F341833
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 229 | 152 | 225 | 209 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100867665|Ga0068855_1008676651 |
| Length | 215 |
| Sequence | MQVEVLNISGKKTTKKVELADSIFNVEPNDHCIYLDVKQHLANKRQGTHKSKERAEIARTTKKLKRQKGTGGARAGSMKSPLFIGGGRVFGPKPRDYSFKLNKKVKVVARASALTYKAKDNAITVLEDFNFEAPKTKNYSELMKNLNMSDKKTLLVLGGHNKNVYLSSRNIHGAKVVNASDLNTYDILNAQNLILSESSVKVIEQILNKQDGNSN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 2 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 3 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 4 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 23 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 30 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 31 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 32 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 33 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 42 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 60 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 61 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 62 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 63 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 64 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 65 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 66 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 67 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 68 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 69 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 70 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 71 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 72 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 73 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 74 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 75 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 76 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 77 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 78 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 79 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 80 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 81 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 82 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 83 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 84 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 85 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 86 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 87 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 88 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 89 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 90 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 91 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 92 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 93 | 3300041454 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT | Metatranscriptome | Rhizoplane |
| 94 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 95 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 96 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 97 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 98 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 99 | 3300041464 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT | Metatranscriptome | Rhizoplane |
| 100 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 101 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 102 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 103 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 104 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 105 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 106 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 107 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 128 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 129 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 130 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 131 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 132 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 133 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 134 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 135 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 136 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 137 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 138 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 140 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 141 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 142 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 143 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 144 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 145 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 146 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 147 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 148 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.86 |
| Metatranscriptomes | 21.4 |
| Isolates | 1.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.04 |
| Nodule | 0 |
| Rhizoplane | 3.49 |
| Rhizosphere | 76.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10008519 | 3300001979 | Bacteria | 4080 |
| 2 | rootH1_10010612 | 3300003316 | Bacteria | 9244 |
| 3 | rootH2_10003970 | 3300003320 | Bacteria | 33753 |
| 4 | rootH2_10173412 | 3300003320 | Bacteria | 1915 |
| 5 | rootL2_10010167 | 3300003322 | Bacteria | 22542 |
| 6 | rootL2_10011247 | 3300003322 | Bacteria | 9421 |
| 7 | rootL2_10015593 | 3300003322 | Bacteria | 11855 |
| 8 | rootH1_10009782 | 3300003323 | Bacteria | 19748 |
| 9 | rootH1_10012094 | 3300003323 | Bacteria | 18730 |
| 10 | rootH1_10108515 | 3300003323 | Bacteria | 1780 |
| 11 | rootH1_10109910 | 3300003323 | Bacteria | 1897 |
| 12 | Ga0007417J51691_1063811 | 3300003544 | Bacteria | 1562 |
| 13 | Ga0055531_10000409 | 3300003794 | Bacteria | 41322 |
| 14 | Ga0058860_12155377 | 3300004801 | Bacteria | 1355 |
| 15 | Ga0065165_1000831 | 3300005262 | Bacteria | 40595 |
| 16 | Ga0065165_1059034 | 3300005262 | Bacteria | 1057 |
| 17 | Ga0065714_10007641 | 3300005288 | Bacteria | 3489 |
| 18 | Ga0070682_100678995 | 3300005337 | Bacteria | 823 |
| 19 | Ga0070668_100181543 | 3300005347 | Bacteria | 1719 |
| 20 | Ga0070688_100041186 | 3300005365 | Bacteria | 2834 |
| 21 | Ga0070714_100091865 | 3300005435 | Bacteria | 2660 |
| 22 | Ga0070713_101169406 | 3300005436 | Bacteria | 744 |
| 23 | Ga0070678_100351006 | 3300005456 | Bacteria | 1268 |
| 24 | Ga0068855_100289382 | 3300005563 | Bacteria | 1817 |
| 25 | Ga0068855_100867665 | 3300005563 | Bacteria | 955 |
| 26 | Ga0068857_100236793 | 3300005577 | Bacteria | 1670 |
| 27 | Ga0068856_100031219 | 3300005614 | Bacteria | 5212 |
| 28 | Ga0068856_100077827 | 3300005614 | Bacteria | 3287 |
| 29 | Ga0068852_101439434 | 3300005616 | Unclassified | 711 |
| 30 | Ga0068864_100677165 | 3300005618 | Bacteria | 1006 |
| 31 | Ga0068863_100436656 | 3300005841 | Bacteria | 1283 |
| 32 | Ga0070715_10085294 | 3300006163 | Bacteria | 1442 |
| 33 | Ga0070716_100039818 | 3300006173 | Bacteria | 2611 |
| 34 | Ga0075370_10341066 | 3300006353 | Bacteria | 894 |
| 35 | Ga0075428_100013576 | 3300006844 | Bacteria | 9071 |
| 36 | Ga0075428_100182361 | 3300006844 | Bacteria | 2272 |
| 37 | Ga0075430_100076161 | 3300006846 | Bacteria | 2812 |
| 38 | Ga0075431_100328003 | 3300006847 | Bacteria | 1542 |
| 39 | Ga0111539_10013971 | 3300009094 | Bacteria | 10037 |
| 40 | Ga0111539_10015243 | 3300009094 | Bacteria | 9574 |
| 41 | Ga0105242_10103549 | 3300009176 | Bacteria | 2415 |
| 42 | Ga0105242_10639314 | 3300009176 | Bacteria | 1033 |
| 43 | Ga0105249_11637997 | 3300009553 | Bacteria | 716 |
| 44 | Ga0157371_10054786 | 3300013102 | Bacteria | 2831 |
| 45 | Ga0157370_10145310 | 3300013104 | Bacteria | 2209 |
| 46 | Ga0157372_10000332 | 3300013307 | Bacteria | 51907 |
| 47 | Ga0157372_10965536 | 3300013307 | Bacteria | 988 |
| 48 | Ga0157380_10000051 | 3300014326 | Bacteria | 68466 |
| 49 | Ga0157380_10006042 | 3300014326 | Bacteria | 8483 |
| 50 | Ga0157376_10670759 | 3300014969 | Bacteria | 1039 |
| 51 | Ga0206356_10873539 | 3300020070 | Bacteria | 1011 |
| 52 | Ga0209050_1005534 | 3300025298 | Bacteria | 7892 |
| 53 | Ga0209050_1049461 | 3300025298 | Bacteria | 1077 |
| 54 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 55 | Ga0209257_1024055 | 3300025304 | Bacteria | 2120 |
| 56 | Ga0207685_10046839 | 3300025905 | Bacteria | 1647 |
| 57 | Ga0207695_10634758 | 3300025913 | Bacteria | 949 |
| 58 | Ga0207687_10089938 | 3300025927 | Bacteria | 2236 |
| 59 | Ga0207686_10198597 | 3300025934 | Bacteria | 1435 |
| 60 | Ga0207665_10050775 | 3300025939 | Bacteria | 2790 |
| 61 | Ga0207667_10182531 | 3300025949 | Bacteria | 2154 |
| 62 | Ga0207667_10189183 | 3300025949 | Bacteria | 2112 |
| 63 | Ga0207667_10939292 | 3300025949 | Bacteria | 855 |
| 64 | Ga0207639_10470787 | 3300026041 | Bacteria | 1144 |
| 65 | Ga0207678_10258902 | 3300026067 | Bacteria | 1491 |
| 66 | Ga0207702_10023144 | 3300026078 | Bacteria | 5153 |
| 67 | Ga0207641_10450750 | 3300026088 | Bacteria | 1243 |
| 68 | Ga0207676_10567325 | 3300026095 | Bacteria | 1086 |
| 69 | Ga0207676_10896913 | 3300026095 | Bacteria | 869 |
| 70 | Ga0207674_10145777 | 3300026116 | Bacteria | 2326 |
| 71 | Ga0207683_10772674 | 3300026121 | Unclassified | 891 |
| 72 | Ga0209995_1030097 | 3300027471 | Bacteria | 908 |
| 73 | Ga0209974_10056787 | 3300027876 | Bacteria | 1321 |
| 74 | Ga0207428_10076578 | 3300027907 | Bacteria | 2619 |
| 75 | Ga0207428_10313406 | 3300027907 | Bacteria | 1159 |
| 76 | Ga0265334_10018191 | 3300028573 | Bacteria | 2898 |
| 77 | Ga0265323_10000040 | 3300028653 | Bacteria | 70373 |
| 78 | Ga0307515_10000009 | 3300028794 | Bacteria | 653206 |
| 79 | Ga0307515_10536201 | 3300028794 | Bacteria | 780 |
| 80 | Ga0265338_10001162 | 3300028800 | Bacteria | 43495 |
| 81 | Ga0265338_10001855 | 3300028800 | Bacteria | 33207 |
| 82 | Ga0265338_10143556 | 3300028800 | Bacteria | 1866 |
| 83 | Ga0265324_10056854 | 3300029957 | Bacteria | 1340 |
| 84 | Ga0265327_10000370 | 3300031251 | Bacteria | 84921 |
| 85 | Ga0265327_10127644 | 3300031251 | Bacteria | 1199 |
| 86 | Ga0265316_10000486 | 3300031344 | Bacteria | 45040 |
| 87 | Ga0307513_10127710 | 3300031456 | Bacteria | 2494 |
| 88 | Ga0307509_10007469 | 3300031507 | Bacteria | 14263 |
| 89 | Ga0307509_10165518 | 3300031507 | Bacteria | 2101 |
| 90 | Ga0307408_100000648 | 3300031548 | Bacteria | 29197 |
| 91 | Ga0307408_100038382 | 3300031548 | Bacteria | 3379 |
| 92 | Ga0307514_10127372 | 3300031649 | Bacteria | 1761 |
| 93 | Ga0316576_10021298 | 3300031727 | Bacteria | 4482 |
| 94 | Ga0316578_10015477 | 3300031728 | Bacteria | 4102 |
| 95 | Ga0307516_10090261 | 3300031730 | Bacteria | 2893 |
| 96 | Ga0307413_10081698 | 3300031824 | Bacteria | 2073 |
| 97 | Ga0307410_10788448 | 3300031852 | Bacteria | 807 |
| 98 | Ga0307412_10010885 | 3300031911 | Bacteria | 5251 |
| 99 | Ga0307412_10276740 | 3300031911 | Bacteria | 1316 |
| 100 | Ga0307409_100054022 | 3300031995 | Bacteria | 3091 |
| 101 | Ga0307416_100000249 | 3300032002 | Bacteria | 28628 |
| 102 | Ga0307414_10010589 | 3300032004 | Bacteria | 5360 |
| 103 | Ga0307411_10133368 | 3300032005 | Bacteria | 1819 |
| 104 | Ga0307415_100035567 | 3300032126 | Bacteria | 3254 |
| 105 | Ga0307415_100840353 | 3300032126 | Unclassified | 842 |
| 106 | Ga0316596_1000052 | 3300033541 | Bacteria | 12700 |
| 107 | Ga0316596_1006083 | 3300033541 | Bacteria | 2790 |
| 108 | Ga0373931_0139815 | 3300035691 | Bacteria | 1401 |
| 109 | Ga0373927_0006959 | 3300035695 | Bacteria | 7677 |
| 110 | Ga0373937_1032720 | 3300036401 | Bacteria | 771 |
| 111 | Ga0316582_0115197 | 3300036647 | Bacteria | 1793 |
| 112 | Ga0316584_0001842 | 3300036712 | Bacteria | 13121 |
| 113 | Ga0316584_0028755 | 3300036712 | Bacteria | 4102 |
| 114 | Ga0395899_0000673 | 3300037312 | Bacteria | 34566 |
| 115 | Ga0395900_0541447 | 3300037418 | Bacteria | 1110 |
| 116 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 117 | Ga0395905_0000376 | 3300037471 | Bacteria | 63695 |
| 118 | Ga0395905_0308049 | 3300037471 | Bacteria | 1472 |
| 119 | Ga0395901_0002865 | 3300038443 | Bacteria | 17414 |
| 120 | Ga0400488_36638 | 3300038741 | Bacteria | 1290 |
| 121 | Ga0451799_02770 | 3300041454 | Bacteria | 1535 |
| 122 | Ga0451801_20542 | 3300041455 | Bacteria | 768 |
| 123 | Ga0451795_0578569 | 3300041456 | Bacteria | 1331 |
| 124 | Ga0451795_1060327 | 3300041456 | Bacteria | 2256 |
| 125 | Ga0451798_0296397 | 3300041458 | Bacteria | 1150 |
| 126 | Ga0451802_1246725 | 3300041460 | Bacteria | 1269 |
| 127 | Ga0451805_091713 | 3300041461 | Bacteria | 3245 |
| 128 | Ga0451808_16930 | 3300041464 | Bacteria | 2421 |
| 129 | Ga0451837_1468151 | 3300041494 | Bacteria | 1012 |
| 130 | Ga0452271_55409 | 3300041916 | Bacteria | 1788 |
| 131 | Ga0439460_0002577 | 3300042461 | Bacteria | 4377 |
| 132 | Ga0451577_0058001 | 3300042876 | Bacteria | 3451 |
| 133 | Ga0451577_0092287 | 3300042876 | Bacteria | 2703 |
| 134 | Ga0453683_0041549 | 3300044673 | Bacteria | 2888 |
| 135 | Ga0453683_0130278 | 3300044673 | Bacteria | 1585 |
| 136 | Ga0453684_0001121 | 3300044712 | Bacteria | 83919 |
| 137 | Ga0453684_0001193 | 3300044712 | Bacteria | 80343 |
| 138 | Ga0453684_0005611 | 3300044712 | Bacteria | 24695 |
| 139 | Ga0453684_0007136 | 3300044712 | Bacteria | 20809 |
| 140 | Ga0453684_0012498 | 3300044712 | Bacteria | 13983 |
| 141 | Ga0453684_0092022 | 3300044712 | Bacteria | 3741 |
| 142 | Ga0453684_0164783 | 3300044712 | Bacteria | 2618 |
| 143 | Ga0453684_0315852 | 3300044712 | Bacteria | 1771 |
| 144 | Ga0453684_0414653 | 3300044712 | Bacteria | 1506 |
| 145 | Ga0453684_0422724 | 3300044712 | Bacteria | 1488 |
| 146 | Ga0453684_0777061 | 3300044712 | Bacteria | 1035 |
| 147 | Ga0453684_1397031 | 3300044712 | Bacteria | 726 |
| 148 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 149 | Ga0451576_0010522 | 3300045051 | Bacteria | 10601 |
| 150 | Ga0451576_0018019 | 3300045051 | Bacteria | 7749 |
| 151 | Ga0451576_0051376 | 3300045051 | Bacteria | 4322 |
| 152 | Ga0451576_0063555 | 3300045051 | Bacteria | 3848 |
| 153 | Ga0451576_0275888 | 3300045051 | Bacteria | 1758 |
| 154 | Ga0451576_0409141 | 3300045051 | Bacteria | 1423 |
| 155 | Ga0495638_0000040 | 3300046460 | Bacteria | 241883 |
| 156 | Ga0495625_0247105 | 3300046660 | Bacteria | 1159 |
| 157 | Ga0501306_000385 | 3300049127 | Bacteria | 3273 |
| 158 | Ga0501306_025537 | 3300049127 | Bacteria | 851 |
| 159 | Ga0501308_000775 | 3300049128 | Bacteria | 2277 |
| 160 | Ga0501309_001746 | 3300049129 | Bacteria | 2213 |
| 161 | Ga0501309_004788 | 3300049129 | Bacteria | 1588 |
| 162 | Ga0501309_058333 | 3300049129 | Bacteria | 617 |
| 163 | Ga0501310_001315 | 3300049130 | Bacteria | 2236 |
| 164 | Ga0501310_003146 | 3300049130 | Bacteria | 1605 |
| 165 | Ga0501304_000312 | 3300049160 | Bacteria | 2329 |
| 166 | Ga0501305_002286 | 3300049161 | Bacteria | 2044 |
| 167 | Ga0501305_006141 | 3300049161 | Bacteria | 1482 |
| 168 | Ga0501305_011468 | 3300049161 | Bacteria | 1198 |
| 169 | Ga0501307_000311 | 3300049162 | Bacteria | 3032 |
| 170 | Ga0501307_000849 | 3300049162 | Bacteria | 2333 |
| 171 | Ga0501307_007393 | 3300049162 | Bacteria | 1210 |
| 172 | Ga0501311_028137 | 3300049527 | Bacteria | 801 |
| 173 | Ga0501312_001574 | 3300049528 | Bacteria | 2277 |
| 174 | Ga0501312_001811 | 3300049528 | Bacteria | 2194 |
| 175 | Ga0501312_006953 | 3300049528 | Bacteria | 1429 |
| 176 | Ga0501312_015404 | 3300049528 | Bacteria | 1084 |
| 177 | Ga0501313_000962 | 3300049529 | Bacteria | 2282 |
| 178 | Ga0501315_001052 | 3300049531 | Bacteria | 2214 |
| 179 | Ga0501315_003624 | 3300049531 | Bacteria | 1557 |
| 180 | Ga0501316_001063 | 3300049532 | Bacteria | 2214 |
| 181 | Ga0501316_039431 | 3300049532 | Bacteria | 655 |
| 182 | Ga0501317_001012 | 3300049533 | Bacteria | 2282 |
| 183 | Ga0501317_001377 | 3300049533 | Bacteria | 2090 |
| 184 | Ga0501320_005075 | 3300049536 | Bacteria | 1186 |
| 185 | Ga0501323_001214 | 3300049539 | Bacteria | 2216 |
| 186 | Ga0501323_001344 | 3300049539 | Bacteria | 2153 |
| 187 | Ga0501335_018507 | 3300049551 | Unclassified | 730 |
| 188 | Ga0501340_003465 | 3300049556 | Bacteria | 958 |
| 189 | Ga0501032_0375687 | 3300049569 | Bacteria | 914 |
| 190 | Ga0501198_012021 | 3300049649 | Bacteria | 1297 |
| 191 | Ga0501207_023748 | 3300049654 | Bacteria | 997 |
| 192 | Ga0501217_019788 | 3300049661 | Bacteria | 1575 |
| 193 | Ga0501217_091876 | 3300049661 | Bacteria | 853 |
| 194 | Ga0501222_007248 | 3300049662 | Bacteria | 1481 |
| 195 | Ga0501223_003765 | 3300049663 | Bacteria | 3276 |
| 196 | Ga0501242_023640 | 3300049674 | Bacteria | 803 |
| 197 | Ga0501257_003554 | 3300049686 | Bacteria | 3354 |
| 198 | Ga0501257_010822 | 3300049686 | Bacteria | 2075 |
| 199 | Ga0501257_034459 | 3300049686 | Bacteria | 1229 |
| 200 | Ga0501259_006914 | 3300049688 | Bacteria | 1810 |
| 201 | Ga0501241_000113 | 3300049758 | Bacteria | 17544 |
| 202 | Ga0501264_000532 | 3300049761 | Bacteria | 5587 |
| 203 | nmdc:mga0k408_111057_c1 | 3300050493 | Bacteria | 1620 |
| 204 | nmdc:mga0k408_296364_c1 | 3300050493 | Bacteria | 965 |
| 205 | nmdc:mga08y16_10401_c1 | 3300050511 | Bacteria | 9761 |
| 206 | Ga0500578_0263911 | 3300053086 | Bacteria | 1033 |
| 207 | Ga0500644_0037696 | 3300053088 | Bacteria | 1582 |
| 208 | Ga0500556_0011703 | 3300053104 | Bacteria | 2603 |
| 209 | Ga0500562_021611 | 3300053108 | Bacteria | 1676 |
| 210 | Ga0500562_046999 | 3300053108 | Bacteria | 1151 |
| 211 | Ga0500652_076474 | 3300053131 | Bacteria | 1392 |
| 212 | Ga0500655_013596 | 3300053133 | Bacteria | 1486 |
| 213 | Ga0500604_0048634 | 3300053151 | Bacteria | 1302 |
| 214 | Ga0500616_0000013 | 3300053153 | Bacteria | 674172 |
| 215 | Ga0500616_0044405 | 3300053153 | Bacteria | 2371 |
| 216 | Ga0500622_0000113 | 3300053156 | Bacteria | 83196 |
| 217 | Ga0500622_0000133 | 3300053156 | Bacteria | 78532 |
| 218 | Ga0500622_0007455 | 3300053156 | Bacteria | 6212 |
| 219 | Ga0587077_044862 | 3300059493 | Bacteria | 902 |
| 220 | Ga0587101_016841 | 3300059623 | Bacteria | 1006 |
| 221 | Ga0587068_002145 | 3300059641 | Bacteria | 2359 |
| 222 | Ga0587068_006340 | 3300059641 | Bacteria | 1653 |
| 223 | Ga0587068_006852 | 3300059641 | Bacteria | 1608 |
| 224 | Ga0587076_007530 | 3300059645 | Bacteria | 1490 |
| 225 | Ga0587079_000249 | 3300059647 | Bacteria | 4161 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049129 | Ga0501309_058333 | Ga0501309_058333_19_585 | 187 |
| 2 | 3300049531 | Ga0501315_003624 | Ga0501315_003624_962_1528 | 187 |
| 3 | 3300050493 | nmdc:mga0k408_296364_c1 | nmdc:mga0k408_296364_c1_373_939 | 187 |
| 4 | 3300053131 | Ga0500652_076474 | Ga0500652_076474_103_669 | 187 |
| 5 | 3300049686 | Ga0501257_034459 | Ga0501257_034459_129_761 | 190 |
| 6 | 3300049532 | Ga0501316_039431 | Ga0501316_039431_64_645 | 193 |
| 7 | 3300031727 | Ga0316576_10021298 | Ga0316576_100212984 | 196 |
| 8 | 3300049569 | Ga0501032_0375687 | Ga0501032_0375687_118_750 | 197 |
| 9 | 3300049129 | Ga0501309_004788 | Ga0501309_004788_86_694 | 201 |
| 10 | iso_pu_bacteria | 2890804823 | 2890807163 | 204 |
| 11 | 3300042461 | Ga0439460_0002577 | Ga0439460_0002577_752_1378 | 205 |
| 12 | iso_pu_bacteria | 2884634485 | 2884637382 | 205 |
| 13 | iso_pu_bacteria | 2910245624 | 2910249760 | 205 |
| 14 | iso_pu_bacteria | 2919692658 | 2919697453 | 205 |
| 15 | 3300006163 | Ga0070715_10085294 | Ga0070715_100852942 | 206 |
| 16 | 3300025905 | Ga0207685_10046839 | Ga0207685_100468393 | 206 |
| 17 | 3300033541 | Ga0316596_1006083 | Ga0316596_10060832 | 206 |
| 18 | 3300044712 | Ga0453684_0007136 | Ga0453684_0007136_1161_1784 | 206 |
| 19 | 3300049551 | Ga0501335_018507 | Ga0501335_018507_66_686 | 206 |
| 20 | 3300028653 | Ga0265323_10000040 | Ga0265323_1000004069 | 207 |
| 21 | 3300031344 | Ga0265316_10000486 | Ga0265316_1000048647 | 207 |
| 22 | 3300038741 | Ga0400488_36638 | Ga0400488_36638_548_1171 | 207 |
| 23 | 3300042876 | Ga0451577_0092287 | Ga0451577_0092287_114_737 | 207 |
| 24 | 3300044712 | Ga0453684_0001193 | Ga0453684_0001193_72700_73323 | 207 |
| 25 | 3300044712 | Ga0453684_0012498 | Ga0453684_0012498_11964_12587 | 207 |
| 26 | 3300044712 | Ga0453684_0092022 | Ga0453684_0092022_2862_3485 | 207 |
| 27 | 3300044712 | Ga0453684_0164783 | Ga0453684_0164783_648_1271 | 207 |
| 28 | 3300044712 | Ga0453684_0315852 | Ga0453684_0315852_987_1610 | 207 |
| 29 | 3300044712 | Ga0453684_0414653 | Ga0453684_0414653_209_832 | 207 |
| 30 | 3300003320 | rootH2_10173412 | rootH2_101734122 | 208 |
| 31 | 3300005614 | Ga0068856_100077827 | Ga0068856_1000778272 | 208 |
| 32 | 3300009176 | Ga0105242_10639314 | Ga0105242_106393141 | 208 |
| 33 | 3300013102 | Ga0157371_10054786 | Ga0157371_100547863 | 208 |
| 34 | 3300025298 | Ga0209050_1049461 | Ga0209050_10494612 | 208 |
| 35 | 3300031548 | Ga0307408_100000648 | Ga0307408_10000064822 | 208 |
| 36 | 3300031728 | Ga0316578_10015477 | Ga0316578_100154775 | 208 |
| 37 | 3300036647 | Ga0316582_0115197 | Ga0316582_0115197_362_988 | 208 |
| 38 | 3300036712 | Ga0316584_0001842 | Ga0316584_0001842_2228_2854 | 208 |
| 39 | 3300037312 | Ga0395899_0000673 | Ga0395899_0000673_24365_24991 | 208 |
| 40 | 3300037418 | Ga0395900_0541447 | Ga0395900_0541447_397_1023 | 208 |
| 41 | 3300037471 | Ga0395905_0000001 | Ga0395905_0000001_275391_276017 | 208 |
| 42 | 3300037471 | Ga0395905_0308049 | Ga0395905_0308049_360_986 | 208 |
| 43 | 3300041456 | Ga0451795_0578569 | Ga0451795_0578569_143_769 | 208 |
| 44 | 3300041456 | Ga0451795_1060327 | Ga0451795_1060327_1068_1694 | 208 |
| 45 | 3300045051 | Ga0451576_0010522 | Ga0451576_0010522_4912_5538 | 208 |
| 46 | 3300045051 | Ga0451576_0409141 | Ga0451576_0409141_371_997 | 208 |
| 47 | 3300049127 | Ga0501306_025537 | Ga0501306_025537_141_767 | 208 |
| 48 | 3300049161 | Ga0501305_011468 | Ga0501305_011468_222_848 | 208 |
| 49 | 3300049162 | Ga0501307_000311 | Ga0501307_000311_1007_1633 | 208 |
| 50 | 3300049649 | Ga0501198_012021 | Ga0501198_012021_283_909 | 208 |
| 51 | 3300049663 | Ga0501223_003765 | Ga0501223_003765_1768_2394 | 208 |
| 52 | 3300049758 | Ga0501241_000113 | Ga0501241_000113_8654_9280 | 208 |
| 53 | 3300053086 | Ga0500578_0263911 | Ga0500578_0263911_244_870 | 208 |
| 54 | 3300053088 | Ga0500644_0037696 | Ga0500644_0037696_271_897 | 208 |
| 55 | 3300053156 | Ga0500622_0007455 | Ga0500622_0007455_5265_5891 | 208 |
| 56 | 3300059647 | Ga0587079_000249 | Ga0587079_000249_991_1617 | 208 |
| 57 | 3300003316 | rootH1_10010612 | rootH1_1001061214 | 209 |
| 58 | 3300003320 | rootH2_10003970 | rootH2_1000397025 | 209 |
| 59 | 3300003322 | rootL2_10010167 | rootL2_1001016726 | 209 |
| 60 | 3300003322 | rootL2_10011247 | rootL2_100112476 | 209 |
| 61 | 3300003322 | rootL2_10015593 | rootL2_100155931 | 209 |
| 62 | 3300003323 | rootH1_10009782 | rootH1_1000978218 | 209 |
| 63 | 3300003323 | rootH1_10012094 | rootH1_1001209421 | 209 |
| 64 | 3300003323 | rootH1_10108515 | rootH1_101085153 | 209 |
| 65 | 3300003323 | rootH1_10109910 | rootH1_101099102 | 209 |
| 66 | 3300003544 | Ga0007417J51691_1063811 | Ga0007417J51691_10638112 | 209 |
| 67 | 3300003794 | Ga0055531_10000409 | Ga0055531_1000040912 | 209 |
| 68 | 3300004801 | Ga0058860_12155377 | Ga0058860_121553773 | 209 |
| 69 | 3300005262 | Ga0065165_1000831 | Ga0065165_100083149 | 209 |
| 70 | 3300005262 | Ga0065165_1059034 | Ga0065165_10590342 | 209 |
| 71 | 3300005337 | Ga0070682_100678995 | Ga0070682_1006789951 | 209 |
| 72 | 3300005347 | Ga0070668_100181543 | Ga0070668_1001815432 | 209 |
| 73 | 3300005365 | Ga0070688_100041186 | Ga0070688_1000411865 | 209 |
| 74 | 3300005435 | Ga0070714_100091865 | Ga0070714_1000918652 | 209 |
| 75 | 3300005436 | Ga0070713_101169406 | Ga0070713_1011694061 | 209 |
| 76 | 3300005456 | Ga0070678_100351006 | Ga0070678_1003510061 | 209 |
| 77 | 3300005563 | Ga0068855_100289382 | Ga0068855_1002893822 | 209 |
| 78 | 3300005563 | Ga0068855_100867665 | Ga0068855_1008676651 | 209 |
| 79 | 3300005577 | Ga0068857_100236793 | Ga0068857_1002367932 | 209 |
| 80 | 3300005614 | Ga0068856_100031219 | Ga0068856_1000312196 | 209 |
| 81 | 3300005616 | Ga0068852_101439434 | Ga0068852_1014394341 | 209 |
| 82 | 3300005618 | Ga0068864_100677165 | Ga0068864_1006771652 | 209 |
| 83 | 3300005841 | Ga0068863_100436656 | Ga0068863_1004366563 | 209 |
| 84 | 3300006173 | Ga0070716_100039818 | Ga0070716_1000398183 | 209 |
| 85 | 3300006353 | Ga0075370_10341066 | Ga0075370_103410662 | 209 |
| 86 | 3300006844 | Ga0075428_100013576 | Ga0075428_1000135762 | 209 |
| 87 | 3300006844 | Ga0075428_100182361 | Ga0075428_1001823613 | 209 |
| 88 | 3300006846 | Ga0075430_100076161 | Ga0075430_1000761612 | 209 |
| 89 | 3300006847 | Ga0075431_100328003 | Ga0075431_1003280032 | 209 |
| 90 | 3300009094 | Ga0111539_10013971 | Ga0111539_100139718 | 209 |
| 91 | 3300009094 | Ga0111539_10015243 | Ga0111539_1001524310 | 209 |
| 92 | 3300009176 | Ga0105242_10103549 | Ga0105242_101035493 | 209 |
| 93 | 3300009553 | Ga0105249_11637997 | Ga0105249_116379971 | 209 |
| 94 | 3300013104 | Ga0157370_10145310 | Ga0157370_101453103 | 209 |
| 95 | 3300013307 | Ga0157372_10000332 | Ga0157372_1000033234 | 209 |
| 96 | 3300013307 | Ga0157372_10965536 | Ga0157372_109655362 | 209 |
| 97 | 3300014326 | Ga0157380_10000051 | Ga0157380_100000516 | 209 |
| 98 | 3300014326 | Ga0157380_10006042 | Ga0157380_100060429 | 209 |
| 99 | 3300014969 | Ga0157376_10670759 | Ga0157376_106707592 | 209 |
| 100 | 3300020070 | Ga0206356_10873539 | Ga0206356_108735392 | 209 |
| 101 | 3300025298 | Ga0209050_1005534 | Ga0209050_10055346 | 209 |
| 102 | 3300025304 | Ga0209257_1000007 | Ga0209257_1000007340 | 209 |
| 103 | 3300025304 | Ga0209257_1024055 | Ga0209257_10240553 | 209 |
| 104 | 3300025913 | Ga0207695_10634758 | Ga0207695_106347582 | 209 |
| 105 | 3300025927 | Ga0207687_10089938 | Ga0207687_100899384 | 209 |
| 106 | 3300025934 | Ga0207686_10198597 | Ga0207686_101985973 | 209 |
| 107 | 3300025939 | Ga0207665_10050775 | Ga0207665_100507753 | 209 |
| 108 | 3300025949 | Ga0207667_10182531 | Ga0207667_101825312 | 209 |
| 109 | 3300025949 | Ga0207667_10189183 | Ga0207667_101891832 | 209 |
| 110 | 3300025949 | Ga0207667_10939292 | Ga0207667_109392921 | 209 |
| 111 | 3300026041 | Ga0207639_10470787 | Ga0207639_104707872 | 209 |
| 112 | 3300026067 | Ga0207678_10258902 | Ga0207678_102589023 | 209 |
| 113 | 3300026078 | Ga0207702_10023144 | Ga0207702_100231443 | 209 |
| 114 | 3300026088 | Ga0207641_10450750 | Ga0207641_104507502 | 209 |
| 115 | 3300026095 | Ga0207676_10567325 | Ga0207676_105673252 | 209 |
| 116 | 3300026095 | Ga0207676_10896913 | Ga0207676_108969131 | 209 |
| 117 | 3300026116 | Ga0207674_10145777 | Ga0207674_101457772 | 209 |
| 118 | 3300026121 | Ga0207683_10772674 | Ga0207683_107726742 | 209 |
| 119 | 3300027471 | Ga0209995_1030097 | Ga0209995_10300972 | 209 |
| 120 | 3300027876 | Ga0209974_10056787 | Ga0209974_100567873 | 209 |
| 121 | 3300027907 | Ga0207428_10076578 | Ga0207428_100765783 | 209 |
| 122 | 3300027907 | Ga0207428_10313406 | Ga0207428_103134062 | 209 |
| 123 | 3300028573 | Ga0265334_10018191 | Ga0265334_100181913 | 209 |
| 124 | 3300028794 | Ga0307515_10000009 | Ga0307515_10000009358 | 209 |
| 125 | 3300028794 | Ga0307515_10536201 | Ga0307515_105362011 | 209 |
| 126 | 3300028800 | Ga0265338_10001162 | Ga0265338_1000116219 | 209 |
| 127 | 3300028800 | Ga0265338_10001855 | Ga0265338_1000185536 | 209 |
| 128 | 3300028800 | Ga0265338_10143556 | Ga0265338_101435562 | 209 |
