_1089_3.40.50.410 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain | 0.7895 | 98 | 151 | 3.40.50.410 |
| 3bezC03 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.7817 | 72 | 295 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L7SA79-F1-model_v4 | S49 family peptidase | 0.902 | 71 | 177 |
GO:0006508
GO:0008233 |
| AF-A0A061NA95-F1-model_v4 | Protease IV | 0.8933 | 72 | 173 |
GO:0006508
GO:0008233 |
| AF-A0A2M7YYF2-F1-model_v4 | Signal peptide peptidase SppA | 0.879 | 71 | 170 |
GO:0006508
GO:0008236 |
| AF-A0A6L7SA79-F1-model_v4 | S49 family peptidase | 0.8351 | 71 | 177 |
GO:0006508
GO:0008233 |
| AF-A0A1B6NVY5-F1-model_v4 | Signal peptide peptidase SppA, 36K type | 0.8261 | 52 | 185 |
GO:0006508
GO:0008236 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar