F341833

General Info

Members Datasets Scaffolds Average Seq Length
229 152 225 209

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100867665|Ga0068855_1008676651
Length 215
Sequence MQVEVLNISGKKTTKKVELADSIFNVEPNDHCIYLDVKQHLANKRQGTHKSKERAEIARTTKKLKRQKGTGGARAGSMKSPLFIGGGRVFGPKPRDYSFKLNKKVKVVARASALTYKAKDNAITVLEDFNFEAPKTKNYSELMKNLNMSDKKTLLVLGGHNKNVYLSSRNIHGAKVVNASDLNTYDILNAQNLILSESSVKVIEQILNKQDGNSN

Samples

Sample ID Description Type Environment
1 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
2 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
3 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
4 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
68 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
93 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
94 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
95 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
96 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
97 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
98 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
99 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
100 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
101 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
102 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
128 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
129 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
130 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
131 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
132 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
133 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
134 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
135 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
136 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
137 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
140 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
141 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
142 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
143 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
144 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
145 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
146 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
147 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
148 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.86
Metatranscriptomes 21.4
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.04
Nodule 0
Rhizoplane 3.49
Rhizosphere 76.86
Stem 0
Stem Tuber 0
Unclassified 9.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008519 3300001979 Bacteria 4080
2 rootH1_10010612 3300003316 Bacteria 9244
3 rootH2_10003970 3300003320 Bacteria 33753
4 rootH2_10173412 3300003320 Bacteria 1915
5 rootL2_10010167 3300003322 Bacteria 22542
6 rootL2_10011247 3300003322 Bacteria 9421
7 rootL2_10015593 3300003322 Bacteria 11855
8 rootH1_10009782 3300003323 Bacteria 19748
9 rootH1_10012094 3300003323 Bacteria 18730
10 rootH1_10108515 3300003323 Bacteria 1780
11 rootH1_10109910 3300003323 Bacteria 1897
12 Ga0007417J51691_1063811 3300003544 Bacteria 1562
13 Ga0055531_10000409 3300003794 Bacteria 41322
14 Ga0058860_12155377 3300004801 Bacteria 1355
15 Ga0065165_1000831 3300005262 Bacteria 40595
16 Ga0065165_1059034 3300005262 Bacteria 1057
17 Ga0065714_10007641 3300005288 Bacteria 3489
18 Ga0070682_100678995 3300005337 Bacteria 823
19 Ga0070668_100181543 3300005347 Bacteria 1719
20 Ga0070688_100041186 3300005365 Bacteria 2834
21 Ga0070714_100091865 3300005435 Bacteria 2660
22 Ga0070713_101169406 3300005436 Bacteria 744
23 Ga0070678_100351006 3300005456 Bacteria 1268
24 Ga0068855_100289382 3300005563 Bacteria 1817
25 Ga0068855_100867665 3300005563 Bacteria 955
26 Ga0068857_100236793 3300005577 Bacteria 1670
27 Ga0068856_100031219 3300005614 Bacteria 5212
28 Ga0068856_100077827 3300005614 Bacteria 3287
29 Ga0068852_101439434 3300005616 Unclassified 711
30 Ga0068864_100677165 3300005618 Bacteria 1006
31 Ga0068863_100436656 3300005841 Bacteria 1283
32 Ga0070715_10085294 3300006163 Bacteria 1442
33 Ga0070716_100039818 3300006173 Bacteria 2611
34 Ga0075370_10341066 3300006353 Bacteria 894
35 Ga0075428_100013576 3300006844 Bacteria 9071
36 Ga0075428_100182361 3300006844 Bacteria 2272
37 Ga0075430_100076161 3300006846 Bacteria 2812
38 Ga0075431_100328003 3300006847 Bacteria 1542
39 Ga0111539_10013971 3300009094 Bacteria 10037
40 Ga0111539_10015243 3300009094 Bacteria 9574
41 Ga0105242_10103549 3300009176 Bacteria 2415
42 Ga0105242_10639314 3300009176 Bacteria 1033
43 Ga0105249_11637997 3300009553 Bacteria 716
44 Ga0157371_10054786 3300013102 Bacteria 2831
45 Ga0157370_10145310 3300013104 Bacteria 2209
46 Ga0157372_10000332 3300013307 Bacteria 51907
47 Ga0157372_10965536 3300013307 Bacteria 988
48 Ga0157380_10000051 3300014326 Bacteria 68466
49 Ga0157380_10006042 3300014326 Bacteria 8483
50 Ga0157376_10670759 3300014969 Bacteria 1039
51 Ga0206356_10873539 3300020070 Bacteria 1011
52 Ga0209050_1005534 3300025298 Bacteria 7892
53 Ga0209050_1049461 3300025298 Bacteria 1077
54 Ga0209257_1000007 3300025304 Bacteria 1564415
55 Ga0209257_1024055 3300025304 Bacteria 2120
56 Ga0207685_10046839 3300025905 Bacteria 1647
57 Ga0207695_10634758 3300025913 Bacteria 949
58 Ga0207687_10089938 3300025927 Bacteria 2236
59 Ga0207686_10198597 3300025934 Bacteria 1435
60 Ga0207665_10050775 3300025939 Bacteria 2790
61 Ga0207667_10182531 3300025949 Bacteria 2154
62 Ga0207667_10189183 3300025949 Bacteria 2112
63 Ga0207667_10939292 3300025949 Bacteria 855
64 Ga0207639_10470787 3300026041 Bacteria 1144
65 Ga0207678_10258902 3300026067 Bacteria 1491
66 Ga0207702_10023144 3300026078 Bacteria 5153
67 Ga0207641_10450750 3300026088 Bacteria 1243
68 Ga0207676_10567325 3300026095 Bacteria 1086
69 Ga0207676_10896913 3300026095 Bacteria 869
70 Ga0207674_10145777 3300026116 Bacteria 2326
71 Ga0207683_10772674 3300026121 Unclassified 891
72 Ga0209995_1030097 3300027471 Bacteria 908
73 Ga0209974_10056787 3300027876 Bacteria 1321
74 Ga0207428_10076578 3300027907 Bacteria 2619
75 Ga0207428_10313406 3300027907 Bacteria 1159
76 Ga0265334_10018191 3300028573 Bacteria 2898
77 Ga0265323_10000040 3300028653 Bacteria 70373
78 Ga0307515_10000009 3300028794 Bacteria 653206
79 Ga0307515_10536201 3300028794 Bacteria 780
80 Ga0265338_10001162 3300028800 Bacteria 43495
81 Ga0265338_10001855 3300028800 Bacteria 33207
82 Ga0265338_10143556 3300028800 Bacteria 1866
83 Ga0265324_10056854 3300029957 Bacteria 1340
84 Ga0265327_10000370 3300031251 Bacteria 84921
85 Ga0265327_10127644 3300031251 Bacteria 1199
86 Ga0265316_10000486 3300031344 Bacteria 45040
87 Ga0307513_10127710 3300031456 Bacteria 2494
88 Ga0307509_10007469 3300031507 Bacteria 14263
89 Ga0307509_10165518 3300031507 Bacteria 2101
90 Ga0307408_100000648 3300031548 Bacteria 29197
91 Ga0307408_100038382 3300031548 Bacteria 3379
92 Ga0307514_10127372 3300031649 Bacteria 1761
93 Ga0316576_10021298 3300031727 Bacteria 4482
94 Ga0316578_10015477 3300031728 Bacteria 4102
95 Ga0307516_10090261 3300031730 Bacteria 2893
96 Ga0307413_10081698 3300031824 Bacteria 2073
97 Ga0307410_10788448 3300031852 Bacteria 807
98 Ga0307412_10010885 3300031911 Bacteria 5251
99 Ga0307412_10276740 3300031911 Bacteria 1316
100 Ga0307409_100054022 3300031995 Bacteria 3091
101 Ga0307416_100000249 3300032002 Bacteria 28628
102 Ga0307414_10010589 3300032004 Bacteria 5360
103 Ga0307411_10133368 3300032005 Bacteria 1819
104 Ga0307415_100035567 3300032126 Bacteria 3254
105 Ga0307415_100840353 3300032126 Unclassified 842
106 Ga0316596_1000052 3300033541 Bacteria 12700
107 Ga0316596_1006083 3300033541 Bacteria 2790
108 Ga0373931_0139815 3300035691 Bacteria 1401
109 Ga0373927_0006959 3300035695 Bacteria 7677
110 Ga0373937_1032720 3300036401 Bacteria 771
111 Ga0316582_0115197 3300036647 Bacteria 1793
112 Ga0316584_0001842 3300036712 Bacteria 13121
113 Ga0316584_0028755 3300036712 Bacteria 4102
114 Ga0395899_0000673 3300037312 Bacteria 34566
115 Ga0395900_0541447 3300037418 Bacteria 1110
116 Ga0395905_0000001 3300037471 Bacteria 2037079
117 Ga0395905_0000376 3300037471 Bacteria 63695
118 Ga0395905_0308049 3300037471 Bacteria 1472
119 Ga0395901_0002865 3300038443 Bacteria 17414
120 Ga0400488_36638 3300038741 Bacteria 1290
121 Ga0451799_02770 3300041454 Bacteria 1535
122 Ga0451801_20542 3300041455 Bacteria 768
123 Ga0451795_0578569 3300041456 Bacteria 1331
124 Ga0451795_1060327 3300041456 Bacteria 2256
125 Ga0451798_0296397 3300041458 Bacteria 1150
126 Ga0451802_1246725 3300041460 Bacteria 1269
127 Ga0451805_091713 3300041461 Bacteria 3245
128 Ga0451808_16930 3300041464 Bacteria 2421
129 Ga0451837_1468151 3300041494 Bacteria 1012
130 Ga0452271_55409 3300041916 Bacteria 1788
131 Ga0439460_0002577 3300042461 Bacteria 4377
132 Ga0451577_0058001 3300042876 Bacteria 3451
133 Ga0451577_0092287 3300042876 Bacteria 2703
134 Ga0453683_0041549 3300044673 Bacteria 2888
135 Ga0453683_0130278 3300044673 Bacteria 1585
136 Ga0453684_0001121 3300044712 Bacteria 83919
137 Ga0453684_0001193 3300044712 Bacteria 80343
138 Ga0453684_0005611 3300044712 Bacteria 24695
139 Ga0453684_0007136 3300044712 Bacteria 20809
140 Ga0453684_0012498 3300044712 Bacteria 13983
141 Ga0453684_0092022 3300044712 Bacteria 3741
142 Ga0453684_0164783 3300044712 Bacteria 2618
143 Ga0453684_0315852 3300044712 Bacteria 1771
144 Ga0453684_0414653 3300044712 Bacteria 1506
145 Ga0453684_0422724 3300044712 Bacteria 1488
146 Ga0453684_0777061 3300044712 Bacteria 1035
147 Ga0453684_1397031 3300044712 Bacteria 726
148 Ga0451576_0000003 3300045051 Bacteria 1550573
149 Ga0451576_0010522 3300045051 Bacteria 10601
150 Ga0451576_0018019 3300045051 Bacteria 7749
151 Ga0451576_0051376 3300045051 Bacteria 4322
152 Ga0451576_0063555 3300045051 Bacteria 3848
153 Ga0451576_0275888 3300045051 Bacteria 1758
154 Ga0451576_0409141 3300045051 Bacteria 1423
155 Ga0495638_0000040 3300046460 Bacteria 241883
156 Ga0495625_0247105 3300046660 Bacteria 1159
157 Ga0501306_000385 3300049127 Bacteria 3273
158 Ga0501306_025537 3300049127 Bacteria 851
159 Ga0501308_000775 3300049128 Bacteria 2277
160 Ga0501309_001746 3300049129 Bacteria 2213
161 Ga0501309_004788 3300049129 Bacteria 1588
162 Ga0501309_058333 3300049129 Bacteria 617
163 Ga0501310_001315 3300049130 Bacteria 2236
164 Ga0501310_003146 3300049130 Bacteria 1605
165 Ga0501304_000312 3300049160 Bacteria 2329
166 Ga0501305_002286 3300049161 Bacteria 2044
167 Ga0501305_006141 3300049161 Bacteria 1482
168 Ga0501305_011468 3300049161 Bacteria 1198
169 Ga0501307_000311 3300049162 Bacteria 3032
170 Ga0501307_000849 3300049162 Bacteria 2333
171 Ga0501307_007393 3300049162 Bacteria 1210
172 Ga0501311_028137 3300049527 Bacteria 801
173 Ga0501312_001574 3300049528 Bacteria 2277