| 129 | 3300029957 | Ga0265324_10056854 | Ga0265324_100568542 | 209 |
| 130 | 3300031251 | Ga0265327_10000370 | Ga0265327_1000037031 | 209 |
| 131 | 3300031251 | Ga0265327_10127644 | Ga0265327_101276442 | 209 |
| 132 | 3300031456 | Ga0307513_10127710 | Ga0307513_101277103 | 209 |
| 133 | 3300031507 | Ga0307509_10007469 | Ga0307509_1000746912 | 209 |
| 134 | 3300031507 | Ga0307509_10165518 | Ga0307509_101655182 | 209 |
| 135 | 3300031548 | Ga0307408_100038382 | Ga0307408_1000383826 | 209 |
| 136 | 3300031649 | Ga0307514_10127372 | Ga0307514_101273722 | 209 |
| 137 | 3300031730 | Ga0307516_10090261 | Ga0307516_100902614 | 209 |
| 138 | 3300031824 | Ga0307413_10081698 | Ga0307413_100816982 | 209 |
| 139 | 3300031852 | Ga0307410_10788448 | Ga0307410_107884481 | 209 |
| 140 | 3300031911 | Ga0307412_10010885 | Ga0307412_100108858 | 209 |
| 141 | 3300031911 | Ga0307412_10276740 | Ga0307412_102767403 | 209 |
| 142 | 3300031995 | Ga0307409_100054022 | Ga0307409_1000540226 | 209 |
| 143 | 3300032002 | Ga0307416_100000249 | Ga0307416_10000024930 | 209 |
| 144 | 3300032004 | Ga0307414_10010589 | Ga0307414_100105892 | 209 |
| 145 | 3300032005 | Ga0307411_10133368 | Ga0307411_101333682 | 209 |
| 146 | 3300032126 | Ga0307415_100035567 | Ga0307415_1000355671 | 209 |
| 147 | 3300032126 | Ga0307415_100840353 | Ga0307415_1008403532 | 209 |
| 148 | 3300033541 | Ga0316596_1000052 | Ga0316596_10000522 | 209 |
| 149 | 3300035691 | Ga0373931_0139815 | Ga0373931_0139815_50_682 | 209 |
| 150 | 3300035695 | Ga0373927_0006959 | Ga0373927_0006959_4981_5613 | 209 |
| 151 | 3300036401 | Ga0373937_1032720 | Ga0373937_1032720_128_760 | 209 |
| 152 | 3300036712 | Ga0316584_0028755 | Ga0316584_0028755_518_1147 | 209 |
| 153 | 3300037471 | Ga0395905_0000376 | Ga0395905_0000376_31645_32274 | 209 |
| 154 | 3300038443 | Ga0395901_0002865 | Ga0395901_0002865_3742_4389 | 209 |
| 155 | 3300041454 | Ga0451799_02770 | Ga0451799_02770_724_1356 | 209 |
| 156 | 3300041455 | Ga0451801_20542 | Ga0451801_20542_119_751 | 209 |
| 157 | 3300041458 | Ga0451798_0296397 | Ga0451798_0296397_244_876 | 209 |
| 158 | 3300041460 | Ga0451802_1246725 | Ga0451802_1246725_526_1158 | 209 |
| 159 | 3300041461 | Ga0451805_091713 | Ga0451805_091713_719_1351 | 209 |
| 160 | 3300041464 | Ga0451808_16930 | Ga0451808_16930_717_1349 | 209 |
| 161 | 3300041494 | Ga0451837_1468151 | Ga0451837_1468151_72_707 | 209 |
| 162 | 3300041916 | Ga0452271_55409 | Ga0452271_55409_724_1356 | 209 |
| 163 | 3300042876 | Ga0451577_0058001 | Ga0451577_0058001_2151_2780 | 209 |
| 164 | 3300044673 | Ga0453683_0041549 | Ga0453683_0041549_661_1290 | 209 |
| 165 | 3300044673 | Ga0453683_0130278 | Ga0453683_0130278_904_1533 | 209 |
| 166 | 3300044712 | Ga0453684_0001121 | Ga0453684_0001121_56606_57235 | 209 |
| 167 | 3300044712 | Ga0453684_0005611 | Ga0453684_0005611_3996_4628 | 209 |
| 168 | 3300044712 | Ga0453684_0422724 | Ga0453684_0422724_135_767 | 209 |
| 169 | 3300044712 | Ga0453684_0777061 | Ga0453684_0777061_140_769 | 209 |
| 170 | 3300044712 | Ga0453684_1397031 | Ga0453684_1397031_47_685 | 209 |
| 171 | 3300045051 | Ga0451576_0000003 | Ga0451576_0000003_955837_956466 | 209 |
| 172 | 3300045051 | Ga0451576_0018019 | Ga0451576_0018019_5431_6063 | 209 |
| 173 | 3300045051 | Ga0451576_0051376 | Ga0451576_0051376_502_1134 | 209 |
| 174 | 3300045051 | Ga0451576_0063555 | Ga0451576_0063555_1266_1898 | 209 |
| 175 | 3300045051 | Ga0451576_0275888 | Ga0451576_0275888_438_1067 | 209 |
| 176 | 3300046460 | Ga0495638_0000040 | Ga0495638_0000040_138063_138695 | 209 |
| 177 | 3300046660 | Ga0495625_0247105 | Ga0495625_0247105_69_701 | 209 |
| 178 | 3300049127 | Ga0501306_000385 | Ga0501306_000385_2585_3217 | 209 |
| 179 | 3300049128 | Ga0501308_000775 | Ga0501308_000775_722_1354 | 209 |
| 180 | 3300049129 | Ga0501309_001746 | Ga0501309_001746_895_1527 | 209 |
| 181 | 3300049130 | Ga0501310_001315 | Ga0501310_001315_679_1311 | 209 |
| 182 | 3300049130 | Ga0501310_003146 | Ga0501310_003146_48_680 | 209 |
| 183 | 3300049160 | Ga0501304_000312 | Ga0501304_000312_722_1354 | 209 |
| 184 | 3300049161 | Ga0501305_002286 | Ga0501305_002286_693_1325 | 209 |
| 185 | 3300049161 | Ga0501305_006141 | Ga0501305_006141_722_1354 | 209 |
| 186 | 3300049162 | Ga0501307_000849 | Ga0501307_000849_722_1354 | 209 |
| 187 | 3300049162 | Ga0501307_007393 | Ga0501307_007393_559_1191 | 209 |
| 188 | 3300049527 | Ga0501311_028137 | Ga0501311_028137_65_697 | 209 |
| 189 | 3300049528 | Ga0501312_001574 | Ga0501312_001574_722_1354 | 209 |
| 190 | 3300049528 | Ga0501312_001811 | Ga0501312_001811_688_1320 | 209 |
