F344416

General Info

Members Datasets Scaffolds Average Seq Length
231 181 222 321

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0319570|Ga0496104_0319570_85_1146
Length 323
Sequence MTDPQDFQPTQQAQPDPRLEHVVAQVTGELIRDRRNERRWRLFGRIAWFALAVAVVWGLVAQRGHVNAPSGPHTALIEVRGEIAEDQEANAENIVSALRSAFEDKNAQGVVLRFNSPGGSPVQSGIVNDEIKRLRKLHPTKKVYAVCEEMCASGAYYMAVAADEIYVDKASIVGSIGVLMDGFGFTGLMEKAGVERRLITAGSNKGMLDPFSPMTDKQRSYAQAMIDQIHNQFITVVKEGRGQRLHETPDTFSGLFWTGQEAVDQGLADHLGNLDYVAREVIKAEDVIDYTLQENVAERLAKRFGASVGAGAVRALQAPTLPR

Samples

Sample ID Description Type Environment
1 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
2 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
3 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
4 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
5 2738541337 Pelomonas sp. BT06 Isolate Unclassified
6 2831864461 Roseateles noduli HZ7 Isolate Nodule
7 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
8 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
9 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
10 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
106 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
108 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
119 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
120 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
128 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
129 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
130 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
131 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
132 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
133 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
134 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
135 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
168 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
169 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
170 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
179 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
180 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.24
Metatranscriptomes 0.87
Isolates 3.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.18
Nodule 1.3
Rhizoplane 1.3
Rhizosphere 67.1
Stem 0
Stem Tuber 0
Unclassified 12.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1017323 3300002705 Bacteria 1367
2 JGI25164J39214_1002826 3300002772 Bacteria 2435
3 rootH1_10009114 3300003316 Bacteria 1473
4 rootH1_10027106 3300003316 Bacteria 6706
5 rootH2_10016099 3300003320 Bacteria 4138
6 rootL2_10001664 3300003322 Bacteria 70373
7 rootH1_10006143 3300003323 Bacteria 26652
8 rootH1_10034501 3300003323 Bacteria 5762
9 Ga0055539_1000689 3300003752 Bacteria 8764
10 Ga0055533_1000053 3300003756 Bacteria 199478
11 Ga0055525_1000004 3300003759 Bacteria 888039
12 Ga0055525_1000613 3300003759 Bacteria 14860
13 Ga0055529_1000219 3300003763 Bacteria 74582
14 Ga0055526_1004642 3300003771 Bacteria 8170
15 Ga0055524_1000311 3300003775 Bacteria 46317
16 Ga0055524_1025015 3300003775 Bacteria 1879
17 Ga0055531_10011106 3300003794 Bacteria 4391
18 Ga0055543_1018316 3300004625 Bacteria 1308
19 Ga0065165_1000016 3300005262 Bacteria 286248
20 Ga0065165_1000942 3300005262 Bacteria 37104
21 Ga0070658_10012596 3300005327 Bacteria 6784
22 Ga0070676_10018035 3300005328 Bacteria 3909
23 Ga0070690_100027032 3300005330 Bacteria 3544
24 Ga0070670_100008956 3300005331 Bacteria 8549
25 Ga0070670_100067230 3300005331 Bacteria 3076
26 Ga0070677_10001953 3300005333 Bacteria 6538
27 Ga0068869_100045588 3300005334 Bacteria 3157
28 Ga0068868_100012907 3300005338 Bacteria 6113
29 Ga0070660_100021543 3300005339 Bacteria 4755
30 Ga0070661_100016478 3300005344 Bacteria 5226
31 Ga0070675_100001865 3300005354 Bacteria 15533
32 Ga0070675_100030521 3300005354 Bacteria 4352
33 Ga0070671_100006074 3300005355 Bacteria 9625
34 Ga0070674_100014647 3300005356 Bacteria 4878
35 Ga0070673_100169263 3300005364 Bacteria 1864
36 Ga0070673_100216726 3300005364 Bacteria 1655
37 Ga0070659_100000701 3300005366 Bacteria 24367
38 Ga0070678_100048121 3300005456 Bacteria 3068
39 Ga0070662_100297526 3300005457 Bacteria 1310
40 Ga0068867_100004166 3300005459 Bacteria 10173
41 Ga0068867_100008603 3300005459 Bacteria 7206
42 Ga0070706_100409261 3300005467 Bacteria 1263
43 Ga0070672_100001038 3300005543 Bacteria 16915
44 Ga0070672_100002031 3300005543 Bacteria 12729
45 Ga0070664_100418584 3300005564 Bacteria 1227
46 Ga0068852_100089938 3300005616 Bacteria 2744
47 Ga0068852_100144242 3300005616 Bacteria 2207
48 Ga0068864_100023041 3300005618 Bacteria 5227
49 Ga0068870_10033670 3300005840 Bacteria 2616
50 Ga0068863_100254423 3300005841 Bacteria 1697
51 Ga0068860_100048804 3300005843 Bacteria 4034
52 Ga0075366_10006382 3300006195 Bacteria 6459
53 Ga0075370_10017759 3300006353 Bacteria 3848
54 Ga0075370_10053927 3300006353 Bacteria 2282
55 Ga0075370_10111718 3300006353 Bacteria 1587
56 Ga0068871_100079080 3300006358 Bacteria 2720
57 Ga0075430_100037022 3300006846 Bacteria 4136
58 Ga0075429_100002479 3300006880 Bacteria 15530
59 Ga0099823_1000021 3300006944 Bacteria 76133
60 Ga0105245_10331195 3300009098 Bacteria 1503
61 Ga0105243_10020922 3300009148 Bacteria 4964
62 Ga0105242_10001240 3300009176 Bacteria 20102
63 Ga0105242_10054416 3300009176 Bacteria 3271
64 Ga0157319_1000008 3300012497 Bacteria 315600
65 Ga0163162_10117079 3300013306 Bacteria 2766
66 Ga0163161_10016764 3300017792 Bacteria 5120
67 Ga0213872_10000339 3300021361 Bacteria 39618
68 Ga0213872_10001347 3300021361 Bacteria 16224
69 Ga0213872_10031504 3300021361 Bacteria 2431
70 Ga0209674_100039 3300025226 Bacteria 402292
71 Ga0209672_103954 3300025228 Bacteria 2890
72 Ga0209563_100013 3300025230 Bacteria 941463
73 Ga0209563_100080 3300025230 Bacteria 199504
74 Ga0207427_100662 3300025231 Bacteria 16501
75 Ga0209258_100072 3300025242 Bacteria 274355
76 Ga0209677_100130 3300025253 Bacteria 72879
77 Ga0209677_105283 3300025253 Bacteria 3415
78 Ga0209759_1001834 3300025256 Bacteria 10650
79 Ga0209759_1002774 3300025256 Bacteria 7419
80 Ga0209759_1010054 3300025256 Bacteria 2805
81 Ga0209455_1000053 3300025272 Bacteria 365949
82 Ga0209564_1000008 3300025295 Bacteria 953227
83 Ga0209050_1002388 3300025298 Bacteria 16298
84 Ga0209050_1003136 3300025298 Bacteria 12623
85 Ga0209256_1000616 3300025299 Bacteria 49183
86 Ga0209256_1001395 3300025299 Bacteria 25179
87 Ga0209051_1001254 3300025303 Bacteria 22688
88 Ga0209051_1005227 3300025303 Bacteria 7665
89 Ga0209051_1007206 3300025303 Bacteria 6116
90 Ga0209257_1000021 3300025304 Bacteria 771986
91 Ga0209257_1000756 3300025304 Bacteria 48782
92 Ga0209257_1002915 3300025304 Bacteria 15775
93 Ga0207697_10009261 3300025315 Bacteria 4260
94 Ga0207656_10022645 3300025321 Bacteria 2523
95 Ga0207682_10001757 3300025893 Bacteria 9947
96 Ga0207643_10066795 3300025908 Bacteria 2063
97 Ga0207705_10057521 3300025909 Bacteria 2805
98 Ga0207695_10055696 3300025913 Bacteria 4118
99 Ga0207657_10031128 3300025919 Bacteria 4837
100 Ga0207649_10000359 3300025920 Bacteria 34180
101 Ga0207681_10006956 3300025923 Bacteria 6940