174 Ga0501312_001811 3300049528 Bacteria 2194
175 Ga0501312_006953 3300049528 Bacteria 1429
176 Ga0501312_015404 3300049528 Bacteria 1084
177 Ga0501313_000962 3300049529 Bacteria 2282
178 Ga0501315_001052 3300049531 Bacteria 2214
179 Ga0501315_003624 3300049531 Bacteria 1557
180 Ga0501316_001063 3300049532 Bacteria 2214
181 Ga0501316_039431 3300049532 Bacteria 655
182 Ga0501317_001012 3300049533 Bacteria 2282
183 Ga0501317_001377 3300049533 Bacteria 2090
184 Ga0501320_005075 3300049536 Bacteria 1186
185 Ga0501323_001214 3300049539 Bacteria 2216
186 Ga0501323_001344 3300049539 Bacteria 2153
187 Ga0501335_018507 3300049551 Unclassified 730
188 Ga0501340_003465 3300049556 Bacteria 958
189 Ga0501032_0375687 3300049569 Bacteria 914
190 Ga0501198_012021 3300049649 Bacteria 1297
191 Ga0501207_023748 3300049654 Bacteria 997
192 Ga0501217_019788 3300049661 Bacteria 1575
193 Ga0501217_091876 3300049661 Bacteria 853
194 Ga0501222_007248 3300049662 Bacteria 1481
195 Ga0501223_003765 3300049663 Bacteria 3276
196 Ga0501242_023640 3300049674 Bacteria 803
197 Ga0501257_003554 3300049686 Bacteria 3354
198 Ga0501257_010822 3300049686 Bacteria 2075
199 Ga0501257_034459 3300049686 Bacteria 1229
200 Ga0501259_006914 3300049688 Bacteria 1810
201 Ga0501241_000113 3300049758 Bacteria 17544
202 Ga0501264_000532 3300049761 Bacteria 5587
203 nmdc:mga0k408_111057_c1 3300050493 Bacteria 1620
204 nmdc:mga0k408_296364_c1 3300050493 Bacteria 965
205 nmdc:mga08y16_10401_c1 3300050511 Bacteria 9761
206 Ga0500578_0263911 3300053086 Bacteria 1033
207 Ga0500644_0037696 3300053088 Bacteria 1582
208 Ga0500556_0011703 3300053104 Bacteria 2603
209 Ga0500562_021611 3300053108 Bacteria 1676
210 Ga0500562_046999 3300053108 Bacteria 1151
211 Ga0500652_076474 3300053131 Bacteria 1392
212 Ga0500655_013596 3300053133 Bacteria 1486
213 Ga0500604_0048634 3300053151 Bacteria 1302
214 Ga0500616_0000013 3300053153 Bacteria 674172
215 Ga0500616_0044405 3300053153 Bacteria 2371
216 Ga0500622_0000113 3300053156 Bacteria 83196
217 Ga0500622_0000133 3300053156 Bacteria 78532
218 Ga0500622_0007455 3300053156 Bacteria 6212
219 Ga0587077_044862 3300059493 Bacteria 902
220 Ga0587101_016841 3300059623 Bacteria 1006
221 Ga0587068_002145 3300059641 Bacteria 2359
222 Ga0587068_006340 3300059641 Bacteria 1653
223 Ga0587068_006852 3300059641 Bacteria 1608
224 Ga0587076_007530 3300059645 Bacteria 1490
225 Ga0587079_000249 3300059647 Bacteria 4161

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049129 Ga0501309_058333 Ga0501309_058333_19_585 187
2 3300049531 Ga0501315_003624 Ga0501315_003624_962_1528 187
3 3300050493 nmdc:mga0k408_296364_c1 nmdc:mga0k408_296364_c1_373_939 187
4 3300053131 Ga0500652_076474 Ga0500652_076474_103_669 187
5 3300049686 Ga0501257_034459 Ga0501257_034459_129_761 190
6 3300049532 Ga0501316_039431 Ga0501316_039431_64_645 193
7 3300031727 Ga0316576_10021298 Ga0316576_100212984 196
8 3300049569 Ga0501032_0375687 Ga0501032_0375687_118_750 197
9 3300049129 Ga0501309_004788 Ga0501309_004788_86_694 201
10 iso_pu_bacteria 2890804823 2890807163 204
11 3300042461 Ga0439460_0002577 Ga0439460_0002577_752_1378 205
12 iso_pu_bacteria 2884634485 2884637382 205
13 iso_pu_bacteria 2910245624 2910249760 205
14 iso_pu_bacteria 2919692658 2919697453 205
15 3300006163 Ga0070715_10085294 Ga0070715_100852942 206
16 3300025905 Ga0207685_10046839 Ga0207685_100468393 206
17 3300033541 Ga0316596_1006083 Ga0316596_10060832 206
18 3300044712 Ga0453684_0007136 Ga0453684_0007136_1161_1784 206
19 3300049551 Ga0501335_018507 Ga0501335_018507_66_686 206
20 3300028653 Ga0265323_10000040 Ga0265323_1000004069 207
21 3300031344 Ga0265316_10000486 Ga0265316_1000048647 207
22 3300038741 Ga0400488_36638 Ga0400488_36638_548_1171 207
23 3300042876 Ga0451577_0092287 Ga0451577_0092287_114_737 207
24 3300044712 Ga0453684_0001193 Ga0453684_0001193_72700_73323 207
25 3300044712 Ga0453684_0012498 Ga0453684_0012498_11964_12587 207
26 3300044712 Ga0453684_0092022 Ga0453684_0092022_2862_3485 207
27 3300044712 Ga0453684_0164783 Ga0453684_0164783_648_1271 207
28 3300044712 Ga0453684_0315852 Ga0453684_0315852_987_1610 207
29 3300044712 Ga0453684_0414653 Ga0453684_0414653_209_832 207
30 3300003320 rootH2_10173412 rootH2_101734122 208
31 3300005614 Ga0068856_100077827 Ga0068856_1000778272 208
32 3300009176 Ga0105242_10639314 Ga0105242_106393141 208
33 3300013102 Ga0157371_10054786 Ga0157371_100547863 208
34 3300025298 Ga0209050_1049461 Ga0209050_10494612 208
35 3300031548 Ga0307408_100000648 Ga0307408_10000064822 208
36 3300031728 Ga0316578_10015477 Ga0316578_100154775 208
37 3300036647 Ga0316582_0115197 Ga0316582_0115197_362_988 208
38 3300036712 Ga0316584_0001842 Ga0316584_0001842_2228_2854 208
39 3300037312 Ga0395899_0000673 Ga0395899_0000673_24365_24991 208
40 3300037418 Ga0395900_0541447 Ga0395900_0541447_397_1023 208
41 3300037471 Ga0395905_0000001 Ga0395905_0000001_275391_276017 208
42 3300037471 Ga0395905_0308049 Ga0395905_0308049_360_986 208
43 3300041456 Ga0451795_0578569 Ga0451795_0578569_143_769 208
44 3300041456 Ga0451795_1060327 Ga0451795_1060327_1068_1694 208
45 3300045051 Ga0451576_0010522 Ga0451576_0010522_4912_5538 208
46 3300045051 Ga0451576_0409141 Ga0451576_0409141_371_997 208
47 3300049127 Ga0501306_025537 Ga0501306_025537_141_767 208
48 3300049161 Ga0501305_011468 Ga0501305_011468_222_848 208
49 3300049162 Ga0501307_000311 Ga0501307_000311_1007_1633 208
50 3300049649 Ga0501198_012021 Ga0501198_012021_283_909 208
51 3300049663 Ga0501223_003765 Ga0501223_003765_1768_2394 208
52 3300049758 Ga0501241_000113 Ga0501241_000113_8654_9280 208
53 3300053086 Ga0500578_0263911 Ga0500578_0263911_244_870 208
54 3300053088 Ga0500644_0037696 Ga0500644_0037696_271_897 208
55 3300053156 Ga0500622_0007455 Ga0500622_0007455_5265_5891 208
56 3300059647 Ga0587079_000249 Ga0587079_000249_991_1617 208
57 3300003316 rootH1_10010612 rootH1_1001061214 209
58 3300003320 rootH2_10003970 rootH2_1000397025 209
59 3300003322 rootL2_10010167 rootL2_1001016726 209
60 3300003322 rootL2_10011247 rootL2_100112476 209
61 3300003322 rootL2_10015593 rootL2_100155931 209
62 3300003323 rootH1_10009782 rootH1_1000978218 209
63 3300003323 rootH1_10012094 rootH1_1001209421 209
64 3300003323 rootH1_10108515 rootH1_101085153 209
65 3300003323 rootH1_10109910 rootH1_101099102 209
66 3300003544 Ga0007417J51691_1063811 Ga0007417J51691_10638112 209
67 3300003794 Ga0055531_10000409 Ga0055531_1000040912 209
68 3300004801 Ga0058860_12155377 Ga0058860_121553773 209
69 3300005262 Ga0065165_1000831 Ga0065165_100083149 209
70 3300005262 Ga0065165_1059034 Ga0065165_10590342 209
71 3300005337 Ga0070682_100678995 Ga0070682_1006789951 209
72 3300005347 Ga0070668_100181543 Ga0070668_1001815432 209
73 3300005365 Ga0070688_100041186 Ga0070688_1000411865 209
74 3300005435 Ga0070714_100091865 Ga0070714_1000918652 209
75 3300005436 Ga0070713_101169406 Ga0070713_1011694061 209
76 3300005456 Ga0070678_100351006 Ga0070678_1003510061 209
77 3300005563 Ga0068855_100289382 Ga0068855_1002893822 209
78 3300005563 Ga0068855_100867665 Ga0068855_1008676651 209
79 3300005577 Ga0068857_100236793 Ga0068857_1002367932 209
80 3300005614 Ga0068856_100031219 Ga0068856_1000312196 209
81 3300005616 Ga0068852_101439434 Ga0068852_1014394341 209
82 3300005618 Ga0068864_100677165 Ga0068864_1006771652 209
83 3300005841 Ga0068863_100436656 Ga0068863_1004366563 209
84 3300006173 Ga0070716_100039818 Ga0070716_1000398183 209
85 3300006353 Ga0075370_10341066 Ga0075370_103410662 209
86 3300006844 Ga0075428_100013576 Ga0075428_1000135762 209
87 3300006844 Ga0075428_100182361 Ga0075428_1001823613 209
88 3300006846 Ga0075430_100076161 Ga0075430_1000761612 209
89 3300006847 Ga0075431_100328003 Ga0075431_1003280032 209
90 3300009094 Ga0111539_10013971 Ga0111539_100139718 209
91 3300009094 Ga0111539_10015243 Ga0111539_1001524310 209
92 3300009176 Ga0105242_10103549 Ga0105242_101035493 209
93 3300009553 Ga0105249_11637997 Ga0105249_116379971 209
94 3300013104 Ga0157370_10145310 Ga0157370_101453103 209
95 3300013307 Ga0157372_10000332 Ga0157372_1000033234 209
96 3300013307 Ga0157372_10965536 Ga0157372_109655362 209
97 3300014326 Ga0157380_10000051 Ga0157380_100000516 209
98 3300014326 Ga0157380_10006042 Ga0157380_100060429 209
99 3300014969 Ga0157376_10670759 Ga0157376_106707592 209
100 3300020070 Ga0206356_10873539 Ga0206356_108735392 209
101 3300025298 Ga0209050_1005534 Ga0209050_10055346 209
102 3300025304 Ga0209257_1000007 Ga0209257_1000007340 209
103 3300025304 Ga0209257_1024055 Ga0209257_10240553 209
104 3300025913 Ga0207695_10634758 Ga0207695_106347582 209
105 3300025927 Ga0207687_10089938 Ga0207687_100899384 209
106 3300025934 Ga0207686_10198597 Ga0207686_101985973 209
107 3300025939 Ga0207665_10050775 Ga0207665_100507753 209
108 3300025949 Ga0207667_10182531 Ga0207667_101825312 209
109 3300025949 Ga0207667_10189183 Ga0207667_101891832 209
110 3300025949 Ga0207667_10939292 Ga0207667_109392921 209
111 3300026041 Ga0207639_10470787 Ga0207639_104707872 209
112 3300026067 Ga0207678_10258902 Ga0207678_102589023 209
113 3300026078 Ga0207702_10023144 Ga0207702_100231443 209
114 3300026088 Ga0207641_10450750 Ga0207641_104507502 209
115 3300026095 Ga0207676_10567325 Ga0207676_105673252 209
116 3300026095 Ga0207676_10896913 Ga0207676_108969131 209
117 3300026116 Ga0207674_10145777 Ga0207674_101457772 209
118 3300026121 Ga0207683_10772674 Ga0207683_107726742 209
119 3300027471 Ga0209995_1030097 Ga0209995_10300972 209
120 3300027876 Ga0209974_10056787 Ga0209974_100567873 209
121 3300027907 Ga0207428_10076578 Ga0207428_100765783 209
122 3300027907 Ga0207428_10313406 Ga0207428_103134062 209
123 3300028573 Ga0265334_10018191 Ga0265334_100181913 209
124 3300028794 Ga0307515_10000009 Ga0307515_10000009358 209
125 3300028794 Ga0307515_10536201 Ga0307515_105362011 209
126 3300028800 Ga0265338_10001162 Ga0265338_1000116219 209
127 3300028800 Ga0265338_10001855 Ga0265338_1000185536 209
128 3300028800 Ga0265338_10143556 Ga0265338_101435562 209
129 3300029957 Ga0265324_10056854 Ga0265324_100568542 209
130 3300031251 Ga0265327_10000370 Ga0265327_1000037031 209
131 3300031251 Ga0265327_10127644 Ga0265327_101276442 209
132 3300031456 Ga0307513_10127710 Ga0307513_101277103 209
133 3300031507 Ga0307509_10007469 Ga0307509_1000746912 209
134 3300031507 Ga0307509_10165518 Ga0307509_101655182 209
135 3300031548 Ga0307408_100038382 Ga0307408_1000383826 209
136 3300031649 Ga0307514_10127372 Ga0307514_101273722 209
137 3300031730 Ga0307516_10090261 Ga0307516_100902614 209
138 3300031824 Ga0307413_10081698 Ga0307413_100816982 209
139 3300031852 Ga0307410_10788448 Ga0307410_107884481 209
140 3300031911 Ga0307412_10010885 Ga0307412_100108858 209
141 3300031911 Ga0307412_10276740 Ga0307412_102767403 209
142 3300031995 Ga0307409_100054022 Ga0307409_1000540226 209
143 3300032002 Ga0307416_100000249 Ga0307416_10000024930 209
144 3300032004 Ga0307414_10010589 Ga0307414_100105892 209
145 3300032005 Ga0307411_10133368 Ga0307411_101333682 209
146 3300032126 Ga0307415_100035567 Ga0307415_1000355671 209
147 3300032126 Ga0307415_100840353 Ga0307415_1008403532 209
148 3300033541 Ga0316596_1000052 Ga0316596_10000522 209
149 3300035691 Ga0373931_0139815 Ga0373931_0139815_50_682 209
150 3300035695 Ga0373927_0006959 Ga0373927_0006959_4981_5613 209
151 3300036401 Ga0373937_1032720 Ga0373937_1032720_128_760 209
152 3300036712 Ga0316584_0028755 Ga0316584_0028755_518_1147 209
153 3300037471 Ga0395905_0000376 Ga0395905_0000376_31645_32274 209
154 3300038443 Ga0395901_0002865 Ga0395901_0002865_3742_4389 209
155 3300041454 Ga0451799_02770 Ga0451799_02770_724_1356 209
156 3300041455 Ga0451801_20542 Ga0451801_20542_119_751 209
157 3300041458 Ga0451798_0296397 Ga0451798_0296397_244_876 209
158 3300041460 Ga0451802_1246725 Ga0451802_1246725_526_1158 209
159 3300041461 Ga0451805_091713 Ga0451805_091713_719_1351 209
160 3300041464 Ga0451808_16930 Ga0451808_16930_717_1349 209
161 3300041494 Ga0451837_1468151 Ga0451837_1468151_72_707 209
162 3300041916 Ga0452271_55409 Ga0452271_55409_724_1356 209
163 3300042876 Ga0451577_0058001 Ga0451577_0058001_2151_2780 209
164 3300044673 Ga0453683_0041549 Ga0453683_0041549_661_1290 209
165 3300044673 Ga0453683_0130278 Ga0453683_0130278_904_1533 209
166 3300044712 Ga0453684_0001121 Ga0453684_0001121_56606_57235 209
167 3300044712 Ga0453684_0005611 Ga0453684_0005611_3996_4628 209
168 3300044712 Ga0453684_0422724 Ga0453684_0422724_135_767 209
169 3300044712 Ga0453684_0777061 Ga0453684_0777061_140_769 209
170 3300044712 Ga0453684_1397031 Ga0453684_1397031_47_685 209
171 3300045051 Ga0451576_0000003 Ga0451576_0000003_955837_956466 209
172 3300045051 Ga0451576_0018019 Ga0451576_0018019_5431_6063 209
173 3300045051 Ga0451576_0051376 Ga0451576_0051376_502_1134 209
174 3300045051 Ga0451576_0063555 Ga0451576_0063555_1266_1898 209
175 3300045051 Ga0451576_0275888 Ga0451576_0275888_438_1067 209
176 3300046460 Ga0495638_0000040 Ga0495638_0000040_138063_138695 209
177 3300046660 Ga0495625_0247105 Ga0495625_0247105_69_701 209
178 3300049127 Ga0501306_000385 Ga0501306_000385_2585_3217 209
179 3300049128 Ga0501308_000775 Ga0501308_000775_722_1354 209
180 3300049129 Ga0501309_001746 Ga0501309_001746_895_1527 209
181 3300049130 Ga0501310_001315 Ga0501310_001315_679_1311 209
182 3300049130 Ga0501310_003146 Ga0501310_003146_48_680 209
183 3300049160 Ga0501304_000312 Ga0501304_000312_722_1354 209
184 3300049161 Ga0501305_002286 Ga0501305_002286_693_1325 209
185 3300049161 Ga0501305_006141 Ga0501305_006141_722_1354 209
186 3300049162 Ga0501307_000849 Ga0501307_000849_722_1354 209
187 3300049162 Ga0501307_007393 Ga0501307_007393_559_1191 209
188 3300049527 Ga0501311_028137 Ga0501311_028137_65_697 209
189 3300049528 Ga0501312_001574 Ga0501312_001574_722_1354 209
190 3300049528 Ga0501312_001811 Ga0501312_001811_688_1320 209
191 3300049528 Ga0501312_006953 Ga0501312_006953_779_1411 209
192 3300049528 Ga0501312_015404 Ga0501312_015404_340_972 209
193 3300049529 Ga0501313_000962 Ga0501313_000962_758_1390 209
194 3300049531 Ga0501315_001052 Ga0501315_001052_895_1527 209
195 3300049532 Ga0501316_001063 Ga0501316_001063_895_1527 209
196 3300049533 Ga0501317_001012 Ga0501317_001012_726_1358 209
197 3300049533 Ga0501317_001377 Ga0501317_001377_772_1404 209
198 3300049536 Ga0501320_005075 Ga0501320_005075_63_695 209
199 3300049539 Ga0501323_001214 Ga0501323_001214_692_1324 209
200 3300049539 Ga0501323_001344 Ga0501323_001344_599_1231 209
201 3300049556 Ga0501340_003465 Ga0501340_003465_311_943 209
202 3300049654 Ga0501207_023748 Ga0501207_023748_352_984 209
203 3300049661 Ga0501217_019788 Ga0501217_019788_338_970 209
204 3300049661 Ga0501217_091876 Ga0501217_091876_97_729 209
205 3300049662 Ga0501222_007248 Ga0501222_007248_764_1396 209
206 3300049674 Ga0501242_023640 Ga0501242_023640_124_756 209
207 3300049686 Ga0501257_003554 Ga0501257_003554_1134_1766 209
208 3300049686 Ga0501257_010822 Ga0501257_010822_146_778 209
209 3300049688 Ga0501259_006914 Ga0501259_006914_1056_1688 209
210 3300049761 Ga0501264_000532 Ga0501264_000532_3141_3773 209
211 3300050493 nmdc:mga0k408_111057_c1 nmdc:mga0k408_111057_c1_721_1353 209
212 3300050511 nmdc:mga08y16_10401_c1 nmdc:mga08y16_10401_c1_5971_6606 209
213 3300053104 Ga0500556_0011703 Ga0500556_0011703_213_845 209
214 3300053108 Ga0500562_021611 Ga0500562_021611_843_1472 209
215 3300053108 Ga0500562_046999 Ga0500562_046999_67_699 209
216 3300053133 Ga0500655_013596 Ga0500655_013596_147_779 209
217 3300053151 Ga0500604_0048634 Ga0500604_0048634_418_1050 209
218 3300053153 Ga0500616_0000013 Ga0500616_0000013_173930_174562 209
219 3300053153 Ga0500616_0044405 Ga0500616_0044405_227_856 209
220 3300053156 Ga0500622_0000113 Ga0500622_0000113_81354_81986 209
221 3300053156 Ga0500622_0000133 Ga0500622_0000133_75563_76195 209
222 3300059493 Ga0587077_044862 Ga0587077_044862_60_692 209
223 3300059623 Ga0587101_016841 Ga0587101_016841_162_791 209
224 3300059641 Ga0587068_002145 Ga0587068_002145_725_1354 209
225 3300059641 Ga0587068_006340 Ga0587068_006340_732_1364 209
226 3300059641 Ga0587068_006852 Ga0587068_006852_228_860 209
227 3300059645 Ga0587076_007530 Ga0587076_007530_181_813 209
228 3300001979 JGI24740J21852_10008519 JGI24740J21852_100085193 210
229 3300005288 Ga0065714_10007641 Ga0065714_100076414 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00573

Ribosomal_L4

Ribosomal protein L4/L1 family

17

206

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9201 10 208
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9112 1 208
8c9a-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.9025 10 208
8c9b-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8997 1 208
8c97-assembly1.cif.gz_E cryo-em captures early ribosome assembly in action 0.8974 3 208
ID Description Score Start End Superfamily
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.8167 1 208 3.40.1370.10
1dmgA00 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.8075 1 208 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7737 1 207 3.40.1370.10
af_Q2FW07_2_206_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7648 1 207 3.40.1370.10
af_K7MAT5_102_317_3.40.1370.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L4; Chain: A;;Ribosomal protein L4/L1 0.7474 1 210 3.40.1370.10
ID Description Score Start End GO Terms
AF-A0A645EVZ5-F1-model_v4 50S ribosomal protein L4 0.96 101 208 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A645EVZ5-F1-model_v4 50S ribosomal protein L4 0.9429 101 208 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2N0BF71-F1-model_v4 deleted 0.9253 91 210
AF-A0A7S2Z7X8-F1-model_v4 50S ribosomal protein L4 0.909 112 210 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A538BFE4-F1-model_v4 Large ribosomal subunit protein uL4 (50S ribosomal protein L4) 0.9075 101 210 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
82.48 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map