| 191 | 3300049528 | Ga0501312_006953 | Ga0501312_006953_779_1411 | 209 |
| 192 | 3300049528 | Ga0501312_015404 | Ga0501312_015404_340_972 | 209 |
| 193 | 3300049529 | Ga0501313_000962 | Ga0501313_000962_758_1390 | 209 |
| 194 | 3300049531 | Ga0501315_001052 | Ga0501315_001052_895_1527 | 209 |
| 195 | 3300049532 | Ga0501316_001063 | Ga0501316_001063_895_1527 | 209 |
| 196 | 3300049533 | Ga0501317_001012 | Ga0501317_001012_726_1358 | 209 |
| 197 | 3300049533 | Ga0501317_001377 | Ga0501317_001377_772_1404 | 209 |
| 198 | 3300049536 | Ga0501320_005075 | Ga0501320_005075_63_695 | 209 |
| 199 | 3300049539 | Ga0501323_001214 | Ga0501323_001214_692_1324 | 209 |
| 200 | 3300049539 | Ga0501323_001344 | Ga0501323_001344_599_1231 | 209 |
| 201 | 3300049556 | Ga0501340_003465 | Ga0501340_003465_311_943 | 209 |
| 202 | 3300049654 | Ga0501207_023748 | Ga0501207_023748_352_984 | 209 |
| 203 | 3300049661 | Ga0501217_019788 | Ga0501217_019788_338_970 | 209 |
| 204 | 3300049661 | Ga0501217_091876 | Ga0501217_091876_97_729 | 209 |
| 205 | 3300049662 | Ga0501222_007248 | Ga0501222_007248_764_1396 | 209 |
| 206 | 3300049674 | Ga0501242_023640 | Ga0501242_023640_124_756 | 209 |
| 207 | 3300049686 | Ga0501257_003554 | Ga0501257_003554_1134_1766 | 209 |
| 208 | 3300049686 | Ga0501257_010822 | Ga0501257_010822_146_778 | 209 |
| 209 | 3300049688 | Ga0501259_006914 | Ga0501259_006914_1056_1688 | 209 |
| 210 | 3300049761 | Ga0501264_000532 | Ga0501264_000532_3141_3773 | 209 |
| 211 | 3300050493 | nmdc:mga0k408_111057_c1 | nmdc:mga0k408_111057_c1_721_1353 | 209 |
| 212 | 3300050511 | nmdc:mga08y16_10401_c1 | nmdc:mga08y16_10401_c1_5971_6606 | 209 |
| 213 | 3300053104 | Ga0500556_0011703 | Ga0500556_0011703_213_845 | 209 |
| 214 | 3300053108 | Ga0500562_021611 | Ga0500562_021611_843_1472 | 209 |
| 215 | 3300053108 | Ga0500562_046999 | Ga0500562_046999_67_699 | 209 |
| 216 | 3300053133 | Ga0500655_013596 | Ga0500655_013596_147_779 | 209 |
| 217 | 3300053151 | Ga0500604_0048634 | Ga0500604_0048634_418_1050 | 209 |
| 218 | 3300053153 | Ga0500616_0000013 | Ga0500616_0000013_173930_174562 | 209 |
| 219 | 3300053153 | Ga0500616_0044405 | Ga0500616_0044405_227_856 | 209 |
| 220 | 3300053156 | Ga0500622_0000113 | Ga0500622_0000113_81354_81986 | 209 |
| 221 | 3300053156 | Ga0500622_0000133 | Ga0500622_0000133_75563_76195 | 209 |
| 222 | 3300059493 | Ga0587077_044862 | Ga0587077_044862_60_692 | 209 |
| 223 | 3300059623 | Ga0587101_016841 | Ga0587101_016841_162_791 | 209 |
| 224 | 3300059641 | Ga0587068_002145 | Ga0587068_002145_725_1354 | 209 |
| 225 | 3300059641 | Ga0587068_006340 | Ga0587068_006340_732_1364 | 209 |
| 226 | 3300059641 | Ga0587068_006852 | Ga0587068_006852_228_860 | 209 |
| 227 | 3300059645 | Ga0587076_007530 | Ga0587076_007530_181_813 | 209 |
| 228 | 3300001979 | JGI24740J21852_10008519 | JGI24740J21852_100085193 | 210 |
| 229 | 3300005288 | Ga0065714_10007641 | Ga0065714_100076414 | 210 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c9a-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9201 | 10 | 208 |
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9112 | 1 | 208 |
| 8c9a-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.9025 | 10 | 208 |
| 8c9b-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8997 | 1 | 208 |
| 8c97-assembly1.cif.gz_E | cryo-em captures early ribosome assembly in action | 0.8974 | 3 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dmgA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.8167 | 1 | 208 | 3.40.1370.10 |
| 1dmgA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.8075 | 1 | 208 | 3.40.1370.10 |
| af_Q2FW07_2_206_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7737 | 1 | 207 | 3.40.1370.10 |
| af_Q2FW07_2_206_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7648 | 1 | 207 | 3.40.1370.10 |
| af_K7MAT5_102_317_3.40.1370.10 | Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 | 0.7474 | 1 | 210 | 3.40.1370.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A645EVZ5-F1-model_v4 | 50S ribosomal protein L4 | 0.96 | 101 | 208 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A645EVZ5-F1-model_v4 | 50S ribosomal protein L4 | 0.9429 | 101 | 208 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A2N0BF71-F1-model_v4 | deleted | 0.9253 | 91 | 210 |
|
| AF-A0A7S2Z7X8-F1-model_v4 | 50S ribosomal protein L4 | 0.909 | 112 | 210 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A538BFE4-F1-model_v4 | Large ribosomal subunit protein uL4 (50S ribosomal protein L4) | 0.9075 | 101 | 210 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar