F342102

General Info

Members Datasets Scaffolds Average Seq Length
229 178 458 321

Family's Representative Sequence

Representative Sequence 3300025934|Ga0207686_10006061|Ga0207686_100060612
Length 375
Sequence MTSVSQTPYYSLQFLKSEEIYFNRSPRSFLARAAHVVSMVAWESLENMAKSVANGFIWFSNSGSPLKKEGRVVIIGSGPAGYTAAIYLARAGLKPLVLQGLYSGGQLMTTHEVENFPGFPEGIQGPEFMQRLEKQAERFGAEMMCDQALKVDLSRYPYRIETQNGPVEASAIILSTGASANRLEVPGTRDGELWQKGVSACAVCDGSLPVFRNKTIFVIGGGDTAMEEALYLSKFASKVNIVHRRNQLRASHAMVQKVLENPKINILYDREVIQVKGEKFIEAIIVKNKLTNQNESYQAGGLFFAISHKPNTAFLRSQLEVDASGYVRVSRGTSETSAPGVFACGDVQDSHYRQAITAAGSGCAAALDAERWLRS

Samples

Sample ID Description Type Environment
1 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
97 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
98 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
106 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
109 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
110 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
111 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
162 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
163 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
166 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
167 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
168 2643221561 Nocardioides sp. Root151 Isolate Unclassified
169 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
170 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
171 2643221696 Nocardioides sp. Root140 Isolate Unclassified
172 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
173 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
174 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
175 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
176 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
177 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
178 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.28
Metatranscriptomes 10.04
Isolates 5.68

Biome Distribution

Category Percentage (%)
Aerial Root 0.87
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 6.55
Rhizosphere 87.34
Stem 0
Stem Tuber 0
Unclassified 0.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207686_10006061 3300025934 Bacteria 6491
2 Ga0006778J45830_1007436 3300003162 Bacteria 1587
3 Ga0006759J45824_1001904 3300003163 Bacteria 2660
4 Ga0006770J48903_1002137 3300003305 Bacteria 1944
5 Ga0006777J48905_1002308 3300003308 Bacteria 2301
6 Ga0007417J51691_1014759 3300003544 Bacteria 1570
7 Ga0007427J51700_102324 3300003559 Bacteria 1723
8 Ga0006781J51513_1001674 3300003568 Bacteria 2238
9 Ga0007410J51695_1002649 3300003574 Bacteria 1624
10 Ga0007410J51695_1009047 3300003574 Bacteria 1535
11 Ga0007410J51695_1016571 3300003574 Bacteria 1387
12 Ga0007409J51694_1007675 3300003575 Bacteria 1567
13 Ga0007416J51690_1003502 3300003577 Bacteria 1697
14 Ga0007429J51699_1020058 3300003579 Bacteria 1327
15 Ga0007411J51799_101708 3300003611 Bacteria 2178
16 Ga0007415J51800_103035 3300003613 Bacteria 1985
17 Ga0006780_1001792 3300003735 Bacteria 1959
18 Ga0070658_10058404 3300005327 Bacteria 3140
19 Ga0070683_100021860 3300005329 Bacteria 5711
20 Ga0070683_100060771 3300005329 Bacteria 3512
21 Ga0070689_100042759 3300005340 Bacteria 3479
22 Ga0070661_100290157 3300005344 Bacteria 1271
23 Ga0070714_100049474 3300005435 Bacteria 3578
24 Ga0070713_100002538 3300005436 Bacteria 11938
25 Ga0070713_100011268 3300005436 Bacteria 6504
26 Ga0070662_100030920 3300005457 Bacteria 3752
27 Ga0070681_10000295 3300005458 Bacteria 40358
28 Ga0070679_100045719 3300005530 Bacteria 4363
29 Ga0070684_100090648 3300005535 Bacteria 2719
30 Ga0070697_100021371 3300005536 Bacteria 5128
31 Ga0068855_100000372 3300005563 Bacteria 55390
32 Ga0068857_100003071 3300005577 Bacteria 13809
33 Ga0068854_100011299 3300005578 Bacteria 5807
34 Ga0068856_100001547 3300005614 Bacteria 24068
35 Ga0068856_100487446 3300005614 Bacteria 1254
36 Ga0068852_100599339 3300005616 Bacteria 1106
37 Ga0068861_100103848 3300005719 Bacteria 2266
38 Ga0068863_100008118 3300005841 Bacteria 10247
39 Ga0068858_100024371 3300005842 Bacteria 5638
40 Ga0081455_10001865 3300005937 Bacteria 25366
41 Ga0081538_10000703 3300005981 Bacteria 36689
42 Ga0070712_100026477 3300006175 Bacteria 3863
43 Ga0097621_100003888 3300006237 Bacteria 10353
44 Ga0075370_10028398 3300006353 Bacteria 3110
45 Ga0068871_100002106 3300006358 Bacteria 13465
46 Ga0075428_100003220 3300006844 Bacteria 17860
47 Ga0075430_100036087 3300006846 Bacteria 4192
48 Ga0075431_100002560 3300006847 Bacteria 17550
49 Ga0075431_100065312 3300006847 Bacteria 3758
50 Ga0075429_100001964 3300006880 Bacteria 17081
51 Ga0075429_100071685 3300006880 Bacteria 3017
52 Ga0105240_10030622 3300009093 Bacteria 6992
53 Ga0105240_10180455 3300009093 Bacteria 2492
54 Ga0111539_10045218 3300009094 Bacteria 5271
55 Ga0111539_10265174 3300009094 Bacteria 1999
56 Ga0105245_10085737 3300009098 Bacteria 2887
57 Ga0105245_10172675 3300009098 Bacteria 2059
58 Ga0114129_10004806 3300009147 Bacteria 19096
59 Ga0105242_10185089 3300009176 Unclassified 1840
60 Ga0105248_10047955 3300009177 Bacteria 4790
61 Ga0105237_10010453 3300009545 Bacteria 9870
62 Ga0105238_10000073 3300009551 Bacteria 112101
63 Ga0105239_10117738 3300010375 Bacteria 2948
64 Ga0157371_10056338 3300013102 Bacteria 2788
65 Ga0157371_10213586 3300013102 Bacteria 1385
66 Ga0157370_10078216 3300013104 Bacteria 3115
67 Ga0157369_10000122 3300013105 Bacteria 110862
68 Ga0157369_10060311 3300013105 Bacteria 4091
69 Ga0157374_10000326 3300013296 Bacteria 44006
70 Ga0157374_10004254 3300013296 Bacteria 12038
71 Ga0157378_10008513 3300013297 Bacteria 8930
72 Ga0157372_10000982 3300013307 Bacteria 31143
73 Ga0157372_10003987 3300013307 Bacteria 15850
74 Ga0157372_10005450 3300013307 Bacteria 13523
75 Ga0157372_10017047 3300013307 Bacteria 7798
76 Ga0157375_10050263 3300013308 Bacteria 4089
77 Ga0163163_10015635 3300014325 Bacteria 7023
78 Ga0163163_10309354 3300014325 Bacteria 1633
79 Ga0157376_10034402 3300014969 Bacteria 4091
80 Ga0206353_10582098 3300020082 Bacteria 3808
81 Ga0213872_10019742 3300021361 Bacteria 3103
82 Ga0207654_10111580 3300025911 Bacteria 1702
83 Ga0207707_10003699 3300025912 Bacteria 13554
84 Ga0207695_10095211 3300025913 Bacteria 2983
85 Ga0207695_10144503 3300025913 Bacteria 2324
86 Ga0207693_10036045 3300025915 Bacteria 3898
87 Ga0207660_10007201 3300025917 Bacteria 7200
88 Ga0207657_10070389 3300025919 Bacteria 2965
89 Ga0207649_10067407 3300025920 Bacteria 2272
90 Ga0207649_10256507 3300025920 Bacteria 1262
91 Ga0207652_10027727 3300025921 Bacteria 4722
92 Ga0207694_10001380 3300025924 Bacteria 20910
93 Ga0207700_10011433 3300025928 Bacteria 5659
94 Ga0207664_10052820 3300025929 Bacteria 3215
95 Ga0207706_10342386 3300025933 Bacteria 1301
96 Ga0207686_10317483 3300025934 Bacteria 1163
97 Ga0207670_10082853 3300025936 Bacteria 2248
98 Ga0207711_10054750 3300025941 Bacteria 3424
99 Ga0207661_10098156 3300025944 Bacteria 2454
100 Ga0207667_10001618 3300025949 Bacteria 28325
101 Ga0207667_10016513 3300025949 Bacteria 8338
102 Ga0207667_10176911 3300025949 Bacteria 2192
103 Ga0207640_10029824 3300025981 Bacteria 3353
104 Ga0207677_10097843 3300026023 Bacteria 2151
105 Ga0207703_10023990 3300026035 Bacteria 4799
106 Ga0207639_10124699 3300026041 Bacteria 2122
107 Ga0207702_10000944 3300026078 Bacteria 29846
108 Ga0207702_10008876 3300026078 Bacteria 8474
109 Ga0207702_10016175 3300026078 Bacteria 6178
110 Ga0207641_10032395 3300026088 Bacteria 4339
111 Ga0207648_10035969 3300026089 Bacteria 4363
112 Ga0207676_10086635 3300026095 Bacteria 2559
113 Ga0207674_10037524 3300026116 Bacteria 5038
114 Ga0207674_10050368 3300026116 Bacteria 4255
115 Ga0207675_100124591 3300026118 Bacteria 2440
116 Ga0207698_10160424 3300026142 Bacteria 1966
117 Ga0207428_10001784 3300027907 Bacteria 22039
118 Ga0265338_10005625 3300028800 Bacteria 16273
119 Ga0307513_10157777 3300031456 Bacteria 2166
120 Ga0307408_100010753 3300031548 Bacteria 6037
121 Ga0307408_100058921 3300031548 Bacteria 2793
122 Ga0316579_10003696 3300031691 Bacteria 6020
123 Ga0316578_10001521 3300031728 Bacteria 9507
124 Ga0316578_10196707 3300031728 Bacteria 1214
125 Ga0316577_10000770 3300031733 Bacteria 13795
126 Ga0307410_10059534 3300031852 Bacteria 2607
127 Ga0307412_10048102 3300031911 Bacteria 2803
128 Ga0307412_10158692 3300031911 Bacteria 1678
129 Ga0307409_100069451 3300031995 Bacteria 2791
130 Ga0307416_100142291 3300032002 Bacteria 2182
131 Ga0307411_10033155 3300032005 Bacteria 3201
132 Ga0307415_100120319 3300032126 Bacteria 1967
133 Ga0316580_10026537 3300032139 Bacteria 1791
134 Ga0316593_10038910 3300032168 Bacteria 1576
135 Ga0316593_10051324 3300032168 Bacteria 1394
136 Ga0316596_1023345 3300033541 Bacteria 1584
137 Ga0373926_0077241 3300035083 Bacteria 1228
138 Ga0316574_0003051 3300035398 Bacteria 8538
139 Ga0316582_0049780 3300036647 Bacteria 2652
140 Ga0316582_0096092 3300036647 Bacteria 1956
141 Ga0316584_0023411 3300036712 Bacteria 4512
142 Ga0316584_0039259 3300036712 Bacteria 3524
143 Ga0395899_0226578 3300037312 Bacteria 1292
144 Ga0395899_0288775 3300037312 Bacteria 1113
145 Ga0395900_0047465 3300037418 Bacteria 4422
146 Ga0395898_0011757 3300037466 Bacteria 9076
147 Ga0395898_0216205 3300037466 Bacteria 1828
148 Ga0395905_0000223 3300037471 Bacteria 86725
149 Ga0395905_0005663 3300037471 Bacteria 12704
150 Ga0395905_0194157 3300037471 Bacteria 1904
151 Ga0316581_0027480 3300037588 Bacteria 1701
152 Ga0395901_0013031 3300038443 Bacteria 8438
153 Ga0395901_0074743 3300038443 Bacteria 3535
154 Ga0436360_1041305 3300039438 Bacteria 6350
155 Ga0436361_1087289 3300039447 Bacteria 3093
156 Ga0436362_0680104 3300039453 Bacteria 1182
157 Ga0439457_019442 3300042014 Bacteria 1509
158 Ga0451577_0000122 3300042876 Bacteria 171004
159 Ga0451577_0059611 3300042876 Bacteria 3403
160 Ga0451577_0117489 3300042876 Unclassified 2382
161 Ga0466969_0001953 3300044656 Bacteria 11024
162 Ga0453683_0034265 3300044673 Bacteria 3201
163 Ga0453683_0084323 3300044673 Bacteria 1991
164 Ga0466966_0234709 3300044684 Bacteria 1106
165 Ga0466961_0021506 3300044693 Bacteria 4151
166 Ga0466963_0132878 3300044694 Bacteria 1720
167 Ga0453684_0000434 3300044712 Bacteria 170295
168 Ga0453684_0004934 3300044712 Bacteria 27202
169 Ga0453684_0016398 3300044712 Bacteria 11587
170 Ga0453684_0036008 3300044712 Bacteria 6829
171 Ga0466968_0009487 3300044735 Bacteria 3743
172 Ga0466957_0128310 3300044842 Bacteria 1622
173 Ga0466957_0303073 3300044842 Bacteria 1074
174 Ga0466960_0017689 3300044901 Bacteria 3113
175 Ga0466959_0000449 3300045049 Bacteria 23976
176 Ga0451576_0054744 3300045051 Bacteria 4176
177 Ga0466958_0278078 3300045836 Bacteria 1073
178 Ga0466967_0260641 3300045976 Bacteria 1658
179 Ga0466967_0420421 3300045976 Bacteria 1303
180 Ga0495583_0068365 3300046506 Bacteria 1567
181 Ga0495625_0022386 3300046660 Bacteria 4846
182 Ga0495581_0089735 3300047315 Bacteria 1783
183 Ga0496100_0108984 3300048903 Bacteria 1921
184 Ga0496103_0079181 3300048906 Bacteria 2064
185 Ga0496104_0006724 3300048907 Bacteria 10124
186 Ga0496104_0166468 3300048907 Bacteria 2114
187 Ga0496105_0070876 3300048908 Bacteria 2881
188 Ga0496108_0084449 3300048911 Bacteria 2694
189 Ga0496109_0051431 3300048912 Bacteria 3752
190 Ga0496110_0109539 3300048913 Bacteria 2480
191 Ga0496110_0137383 3300048913 Bacteria 2209
192 Ga0496111_0096012 3300048914 Bacteria 2175
193 Ga0496112_0008780 3300048915 Bacteria 9069
194 Ga0496112_0072470 3300048915 Bacteria 3405
195 Ga0496114_0011964 3300048917 Bacteria 6943
196 Ga0496114_0269076 3300048917 Bacteria 1501
197 Ga0501317_006313 3300049533 Bacteria 1300
198 Ga0501321_001234 3300049537 Bacteria 1982
199 Ga0501322_000344 3300049538 Bacteria 2092
200 Ga0501039_0073503 3300049575 Bacteria 2656
201 Ga0501067_0012856 3300049583 Bacteria 4635
202 Ga0501067_0020009 3300049583 Bacteria 3704
203 Ga0501067_0046416 3300049583 Bacteria 2411
204 Ga0501071_0079955 3300049587 Bacteria 2390
205 nmdc:mga05p37_7231_c1 3300050507 Bacteria 13097
206 nmdc:mga09592_61038_c1 3300050508 Bacteria 3188
207 nmdc:mga0qj67_5120_c1 3300050509 Bacteria 9545
208 nmdc:mga06r32_50803_c1 3300050510 Bacteria 3966
209 nmdc:mga08y16_6684_c1 3300050511 Bacteria 12098
210 nmdc:mga0n895_209760_c1 3300050512 Bacteria 1978
211 Ga0500635_0001190 3300053080 Bacteria 6237
212 Ga0500643_004700 3300053087 Bacteria 6074
213 Ga0500568_0008938 3300053139 Bacteria 4792
214 Ga0501084_0099253 3300054114 Bacteria 2445
215 Ga0530510_0020784 3300061734 Bacteria 4669
216 Ga0530510_0123149 3300061734 Bacteria 1905
217 2515853438 2515154155 Bacteria 7985436
218 2600202576 2599185354 Bacteria 4398675
219 2643827125 2643221561 Bacteria 4984412
220 2643850212 2643221567 Bacteria 4163945
221 2644136600 2643221624 Bacteria 4384879
222 2644534478 2643221696 Bacteria 5431823
223 2753764369 2751185897 Bacteria 5322941
224 2852677576 2852677369 Bacteria 3768884
225 2894511558 2894510363 Bacteria 5121143
226 2897561842 2897561785 Bacteria 3256946
227 2984578179 2984576629 Bacteria 4248407
228 2990257691 2990256926 Bacteria 4252839
229 8057103127 8057101203 Bacteria 5034064
230 Ga0207686_10006061
231 Ga0006778J45830_1007436
232 Ga0006759J45824_1001904
233 Ga0006770J48903_1002137
234 Ga0006777J48905_1002308
235 Ga0007417J51691_1014759
236 Ga0007427J51700_102324
237 Ga0006781J51513_1001674
238 Ga0007410J51695_1002649
239 Ga0007410J51695_1009047
240 Ga0007410J51695_1016571
241 Ga0007409J51694_1007675
242 Ga0007416J51690_1003502
243 Ga0007429J51699_1020058
244 Ga0007411J51799_101708
245 Ga0007415J51800_103035
246 Ga0006780_1001792
247 Ga0070658_10058404
248 Ga0070683_100021860
249 Ga0070683_100060771
250 Ga0070689_100042759
251 Ga0070661_100290157
252 Ga0070714_100049474
253 Ga0070713_100002538
254 Ga0070713_100011268
255 Ga0070662_100030920
256 Ga0070681_10000295
257 Ga0070679_100045719
258 Ga0070684_100090648
259 Ga0070697_100021371
260 Ga0068855_100000372
261 Ga0068857_100003071
262 Ga0068854_100011299
263 Ga0068856_100001547
264 Ga0068856_100487446
265 Ga0068852_100599339
266 Ga0068861_100103848
267 Ga0068863_100008118
268 Ga0068858_100024371
269 Ga0081455_10001865
270 Ga0081538_10000703
271 Ga0070712_100026477
272 Ga0097621_100003888
273 Ga0075370_10028398
274 Ga0068871_100002106
275 Ga0075428_100003220
276 Ga0075430_100036087
277 Ga0075431_100002560
278 Ga0075431_100065312
279 Ga0075429_100001964
280 Ga0075429_100071685
281 Ga0105240_10030622
282 Ga0105240_10180455
283 Ga0111539_10045218
284 Ga0111539_10265174
285 Ga0105245_10085737
286 Ga0105245_10172675
287 Ga0114129_10004806
288 Ga0105242_10185089
289 Ga0105248_10047955
290 Ga0105237_10010453
291 Ga0105238_10000073
292 Ga0105239_10117738
293 Ga0157371_10056338
294 Ga0157371_10213586
295 Ga0157370_10078216
296 Ga0157369_10000122
297 Ga0157369_10060311
298 Ga0157374_10000326
299 Ga0157374_10004254
300 Ga0157378_10008513
301 Ga0157372_10000982
302 Ga0157372_10003987
303 Ga0157372_10005450
304 Ga0157372_10017047
305 Ga0157375_10050263
306 Ga0163163_10015635
307 Ga0163163_10309354
308 Ga0157376_10034402
309 Ga0206353_10582098
310 Ga0213872_10019742
311 Ga0207654_10111580
312 Ga0207707_10003699
313 Ga0207695_10095211
314 Ga0207695_10144503
315 Ga0207693_10036045
316 Ga0207660_10007201
317 Ga0207657_10070389
318 Ga0207649_10067407
319 Ga0207649_10256507
320 Ga0207652_10027727
321 Ga0207694_10001380
322 Ga0207700_10011433
323 Ga0207664_10052820
324 Ga0207706_10342386
325 Ga0207686_10317483
326 Ga0207670_10082853
327 Ga0207711_10054750
328 Ga0207661_10098156
329 Ga0207667_10001618
330 Ga0207667_10016513
331 Ga0207667_10176911
332 Ga0207640_10029824
333 Ga0207677_10097843
334 Ga0207703_10023990
335 Ga0207639_10124699
336 Ga0207702_10000944
337 Ga0207702_10008876
338 Ga0207702_10016175
339 Ga0207641_10032395
340 Ga0207648_10035969
341 Ga0207676_10086635
342 Ga0207674_10037524
343 Ga0207674_10050368
344 Ga0207675_100124591
345 Ga0207698_10160424
346 Ga0207428_10001784
347 Ga0265338_10005625
348 Ga0307513_10157777
349 Ga0307408_100010753
350 Ga0307408_100058921
351 Ga0316579_10003696
352 Ga0316578_10001521
353 Ga0316578_10196707
354 Ga0316577_10000770
355 Ga0307410_10059534
356 Ga0307412_10048102
357 Ga0307412_10158692
358 Ga0307409_100069451
359 Ga0307416_100142291
360 Ga0307411_10033155
361 Ga0307415_100120319
362 Ga0316580_10026537
363 Ga0316593_10038910
364 Ga0316593_10051324
365 Ga0316596_1023345
366 Ga0373926_0077241
367 Ga0316574_0003051
368 Ga0316582_0049780
369 Ga0316582_0096092
370 Ga0316584_0023411
371 Ga0316584_0039259
372 Ga0395899_0226578
373 Ga0395899_0288775
374 Ga0395900_0047465
375 Ga0395898_0011757
376 Ga0395898_0216205
377 Ga0395905_0000223
378 Ga0395905_0005663
379 Ga0395905_0194157
380 Ga0316581_0027480
381 Ga0395901_0013031
382 Ga0395901_0074743
383 Ga0436360_1041305
384 Ga0436361_1087289
385 Ga0436362_0680104
386 Ga0439457_019442
387 Ga0451577_0000122
388 Ga0451577_0059611
389 Ga0451577_0117489
390 Ga0466969_0001953
391 Ga0453683_0034265
392 Ga0453683_0084323
393 Ga0466966_0234709
394 Ga0466961_0021506
395 Ga0466963_0132878
396 Ga0453684_0000434
397 Ga0453684_0004934
398 Ga0453684_0016398
399 Ga0453684_0036008
400 Ga0466968_0009487
401 Ga0466957_0128310
402 Ga0466957_0303073
403 Ga0466960_0017689
404 Ga0466959_0000449
405 Ga0451576_0054744
406 Ga0466958_0278078
407 Ga0466967_0260641
408 Ga0466967_0420421
409 Ga0495583_0068365
410 Ga0495625_0022386
411 Ga0495581_0089735
412 Ga0496100_0108984
413 Ga0496103_0079181
414 Ga0496104_0006724
415 Ga0496104_0166468
416 Ga0496105_0070876
417 Ga0496108_0084449
418 Ga0496109_0051431
419 Ga0496110_0109539
420 Ga0496110_0137383
421 Ga0496111_0096012
422 Ga0496112_0008780
423 Ga0496112_0072470
424 Ga0496114_0011964
425 Ga0496114_0269076
426 Ga0501317_006313
427 Ga0501321_001234
428 Ga0501322_000344
429 Ga0501039_0073503
430 Ga0501067_0012856
431 Ga0501067_0020009
432 Ga0501067_0046416
433 Ga0501071_0079955
434 nmdc:mga05p37_7231_c1
435 nmdc:mga09592_61038_c1
436 nmdc:mga0qj67_5120_c1
437 nmdc:mga06r32_50803_c1
438 nmdc:mga08y16_6684_c1
439 nmdc:mga0n895_209760_c1
440 Ga0500635_0001190
441 Ga0500643_004700
442 Ga0500568_0008938
443 Ga0501084_0099253
444 Ga0530510_0020784
445 Ga0530510_0123149
446 2515853438
447 2600202576
448 2643827125
449 2643850212
450 2644136600
451 2644534478
452 2753764369
453 2852677576
454 2894511558
455 2897561842
456 2984578179
457 2990257691
458 8057103127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

70

362

0.91

PF00890

FAD_binding_2

FAD binding domain

71

111

0.87

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

215

289

0.85

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

109

345

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f8r-assembly1.cif.gz_B crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two nadp molecules 0.9444 15 316
7jyp-assembly1.cif.gz_A-2 structure of thioredoxin reductase from the thermophilic eubacterium thermosipho africanus tcf52b 0.9394 15 312
3itj-assembly2.cif.gz_C crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1) 0.9351 14 317
3itj-assembly1.cif.gz_A crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1) 0.9344 12 317
5uth-assembly1.cif.gz_A crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad 0.9339 11 316
ID Description Score Start End Superfamily
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9938 127 249 3.50.50.60
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9858 127 249 3.50.50.60
4zn0C02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9763 127 249 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9744 127 249 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9661 127 249 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3C0YJU2-F1-model_v4 deleted 1.006 145 214
AF-A0A3C0YJU2-F1-model_v4 deleted 0.992 145 214
AF-A0A3D5UWY6-F1-model_v4 Thioredoxin-disulfide reductase 0.9871 152 241 GO:0016491
AF-A0A6B3EPH4-F1-model_v4 FAD-dependent oxidoreductase 0.9852 117 235 GO:0016668
AF-A0A6G3XGX0-F1-model_v4 FAD-dependent oxidoreductase 0.9829 80 256 GO:0016668

Map