F324231

General Info

Members Datasets Scaffolds Average Seq Length
213 145 202 268

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100217913|Ga0307416_1002179132
Length 300
Sequence VTKLAGKSLAMRSGGFAAMIAPDEIELRRSSLAKSSTRIRVGVGGWTYEPWRSNFYPEGLPHSRELEYASRQLTAIEINGTYYSTQKPASFAKWRDETPEDFVFSMKASRYATNRKVLGEAGESVQRFVGSGIAQLGPKLGPVVWQFMPTKRFDADDFEAFLKLLPDQVEGLPLRHVMDVRHESFKSPDYLALAKKYRVASVFTDSDDYPSFADLTTDFVYARLMRSDAKLKAGYAPKSLDEWAERAAQWAAGGEPADLPRVGEKPAPKKARDVFIYFISSAKERNPAAAMALIERVAPR

Samples

Sample ID Description Type Environment
1 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
2 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
3 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
4 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
5 2643221607 Rhizobium sp. Root73 Isolate Unclassified
6 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
7 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
8 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
9 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
10 2941479691
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
86 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
98 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
105 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
106 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
114 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
115 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
130 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
134 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
135 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
136 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
137 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
138 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
139 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
140 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
141 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
142 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
143 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
144 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
145 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.84
Metatranscriptomes 0
Isolates 5.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.43
Nodule 0.47
Rhizoplane 0.47
Rhizosphere 61.5
Stem 0
Stem Tuber 0
Unclassified 21.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055524_1001503 3300003775 Bacteria 13222
2 Ga0070658_10369373 3300005327 Bacteria 1230
3 Ga0070676_10010946 3300005328 Bacteria 4929
4 Ga0070676_10066840 3300005328 Bacteria 2148
5 Ga0070670_100113766 3300005331 Bacteria 2333
6 Ga0068869_100001957 3300005334 Bacteria 12337
7 Ga0068868_100300818 3300005338 Bacteria 1362
8 Ga0068868_100358102 3300005338 Bacteria 1251
9 Ga0070675_100004483 3300005354 Bacteria 10658
10 Ga0070671_100083694 3300005355 Bacteria 2668
11 Ga0070671_100180959 3300005355 Bacteria 1784
12 Ga0070673_100019023 3300005364 Bacteria 4925
13 Ga0070667_100000975 3300005367 Bacteria 26309
14 Ga0070663_100001291 3300005455 Bacteria 13730
15 Ga0070678_100321190 3300005456 Bacteria 1322
16 Ga0068867_100016157 3300005459 Bacteria 5302
17 Ga0068867_100059733 3300005459 Bacteria 2826
18 Ga0068867_100078185 3300005459 Bacteria 2488
19 Ga0070706_100001239 3300005467 Bacteria 27289
20 Ga0070707_100148366 3300005468 Bacteria 2283
21 Ga0068853_100001824 3300005539 Bacteria 15667
22 Ga0070672_100024174 3300005543 Bacteria 4485
23 Ga0070665_100009963 3300005548 Bacteria 9612
24 Ga0068857_100047402 3300005577 Bacteria 3815
25 Ga0068852_100012632 3300005616 Bacteria 6421
26 Ga0068852_100290794 3300005616 Bacteria 1578
27 Ga0068864_100043153 3300005618 Bacteria 3861
28 Ga0068863_100023313 3300005841 Bacteria 5913
29 Ga0068863_100297957 3300005841 Bacteria 1564
30 Ga0075367_10030656 3300006178 Bacteria 3084
31 Ga0075367_10055614 3300006178 Bacteria 2349
32 Ga0075366_10000111 3300006195 Bacteria 33316
33 Ga0075366_10003361 3300006195 Bacteria 8422
34 Ga0075366_10021743 3300006195 Bacteria 3730
35 Ga0075366_10097927 3300006195 Bacteria 1759
36 Ga0097621_100301365 3300006237 Bacteria 1415
37 Ga0075370_10001093 3300006353 Bacteria 11305
38 Ga0075370_10021549 3300006353 Bacteria 3531
39 Ga0075370_10190849 3300006353 Bacteria 1207
40 Ga0075430_100121671 3300006846 Bacteria 2176
41 Ga0075429_100005450 3300006880 Bacteria 10959
42 Ga0105245_10134407 3300009098 Bacteria 2323
43 Ga0105243_10010079 3300009148 Bacteria 7185
44 Ga0105248_10505625 3300009177 Bacteria 1362
45 Ga0157378_10131246 3300013297 Bacteria 2319
46 Ga0157378_10233655 3300013297 Bacteria 1753
47 Ga0163162_10331255 3300013306 Bacteria 1655
48 Ga0157375_10053981 3300013308 Bacteria 3956
49 Ga0157375_10073362 3300013308 Bacteria 3441
50 Ga0157375_10158094 3300013308 Bacteria 2407
51 Ga0213872_10000042 3300021361 Bacteria 118474
52 Ga0209233_1049120 3300025261 Bacteria 868
53 Ga0209758_1035853 3300025297 Bacteria 1947
54 Ga0207645_10005976 3300025907 Bacteria 8763
55 Ga0207645_10076785 3300025907 Bacteria 2140
56 Ga0207684_10019767 3300025910 Bacteria 5760
57 Ga0207684_10207399 3300025910 Bacteria 1691
58 Ga0207649_10000037 3300025920 Bacteria 131159
59 Ga0207694_10450374 3300025924 Bacteria 1074
60 Ga0207659_10022340 3300025926 Bacteria 4212
61 Ga0207659_10024103 3300025926 Bacteria 4072
62 Ga0207687_10025624 3300025927 Bacteria 3946
63 Ga0207687_10037959 3300025927 Bacteria 3289
64 Ga0207644_10160172 3300025931 Bacteria 1749
65 Ga0207709_10090094 3300025935 Bacteria 2002
66 Ga0207669_10386808 3300025937 Bacteria 1092
67 Ga0207669_10405161 3300025937 Bacteria 1069
68 Ga0207691_10013854 3300025940 Bacteria 7698
69 Ga0207691_10189417 3300025940 Bacteria 1795
70 Ga0207711_10353590 3300025941 Bacteria 1361
71 Ga0207689_10002506 3300025942 Bacteria 17061
72 Ga0207679_10510712 3300025945 Bacteria 1074
73 Ga0207668_10377974 3300025972 Bacteria 1192
74 Ga0207668_10529274 3300025972 Bacteria 1018
75 Ga0207658_10002242 3300025986 Bacteria 14325
76 Ga0207658_10637169 3300025986 Bacteria 960
77 Ga0207677_10036841 3300026023 Bacteria 3192
78 Ga0207639_10001145 3300026041 Bacteria 18035
79 Ga0207678_10000458 3300026067 Bacteria 36993
80 Ga0207641_10648497 3300026088 Bacteria 1037
81 Ga0207648_10023900 3300026089 Bacteria 5464
82 Ga0207648_10058608 3300026089 Bacteria 3358
83 Ga0207676_10268676 3300026095 Bacteria 1543
84 Ga0207674_10024713 3300026116 Bacteria 6413
85 Ga0207674_10038123 3300026116 Bacteria 4994
86 Ga0207683_10124261 3300026121 Bacteria 2318
87 Ga0207683_10685800 3300026121 Bacteria 950
88 Ga0207698_10007259 3300026142 Bacteria 6943
89 Ga0209974_10003531 3300027876 Bacteria 5627
90 Ga0268266_10277448 3300028379 Bacteria 1557
91 Ga0307517_10080417 3300028786 Bacteria 2791
92 Ga0307515_10000026 3300028794 Bacteria 382411
93 Ga0307515_10000233 3300028794 Bacteria 137311
94 Ga0307515_10001456 3300028794 Bacteria 53165
95 Ga0307515_10022943 3300028794 Bacteria 10975
96 Ga0307515_10026741 3300028794 Bacteria 9910
97 Ga0307515_10155459 3300028794 Bacteria 2363
98 Ga0307515_10272969 3300028794 Bacteria 1409
99 Ga0307512_10083416 3300030522 Bacteria 2279
100 Ga0307513_10018473 3300031456 Bacteria 8328
101 Ga0307513_10055644 3300031456 Bacteria 4231
102 Ga0307513_10104081 3300031456 Bacteria 2853
103 Ga0307513_10217660 3300031456 Bacteria 1734
104 Ga0307509_10002250 3300031507 Bacteria 31597
105 Ga0307509_10011282 3300031507 Bacteria 10840
106 Ga0307509_10130686 3300031507 Bacteria 2467
107 Ga0307509_10367717 3300031507 Bacteria 1155
108 Ga0307408_100567184 3300031548 Bacteria 1004
109 Ga0307508_10000296 3300031616 Bacteria 60826
110 Ga0307508_10026278 3300031616 Bacteria 5277
111 Ga0265314_10102292 3300031711 Bacteria 1839
112 Ga0307516_10000017 3300031730 Bacteria 202506
113 Ga0307516_10003676 3300031730 Bacteria 19502
114 Ga0307516_10196438 3300031730 Bacteria 1740
115 Ga0307416_100217913 3300032002 Bacteria 1827
116 Ga0307414_10008856 3300032004 Bacteria 5744
117 Ga0307507_10269673 3300033179 Bacteria 1077
118 Ga0307510_10006854 3300033180 Bacteria 13589
119 Ga0307510_10110026 3300033180 Bacteria 2502
120 Ga0307510_10144854 3300033180 Bacteria 2010
121 Ga0307510_10184144 3300033180 Bacteria 1646
122 Ga0395900_0086310 3300037418 Bacteria 3225
123 Ga0395900_0484431 3300037418 Bacteria 1189
124 Ga0395898_0067146 3300037466 Bacteria 3473
125 Ga0395905_0023096 3300037471 Bacteria 5879
126 Ga0395905_0068582 3300037471 Bacteria 3321
127 Ga0395901_0643979 3300038443 Bacteria 1064
128 Ga0436361_1150385 3300039447 Bacteria 105721
129 Ga0451577_0001028 3300042876 Bacteria 40476
130 Ga0453684_0578359 3300044712 Bacteria 1234
131 Ga0466957_0177878 3300044842 Bacteria 1388
132 Ga0466958_0038326 3300045836 Bacteria 2876
133 Ga0495592_0000519 3300046454 Bacteria 27856
134 Ga0495638_0042471 3300046460 Bacteria 2872
135 Ga0495638_0170674 3300046460 Bacteria 1248
136 Ga0495650_0003814 3300046471 Bacteria 10722
137 Ga0495650_0005332 3300046471 Bacteria 8390
138 Ga0495610_0018106 3300046512 Bacteria 3989
139 Ga0495620_0048795 3300046515 Bacteria 1815
140 Ga0495666_0028402 3300046526 Bacteria 2752
141 Ga0495668_0091918 3300046616 Bacteria 1663
142 Ga0495625_0119448 3300046660 Bacteria 1795
143 Ga0495649_0003929 3300046694 Bacteria 9825
144 Ga0495660_0017712 3300046810 Bacteria 4098
145 Ga0495687_007438 3300047443 Bacteria 6447
146 Ga0495687_007644 3300047443 Bacteria 6327
147 Ga0495686_0000906 3300047472 Bacteria 37300
148 Ga0495626_0038266 3300048091 Bacteria 2275
149 Ga0496102_0008471 3300048905 Bacteria 8816
150 Ga0496117_0023605 3300048920 Bacteria 4894
151 Ga0496118_0018290 3300048921 Bacteria 6328
152 Ga0496118_0044936 3300048921 Bacteria 3453
153 Ga0496119_0035407 3300048922 Bacteria 3272
154 Ga0496121_0000601 3300048924 Bacteria 67662
155 Ga0496121_0011799 3300048924 Bacteria 9630
156 Ga0496121_0154809 3300048924 Bacteria 1683
157 Ga0496122_0098928 3300048925 Bacteria 1957
158 Ga0496123_0205423 3300048926 Bacteria 1006
159 Ga0496125_0000042 3300048928 Bacteria 303305
160 Ga0496125_0245913 3300048928 Bacteria 1132
161 Ga0496126_0028265 3300048929 Bacteria 5345
162 Ga0501033_0058274 3300049570 Bacteria 2853
163 Ga0501033_0089546 3300049570 Bacteria 2251
164 Ga0501034_0041445 3300049571 Bacteria 4658
165 Ga0501038_0101054 3300049574 Bacteria 2401
166 Ga0501043_0035486 3300049579 Bacteria 3922
167 Ga0501043_0547429 3300049579 Bacteria 860
168 Ga0501046_0021768 3300049580 Bacteria 5285
169 Ga0501047_0001454 3300049581 Bacteria 23159
170 Ga0501047_0051219 3300049581 Bacteria 3988
171 Ga0501048_0117687 3300049582 Bacteria 1877
172 Ga0501073_0162245 3300049589 Bacteria 1548
173 Ga0501080_0032400 3300049742 Bacteria 4874
174 Ga0501035_0002623 3300049822 Bacteria 17522
175 Ga0501035_0037966 3300049822 Bacteria 4361
176 Ga0501044_0003157 3300049823 Bacteria 18634
177 Ga0501044_0026527 3300049823 Bacteria 6132
178 nmdc:mga0k408_124895_c1 3300050493 Bacteria 1526
179 nmdc:mga0k408_139164_c1 3300050493 Bacteria 1443
180 nmdc:mga0k408_2495_c1 3300050493 Bacteria 5708
181 nmdc:mga0k408_37989_c1 3300050493 Bacteria 2765
182 nmdc:mga0k408_50255_c1 3300050493 Bacteria 2414
183 nmdc:mga0k408_57759_c1 3300050493 Bacteria 2253
184 nmdc:mga07m45_112266_c1 3300050496 Bacteria 1571
185 nmdc:mga07m45_201646_c1 3300050496 Bacteria 1157
186 nmdc:mga07m45_35807_c1 3300050496 Bacteria 2762
187 nmdc:mga07m45_76256_c1 3300050496 Bacteria 1912
188 nmdc:mga07m45_8985_c1 3300050496 Bacteria 5160
189 nmdc:mga09592_38010_c2 3300050508 Bacteria 3702
190 nmdc:mga0qj67_113834_c1 3300050509 Bacteria 2185
191 Ga0500643_064354 3300053087 Bacteria 1025
192 Ga0500644_0001041 3300053088 Bacteria 8321
193 Ga0500647_0214981 3300053091 Bacteria 864
194 Ga0500607_122669 3300053121 Bacteria 1254
195 Ga0500655_026497 3300053133 Bacteria 1104
196 Ga0500658_0003762 3300053134 Bacteria 5713
197 Ga0500559_0000176 3300053136 Bacteria 50699
198 Ga0500568_0037515 3300053139 Bacteria 1965
199 Ga0500586_032616 3300053145 Bacteria 1726
200 Ga0500604_0019960 3300053151 Bacteria 1881
201 Ga0500619_000078 3300053154 Bacteria 27132
202 Ga0500636_0097110 3300053177 Bacteria 1680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046471 Ga0495650_0003814 Ga0495650_0003814_4718_5467 247
2 3300006178 Ga0075367_10030656 Ga0075367_100306563 248
3 3300006353 Ga0075370_10021549 Ga0075370_100215493 248
4 3300037418 Ga0395900_0086310 Ga0395900_0086310_1940_2692 249
5 3300037471 Ga0395905_0068582 Ga0395905_0068582_2108_2860 249
6 3300038443 Ga0395901_0643979 Ga0395901_0643979_148_900 249
7 3300048924 Ga0496121_0011799 Ga0496121_0011799_5390_6196 252
8 3300048926 Ga0496123_0205423 Ga0496123_0205423_172_930 252
9 3300031456 Ga0307513_10104081 Ga0307513_101040812 254
10 3300005467 Ga0070706_100001239 Ga0070706_10000123912 256
11 3300005468 Ga0070707_100148366 Ga0070707_1001483662 256
12 3300025910 Ga0207684_10019767 Ga0207684_100197674 256
13 3300031548 Ga0307408_100567184 Ga0307408_1005671842 256
14 3300053091 Ga0500647_0214981 Ga0500647_0214981_27_818 259
15 3300053177 Ga0500636_0097110 Ga0500636_0097110_188_979 259
16 iso_pu_bacteria 2513237087 2513591160 259
17 3300021361 Ga0213872_10000042 Ga0213872_1000004211 260
18 3300025920 Ga0207649_10000037 Ga0207649_10000037138 260
19 3300031711 Ga0265314_10102292 Ga0265314_101022922 260
20 3300049570 Ga0501033_0058274 Ga0501033_0058274_1129_1914 260
21 3300049571 Ga0501034_0041445 Ga0501034_0041445_1507_2292 260
22 3300049574 Ga0501038_0101054 Ga0501038_0101054_278_1063 260
23 3300049579 Ga0501043_0035486 Ga0501043_0035486_122_907 260
24 3300049580 Ga0501046_0021768 Ga0501046_0021768_2496_3281 260
25 3300049581 Ga0501047_0051219 Ga0501047_0051219_1365_2150 260
26 3300049589 Ga0501073_0162245 Ga0501073_0162245_256_1041 260
27 3300049742 Ga0501080_0032400 Ga0501080_0032400_1497_2282 260
28 3300049822 Ga0501035_0037966 Ga0501035_0037966_3089_3874 260
29 3300049823 Ga0501044_0026527 Ga0501044_0026527_614_1399 260
30 3300005539 Ga0068853_100001824 Ga0068853_10000182415 261
31 3300026041 Ga0207639_10001145 Ga0207639_100011456 261
32 3300026116 Ga0207674_10038123 Ga0207674_100381234 261
33 3300037471 Ga0395905_0023096 Ga0395905_0023096_5045_5869 261
34 3300046460 Ga0495638_0042471 Ga0495638_0042471_1261_2058 261
35 3300005548 Ga0070665_100009963 Ga0070665_1000099636 263
36 3300005618 Ga0068864_100043153 Ga0068864_1000431533 263
37 3300005841 Ga0068863_100023313 Ga0068863_1000233133 263
38 3300009177 Ga0105248_10505625 Ga0105248_105056252 263
39 3300013308 Ga0157375_10158094 Ga0157375_101580942 263
40 3300025927 Ga0207687_10025624 Ga0207687_100256242 263
41 3300025941 Ga0207711_10353590 Ga0207711_103535902 263
42 3300025986 Ga0207658_10637169 Ga0207658_106371692 263
43 3300026095 Ga0207676_10268676 Ga0207676_102686762 263
44 3300028379 Ga0268266_10277448 Ga0268266_102774482 263
45 3300048928 Ga0496125_0245913 Ga0496125_0245913_244_1050 263
46 iso_pu_bacteria 2582581283 2585168460 263
47 iso_pu_bacteria 2582581306 2585270024 263
48 iso_pu_bacteria 2582581865 2585389729 263
49 iso_pu_bacteria 2643221607 2644049374 263
50 iso_pu_bacteria 2643221636 2644204287 263
51 iso_pu_bacteria 2643221686 2644482408 263
52 3300005841 Ga0068863_100297957 Ga0068863_1002979572 264
53 3300006237 Ga0097621_100301365 Ga0097621_1003013652 264
54 3300026088 Ga0207641_10648497 Ga0207641_106484971 264
55 3300028794 Ga0307515_10022943 Ga0307515_100229432 264