102 Ga0207650_10000587 3300025925 Bacteria 29198
103 Ga0207659_10000861 3300025926 Bacteria 18018
104 Ga0207659_10045359 3300025926 Bacteria 3099
105 Ga0207687_10217197 3300025927 Bacteria 1503
106 Ga0207644_10003548 3300025931 Bacteria 10097
107 Ga0207690_10032846 3300025932 Bacteria 3333
108 Ga0207706_10337016 3300025933 Bacteria 1312
109 Ga0207686_10068367 3300025934 Bacteria 2275
110 Ga0207669_10014392 3300025937 Bacteria 3963
111 Ga0207691_10001498 3300025940 Bacteria 23269
112 Ga0207691_10012265 3300025940 Bacteria 8216
113 Ga0207689_10021340 3300025942 Bacteria 5446
114 Ga0207689_10146780 3300025942 Bacteria 1943
115 Ga0207679_10000047 3300025945 Bacteria 119891
116 Ga0207679_10057235 3300025945 Bacteria 2883
117 Ga0207679_10143355 3300025945 Bacteria 1934
118 Ga0207651_10128944 3300025960 Bacteria 1932
119 Ga0207651_10203714 3300025960 Bacteria 1587
120 Ga0207677_10007714 3300026023 Bacteria 5974
121 Ga0207641_10296695 3300026088 Bacteria 1525
122 Ga0207648_10002295 3300026089 Bacteria 20666
123 Ga0207648_10016286 3300026089 Bacteria 6799
124 Ga0207648_10386650 3300026089 Bacteria 1266
125 Ga0207676_10008533 3300026095 Bacteria 7285
126 Ga0207674_10013681 3300026116 Bacteria 8989
127 Ga0207675_100010326 3300026118 Bacteria 8750
128 Ga0207683_10016480 3300026121 Bacteria 6290
129 Ga0207698_10047770 3300026142 Bacteria 3245
130 Ga0209389_1010922 3300027296 Bacteria 8209
131 Ga0209974_10002346 3300027876 Bacteria 6865
132 Ga0265334_10035761 3300028573 Bacteria 1964
133 Ga0265336_10000014 3300028666 Bacteria 241247
134 Ga0307515_10000080 3300028794 Bacteria 224941
135 Ga0307515_10000180 3300028794 Bacteria 156173
136 Ga0307515_10353889 3300028794 Bacteria 1113
137 Ga0265324_10001016 3300029957 Bacteria 17236
138 Ga0307513_10002929 3300031456 Bacteria 23340
139 Ga0307408_100047450 3300031548 Bacteria 3076
140 Ga0307516_10000703 3300031730 Bacteria 45501
141 Ga0307516_10005049 3300031730 Bacteria 15969
142 Ga0307413_10206077 3300031824 Bacteria 1424
143 Ga0307410_10065696 3300031852 Bacteria 2496
144 Ga0307416_100052857 3300032002 Bacteria 3255
145 Ga0307510_10232483 3300033180 Bacteria 1345
146 Ga0373949_0023952 3300035090 Bacteria 1417
147 Ga0373939_0000020 3300035114 Bacteria 58845
148 Ga0373962_0001815 3300035242 Bacteria 5084
149 Ga0373924_0003422 3300035410 Bacteria 5458
150 Ga0373931_0003316 3300035691 Bacteria 7209
151 Ga0395898_0008966 3300037466 Bacteria 10534
152 Ga0395905_0005105 3300037471 Bacteria 13488
153 Ga0395905_0007759 3300037471 Bacteria 10644
154 Ga0395905_0104993 3300037471 Bacteria 2652
155 Ga0395901_0013549 3300038443 Bacteria 8291
156 Ga0436361_0265063 3300039447 Bacteria 36678
157 Ga0436361_0410668 3300039447 Bacteria 27008
158 Ga0436361_0487065 3300039447 Bacteria 63556
159 Ga0451798_0065902 3300041458 Bacteria 1155
160 Ga0439437_001346 3300042000 Bacteria 2585
161 Ga0450917_000469 3300042120 Bacteria 3038
162 Ga0450888_000188 3300042126 Bacteria 5445
163 Ga0450891_000311 3300042129 Bacteria 4980
164 Ga0450892_001152 3300042130 Bacteria 2740
165 Ga0439459_0001105 3300042438 Bacteria 3883
166 Ga0450893_0004106 3300042532 Bacteria 2315
167 Ga0450901_002870 3300042533 Bacteria 1826
168 Ga0451577_0000641 3300042876 Bacteria 55722
169 Ga0451577_0397001 3300042876 Bacteria 1251
170 Ga0466969_0002402 3300044656 Bacteria 10011
171 Ga0466965_0008277 3300044683 Bacteria 4807
172 Ga0466965_0029760 3300044683 Bacteria 2658
173 Ga0466966_0015553 3300044684 Bacteria 5029
174 Ga0466961_0031737 3300044693 Bacteria 3396
175 Ga0466961_0038701 3300044693 Bacteria 3059
176 Ga0466963_0018259 3300044694 Bacteria 4381
177 Ga0466964_0010454 3300044706 Bacteria 3501
178 Ga0453684_0001818 3300044712 Bacteria 56168
179 Ga0453684_0096058 3300044712 Bacteria 3642
180 Ga0466957_0005225 3300044842 Bacteria 7266
181 Ga0466959_0038837 3300045049 Bacteria 3517
182 Ga0466959_0063012 3300045049 Bacteria 2693
183 Ga0451576_0002104 3300045051 Bacteria 31012
184 Ga0466958_0271915 3300045836 Bacteria 1085
185 Ga0495638_0083310 3300046460 Bacteria 1938
186 Ga0495639_0011435 3300046475 Bacteria 3827
187 Ga0495628_0339511 3300046516 Bacteria 1106
188 Ga0495652_0199839 3300046529 Bacteria 1518
189 Ga0496104_0319570 3300048907 Bacteria 1465
190 Ga0496109_0181619 3300048912 Bacteria 1976
191 Ga0496118_0171960 3300048921 Bacteria 1322
192 Ga0496121_0058475 3300048924 Bacteria 3187
193 Ga0496124_0000596 3300048927 Bacteria 60853
194 Ga0496124_0017997 3300048927 Bacteria 6638
195 Ga0496125_0026833 3300048928 Bacteria 5234
196 Ga0501309_004486 3300049129 Bacteria 1629
197 Ga0501310_002319 3300049130 Bacteria 1799
198 Ga0501298_011893 3300049521 Bacteria 1519
199 Ga0501034_0024845 3300049571 Bacteria 6096
200 Ga0501036_0305779 3300049572 Bacteria 1330
201 Ga0501043_0000020 3300049579 Bacteria 155270
202 Ga0501046_0000039 3300049580 Bacteria 155237
203 Ga0501047_0000028 3300049581 Bacteria 220279
204 Ga0501048_0042394 3300049582 Bacteria 3259
205 Ga0501198_000001 3300049649 Bacteria 234552
206 Ga0501222_000013 3300049662 Bacteria 87490
207 Ga0501222_007944 3300049662 Bacteria 1412
208 Ga0501252_007034 3300049682 Bacteria 1266
209 Ga0501221_002898 3300049704 Bacteria 2827
210 Ga0501035_0016072 3300049822 Bacteria 6906
211 Ga0501035_0103460 3300049822 Bacteria 2498
212 Ga0501044_0304709 3300049823 Bacteria 1521
213 Ga0501045_0003924 3300049824 Bacteria 10247
214 Ga0501226_003354 3300049853 Bacteria 1902
215 nmdc:mga0k408_1297_c2 3300050493 Bacteria 9516
216 nmdc:mga07m45_269_c2 3300050496 Bacteria 19075
217 nmdc:mga09592_2859_c1 3300050508 Bacteria 14008
218 Ga0500635_0000074 3300053080 Bacteria 64642
219 Ga0500619_000045 3300053154 Bacteria 38384
220 Ga0500622_0004664 3300053156 Bacteria 8479
221 Ga0466962_0026872 3300061719 Bacteria 2763
222 Ga0466962_0033544 3300061719 Bacteria 2456

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053154 Ga0500619_000045 Ga0500619_000045_3296_4282 264
2 3300049649 Ga0501198_000001 Ga0501198_000001_158874_159875 268
3 3300049662 Ga0501222_000013 Ga0501222_000013_11838_12839 268
4 3300006846 Ga0075430_100037022 Ga0075430_1000370222 270
5 3300006880 Ga0075429_100002479 Ga0075429_1000024795 270
6 3300050508 nmdc:mga09592_2859_c1 nmdc:mga09592_2859_c1_3796_4803 270
7 3300005616 Ga0068852_100144242 Ga0068852_1001442423 275
8 3300026142 Ga0207698_10047770 Ga0207698_100477703 275
9 3300041458 Ga0451798_0065902 Ga0451798_0065902_301_1134 276
10 3300028794 Ga0307515_10000080 Ga0307515_10000080183 281
11 3300032002 Ga0307416_100052857 Ga0307416_1000528574 284
12 3300049662 Ga0501222_007944 Ga0501222_007944_235_1266 284
13 3300044712 Ga0453684_0096058 Ga0453684_0096058_1287_2276 285
14 3300049129 Ga0501309_004486 Ga0501309_004486_20_1018 285
15 3300049130 Ga0501310_002319 Ga0501310_002319_533_1531 285
16 3300049521 Ga0501298_011893 Ga0501298_011893_69_1067 285
17 3300049682 Ga0501252_007034 Ga0501252_007034_62_1060 285
18 3300049704 Ga0501221_002898 Ga0501221_002898_147_1145 285
19 3300049853 Ga0501226_003354 Ga0501226_003354_816_1814 285
20 3300021361 Ga0213872_10031504 Ga0213872_100315044 289
21 3300049572 Ga0501036_0305779 Ga0501036_0305779_67_1050 289
22 3300003316 rootH1_10027106 rootH1_100271067 290
23 3300005262 Ga0065165_1000942 Ga0065165_100094229 290
24 3300005457 Ga0070662_100297526 Ga0070662_1002975261 290
25 3300021361 Ga0213872_10000339 Ga0213872_1000033916 290
26 3300025933 Ga0207706_10337016 Ga0207706_103370161 290
27 3300025945 Ga0207679_10057235 Ga0207679_100572351 290
28 3300039447 Ga0436361_0410668 Ga0436361_0410668_21061_22038 291
29 3300049822 Ga0501035_0103460 Ga0501035_0103460_194_1117 291
30 3300045836 Ga0466958_0271915 Ga0466958_0271915_194_1075 292
31 3300005843 Ga0068860_100048804 Ga0068860_1000488045 297
32 3300005331 Ga0070670_100067230 Ga0070670_1000672304 298
33 3300005354 Ga0070675_100030521 Ga0070675_1000305214 298
34 3300005459 Ga0068867_100004166 Ga0068867_1000041669 298
35 3300005543 Ga0070672_100002031 Ga0070672_10000203113 298
36 3300025908 Ga0207643_10066795 Ga0207643_100667953 298
37 3300025926 Ga0207659_10045359 Ga0207659_100453592 298
38 3300025927 Ga0207687_10217197 Ga0207687_102171971 298
39 3300025940 Ga0207691_10012265 Ga0207691_100122654 298
40 3300025942 Ga0207689_10146780 Ga0207689_101467802 298
41 3300026089 Ga0207648_10002295 Ga0207648_100022959 298
42 3300026116 Ga0207674_10013681 Ga0207674_100136815 298
43 3300005564 Ga0070664_100418584 Ga0070664_1004185842 299
44 3300042876 Ga0451577_0000641 Ga0451577_0000641_14538_15497 299
45 3300044712 Ga0453684_0001818 Ga0453684_0001818_40672_41631 299
46 3300003323 rootH1_10034501 rootH1_100345018 300
47 3300003759 Ga0055525_1000004 Ga0055525_1000004474 301
48 3300025230 Ga0209563_100013 Ga0209563_100013474 301
49 3300009098 Ga0105245_10331195 Ga0105245_103311951 304
50 3300031824 Ga0307413_10206077 Ga0307413_102060772 304
51 3300031852 Ga0307410_10065696 Ga0307410_100656962 304
52 3300037471 Ga0395905_0007759 Ga0395905_0007759_3964_4965 304
53 3300037471 Ga0395905_0005105 Ga0395905_0005105_3518_4516 305
54 3300045051 Ga0451576_0002104 Ga0451576_0002104_26512_27471 305
55 3300039447 Ga0436361_0265063 Ga0436361_0265063_4580_5611 306
56 3300033180 Ga0307510_10232483 Ga0307510_102324832 307
57 3300005328 Ga0070676_10018035 Ga0070676_100180352 309
58 3300005331 Ga0070670_100008956 Ga0070670_1000089566 309
59 3300005333 Ga0070677_10001953 Ga0070677_100019533 309
60 3300005338 Ga0068868_100012907 Ga0068868_1000129076 309
61 3300005354 Ga0070675_100001865 Ga0070675_10000186510 309
62 3300005355 Ga0070671_100006074 Ga0070671_1000060745 309
63 3300005356 Ga0070674_100014647 Ga0070674_1000146475 309
64 3300005364 Ga0070673_100216726 Ga0070673_1002167262 309
65 3300005456 Ga0070678_100048121 Ga0070678_1000481212 309
66 3300005459 Ga0068867_100008603 Ga0068867_1000086038 309
67 3300005543 Ga0070672_100001038 Ga0070672_1000010388 309
68 3300005616 Ga0068852_100089938 Ga0068852_1000899384 309
69 3300005618 Ga0068864_100023041 Ga0068864_1000230413 309
70 3300005840 Ga0068870_10033670 Ga0068870_100336702 309
71 3300005841 Ga0068863_100254423 Ga0068863_1002544232 309
72 3300006358 Ga0068871_100079080 Ga0068871_1000790802 309
73 3300013306 Ga0163162_10117079 Ga0163162_101170794 309
74 3300017792 Ga0163161_10016764 Ga0163161_100167645 309
75 3300025315 Ga0207697_10009261 Ga0207697_100092612 309
76 3300025321 Ga0207656_10022645 Ga0207656_100226453 309
77 3300025893 Ga0207682_10001757 Ga0207682_100017575 309
78 3300025923 Ga0207681_10006956 Ga0207681_100069565 309
79 3300025925 Ga0207650_10000587 Ga0207650_1000058730 309
80 3300025926 Ga0207659_10000861 Ga0207659_1000086114 309
81 3300025931 Ga0207644_10003548 Ga0207644_100035485 309
82 3300025937 Ga0207669_10014392 Ga0207669_100143924 309
83 3300025940 Ga0207691_10001498 Ga0207691_1000149813 309
84 3300025945 Ga0207679_10143355 Ga0207679_101433551 309
85 3300025960 Ga0207651_10203714 Ga0207651_102037142 309
86 3300026023 Ga0207677_10007714 Ga0207677_100077145 309
87 3300026088 Ga0207641_10296695 Ga0207641_102966952 309
88 3300026089 Ga0207648_10016286 Ga0207648_100162865 309
89 3300026095 Ga0207676_10008533 Ga0207676_100085333 309
90 3300026121 Ga0207683_10016480 Ga0207683_100164805 309
91 3300028794 Ga0307515_10000180 Ga0307515_1000018051 309
92 3300035410 Ga0373924_0003422 Ga0373924_0003422_1099_2040 309
93 3300046516 Ga0495628_0339511 Ga0495628_0339511_118_1059 309
94 3300049571 Ga0501034_0024845 Ga0501034_0024845_3789_4742 309
95 iso_pu_bacteria 2919704043 2919707230 309
96 3300021361 Ga0213872_10001347 Ga0213872_100013474 310
97 3300039447 Ga0436361_0487065 Ga0436361_0487065_32908_33903 310
98 3300044683 Ga0466965_0008277 Ga0466965_0008277_833_1870 310
99 3300044693 Ga0466961_0038701 Ga0466961_0038701_1482_2519 310
100 3300045049 Ga0466959_0063012 Ga0466959_0063012_1370_2407 310
101 3300049822 Ga0501035_0016072 Ga0501035_0016072_492_1475 310
102 3300061719 Ga0466962_0033544 Ga0466962_0033544_833_1870 310
103 3300003316 rootH1_10009114 rootH1_100091141 311
104 3300003794 Ga0055531_10011106 Ga0055531_100111064 311
105 3300012497 Ga0157319_1000008 Ga0157319_1000008258 311
106 3300025304 Ga0209257_1000756 Ga0209257_10007565 311
107 3300031456 Ga0307513_10002929 Ga0307513_100029294 311
108 3300042000 Ga0439437_001346 Ga0439437_001346_595_1590 311
109 3300042120 Ga0450917_000469 Ga0450917_000469_1909_2904 311
110 3300042126 Ga0450888_000188 Ga0450888_000188_4239_5234 311
111 3300042129 Ga0450891_000311 Ga0450891_000311_2217_3212 311
112 3300042130 Ga0450892_001152 Ga0450892_001152_914_1909 311
113 3300042532 Ga0450893_0004106 Ga0450893_0004106_981_1976 311
114 3300042533 Ga0450901_002870 Ga0450901_002870_219_1214 311
115 iso_pu_bacteria 2738541337 2739058915 311
116 iso_pu_bacteria 2839138175 2839142368 311
117 3300005467 Ga0070706_100409261 Ga0070706_1004092611 312
118 3300006195 Ga0075366_10006382 Ga0075366_100063824 312
119 3300027876 Ga0209974_10002346 Ga0209974_100023465 312
120 3300048921 Ga0496118_0171960 Ga0496118_0171960_124_1128 312
121 3300048924 Ga0496121_0058475 Ga0496121_0058475_1629_2633 312
122 3300048927 Ga0496124_0000596 Ga0496124_0000596_46973_47968 312
123 3300048928 Ga0496125_0026833 Ga0496125_0026833_3314_4309 312
124 3300050493 nmdc:mga0k408_1297_c2 nmdc:mga0k408_1297_c2_4141_5151 312
125 iso_pu_bacteria 2643221544 2643744978 312
126 iso_pu_bacteria 2643221639 2644222828 312
127 iso_pu_bacteria 2643221646 2644260701 312
128 3300004625 Ga0055543_1018316 Ga0055543_10183161 313
129 3300005262 Ga0065165_1000016 Ga0065165_100001646 313
130 3300006353 Ga0075370_10111718 Ga0075370_101117182 313
131 3300042876 Ga0451577_0397001 Ga0451577_0397001_172_1188 313
132 3300048907 Ga0496104_0319570 Ga0496104_0319570_85_1146 313
133 iso_pu_bacteria 2643221654 2644302866 313
134 3300003775 Ga0055524_1000311 Ga0055524_10003115 314
135 3300005344 Ga0070661_100016478 Ga0070661_1000164783 314
136 3300005364 Ga0070673_100169263 Ga0070673_1001692632 314
137 3300005366 Ga0070659_100000701 Ga0070659_10000070117 314
138 3300006353 Ga0075370_10017759 Ga0075370_100177594 314
139 3300025299 Ga0209256_1000616 Ga0209256_100061642 314
140 3300025920 Ga0207649_10000359 Ga0207649_1000035933 314
141 3300025932 Ga0207690_10032846 Ga0207690_100328462 314
142 3300025945 Ga0207679_10000047 Ga0207679_1000004731 314
143 3300025960 Ga0207651_10128944 Ga0207651_101289442 314
144 3300045049 Ga0466959_0038837 Ga0466959_0038837_1077_2123 314
145 iso_pu_bacteria 2831864461 2831869277 314
146 iso_pu_bacteria 2886848708 2886854306 314
147 3300003322 rootL2_10001664 rootL2_100016645 315
148 3300025298 Ga0209050_1003136 Ga0209050_10031368 315
149 3300025303 Ga0209051_1005227 Ga0209051_10052275 315
150 3300025304 Ga0209257_1002915 Ga0209257_10029154 315
151 3300035090 Ga0373949_0023952 Ga0373949_0023952_22_1014 315
152 3300035114 Ga0373939_0000020 Ga0373939_0000020_22708_23700 315
153 3300035242 Ga0373962_0001815 Ga0373962_0001815_2432_3424 315
154 3300035691 Ga0373931_0003316 Ga0373931_0003316_3041_4033 315
155 3300044656 Ga0466969_0002402 Ga0466969_0002402_2178_3224 315
156 3300044683 Ga0466965_0029760 Ga0466965_0029760_180_1226 315
157 3300044684 Ga0466966_0015553 Ga0466966_0015553_1318_2364 315
158 3300044693 Ga0466961_0031737 Ga0466961_0031737_1759_2805 315
159 3300044706 Ga0466964_0010454 Ga0466964_0010454_2358_3404 315
160 3300044842 Ga0466957_0005225 Ga0466957_0005225_2806_3852 315
161 3300046460 Ga0495638_0083310 Ga0495638_0083310_513_1592 315
162 3300061719 Ga0466962_0026872 Ga0466962_0026872_91_1137 315
163 3300005339 Ga0070660_100021543 Ga0070660_1000215434 316
164 3300009148 Ga0105243_10020922 Ga0105243_100209223 316
165 3300025298 Ga0209050_1002388 Ga0209050_100238815 316
166 3300025303 Ga0209051_1007206 Ga0209051_10072062 316
167 3300025304 Ga0209257_1000021 Ga0209257_100002198 316
168 3300031548 Ga0307408_100047450 Ga0307408_1000474502 316
169 3300031730 Ga0307516_10005049 Ga0307516_1000504914 316
170 3300042438 Ga0439459_0001105 Ga0439459_0001105_618_1691 316
171 3300044694 Ga0466963_0018259 Ga0466963_0018259_2055_3101 316
172 3300003320 rootH2_10016099 rootH2_100160996 317
173 3300005327 Ga0070658_10012596 Ga0070658_100125964 317
174 3300025909 Ga0207705_10057521 Ga0207705_100575214 317
175 3300025919 Ga0207657_10031128 Ga0207657_100311284 317
176 3300028794 Ga0307515_10353889 Ga0307515_103538891 317
177 3300037471 Ga0395905_0104993 Ga0395905_0104993_10_1116 317
178 3300049579 Ga0501043_0000020 Ga0501043_0000020_31844_32854 317
179 3300049580 Ga0501046_0000039 Ga0501046_0000039_31882_32892 317
180 3300049581 Ga0501047_0000028 Ga0501047_0000028_31856_32866 317
181 3300049582 Ga0501048_0042394 Ga0501048_0042394_1011_2021 317
182 3300049823 Ga0501044_0304709 Ga0501044_0304709_323_1333 317
183 3300049824 Ga0501045_0003924 Ga0501045_0003924_5663_6673 317
184 3300003763 Ga0055529_1000219 Ga0055529_100021910 318
185 3300003771 Ga0055526_1004642 Ga0055526_10046425 318
186 3300003775 Ga0055524_1025015 Ga0055524_10250152 318
187 3300006353 Ga0075370_10053927 Ga0075370_100539272 318
188 3300006944 Ga0099823_1000021 Ga0099823_100002120 318
189 3300009176 Ga0105242_10001240 Ga0105242_100012408 318
190 3300025228 Ga0209672_103954 Ga0209672_1039542 318
191 3300025242 Ga0209258_100072 Ga0209258_10007242 318
192 3300025253 Ga0209677_105283 Ga0209677_1052834 318
193 3300025256 Ga0209759_1001834 Ga0209759_10018347 318
194 3300025272 Ga0209455_1000053 Ga0209455_1000053122 318
195 3300025295 Ga0209564_1000008 Ga0209564_1000008507 318
196 3300025299 Ga0209256_1001395 Ga0209256_100139518 318
197 3300025303 Ga0209051_1001254 Ga0209051_100125415 318
198 3300025934 Ga0207686_10068367 Ga0207686_100683672 318
199 3300027296 Ga0209389_1010922 Ga0209389_10109227 318
200 3300037466 Ga0395898_0008966 Ga0395898_0008966_4539_5606 318
201 3300038443 Ga0395901_0013549 Ga0395901_0013549_1257_2324 318
202 3300048912 Ga0496109_0181619 Ga0496109_0181619_107_1186 318
203 3300048927 Ga0496124_0017997 Ga0496124_0017997_2409_3446 318
204 3300050496 nmdc:mga07m45_269_c2 nmdc:mga07m45_269_c2_3991_5040 318
205 3300053156 Ga0500622_0004664 Ga0500622_0004664_3246_4325 318
206 3300002772 JGI25164J39214_1002826 JGI25164J39214_10028262 319
207 3300003323 rootH1_10006143 rootH1_1000614320 319
208 3300025231 Ga0207427_100662 Ga0207427_1006628 319
209 3300025913 Ga0207695_10055696 Ga0207695_100556964 319
210 3300028573 Ga0265334_10035761 Ga0265334_100357612 319
211 3300028666 Ga0265336_10000014 Ga0265336_10000014149 319
212 3300029957 Ga0265324_10001016 Ga0265324_100010165 319
213 3300031730 Ga0307516_10000703 Ga0307516_1000070337 319
214 3300046475 Ga0495639_0011435 Ga0495639_0011435_670_1707 319
215 3300046529 Ga0495652_0199839 Ga0495652_0199839_365_1402 319
216 3300053080 Ga0500635_0000074 Ga0500635_0000074_18510_19553 319
217 3300003752 Ga0055539_1000689 Ga0055539_10006894 320
218 3300003756 Ga0055533_1000053 Ga0055533_100005367 320
219 3300003759 Ga0055525_1000613 Ga0055525_10006135 320
220 3300005330 Ga0070690_100027032 Ga0070690_1000270322 320
221 3300005334 Ga0068869_100045588 Ga0068869_1000455884 320
222 3300009176 Ga0105242_10054416 Ga0105242_100544163 320
223 3300025226 Ga0209674_100039 Ga0209674_100039125 320
224 3300025230 Ga0209563_100080 Ga0209563_100080125 320
225 3300025253 Ga0209677_100130 Ga0209677_10013056 320
226 3300025256 Ga0209759_1002774 Ga0209759_10027746 320
227 3300025256 Ga0209759_1010054 Ga0209759_10100542 320
228 3300025942 Ga0207689_10021340 Ga0207689_100213402 320
229 3300026089 Ga0207648_10386650 Ga0207648_103866502 320
230 3300026118 Ga0207675_100010326 Ga0207675_1000103266 320
231 3300002705 JGI25156J39149_1017323 JGI25156J39149_10173231 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01343

Peptidase_S49

Peptidase family S49

135

288

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hln-assembly2.cif.gz_T crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds 0.8134 80 275
4emm-assembly1.cif.gz_C crystal structure of staphylococcus aureus clpp in compact conformation 0.8057 80 276
6dkf-assembly1.cif.gz_B caseinolytic protease (clpp) from staphylococcus aureus mutant - v7a 0.8031 80 275
7vp9-assembly1.cif.gz_L crystal structure of human clpp in complex with zg111 0.7984 80 272
8i7x-assembly1.cif.gz_L crystal structure of human clpp in complex with zg36 0.7978 80 272
ID Description Score Start End Superfamily
4kwbC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8382 75 300 3.90.226.10
3bezC03 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7999 72 295 3.90.226.10
4kwbC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7914 75 300 3.90.226.10
af_Q3UVV9_921_1089_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7895 98 151 3.40.50.410
3bezC03 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7817 72 295 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A6L7SA79-F1-model_v4 S49 family peptidase 0.902 71 177 GO:0006508
GO:0008233
AF-A0A061NA95-F1-model_v4 Protease IV 0.8933 72 173 GO:0006508
GO:0008233
AF-A0A2M7YYF2-F1-model_v4 Signal peptide peptidase SppA 0.879 71 170 GO:0006508
GO:0008236
AF-A0A6L7SA79-F1-model_v4 S49 family peptidase 0.8351 71 177 GO:0006508
GO:0008233
AF-A0A1B6NVY5-F1-model_v4 Signal peptide peptidase SppA, 36K type 0.8261 52 185 GO:0006508
GO:0008236

Feature Viewer

pLDDT pTM Quality
74.66 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map