56 3300030522 Ga0307512_10083416 Ga0307512_100834162 264
57 3300031507 Ga0307509_10002250 Ga0307509_100022507 264
58 3300031507 Ga0307509_10011282 Ga0307509_1001128212 264
59 3300031507 Ga0307509_10130686 Ga0307509_101306862 264
60 3300031507 Ga0307509_10367717 Ga0307509_103677171 264
61 3300031616 Ga0307508_10000296 Ga0307508_1000029629 264
62 3300031616 Ga0307508_10026278 Ga0307508_100262782 264
63 3300031730 Ga0307516_10196438 Ga0307516_101964382 264
64 3300033180 Ga0307510_10006854 Ga0307510_100068548 264
65 3300033180 Ga0307510_10144854 Ga0307510_101448542 264
66 3300033180 Ga0307510_10184144 Ga0307510_101841442 264
67 3300044842 Ga0466957_0177878 Ga0466957_0177878_124_921 264
68 3300045836 Ga0466958_0038326 Ga0466958_0038326_2016_2813 264
69 3300046454 Ga0495592_0000519 Ga0495592_0000519_14796_15590 264
70 3300046460 Ga0495638_0170674 Ga0495638_0170674_363_1157 264
71 3300046512 Ga0495610_0018106 Ga0495610_0018106_1533_2327 264
72 3300046526 Ga0495666_0028402 Ga0495666_0028402_1618_2412 264
73 3300053088 Ga0500644_0001041 Ga0500644_0001041_4611_5405 264
74 3300053121 Ga0500607_122669 Ga0500607_122669_432_1229 264
75 3300053133 Ga0500655_026497 Ga0500655_026497_58_852 264
76 3300053136 Ga0500559_0000176 Ga0500559_0000176_27374_28168 264
77 iso_pu_bacteria 2643221654 2644303443 264
78 3300005328 Ga0070676_10010946 Ga0070676_100109462 265
79 3300005331 Ga0070670_100113766 Ga0070670_1001137663 265
80 3300005334 Ga0068869_100001957 Ga0068869_1000019572 265
81 3300005338 Ga0068868_100358102 Ga0068868_1003581021 265
82 3300005354 Ga0070675_100004483 Ga0070675_1000044837 265
83 3300005355 Ga0070671_100083694 Ga0070671_1000836942 265
84 3300005364 Ga0070673_100019023 Ga0070673_1000190233 265
85 3300005456 Ga0070678_100321190 Ga0070678_1003211902 265
86 3300005459 Ga0068867_100016157 Ga0068867_1000161573 265
87 3300005543 Ga0070672_100024174 Ga0070672_1000241743 265
88 3300005577 Ga0068857_100047402 Ga0068857_1000474023 265
89 3300009098 Ga0105245_10134407 Ga0105245_101344072 265
90 3300013297 Ga0157378_10131246 Ga0157378_101312462 265
91 3300013306 Ga0163162_10331255 Ga0163162_103312552 265
92 3300013308 Ga0157375_10073362 Ga0157375_100733622 265
93 3300025907 Ga0207645_10005976 Ga0207645_100059762 265
94 3300025910 Ga0207684_10207399 Ga0207684_102073992 265
95 3300025926 Ga0207659_10022340 Ga0207659_100223404 265
96 3300025927 Ga0207687_10037959 Ga0207687_100379592 265
97 3300025940 Ga0207691_10013854 Ga0207691_100138545 265
98 3300025942 Ga0207689_10002506 Ga0207689_100025065 265
99 3300025972 Ga0207668_10529274 Ga0207668_105292741 265
100 3300026023 Ga0207677_10036841 Ga0207677_100368412 265
101 3300026089 Ga0207648_10023900 Ga0207648_100239005 265
102 3300026116 Ga0207674_10024713 Ga0207674_100247132 265
103 3300033179 Ga0307507_10269673 Ga0307507_102696732 265
104 3300046471 Ga0495650_0005332 Ga0495650_0005332_3558_4358 265
105 3300049570 Ga0501033_0089546 Ga0501033_0089546_1177_1983 265
106 3300049579 Ga0501043_0547429 Ga0501043_0547429_26_832 265
107 3300049581 Ga0501047_0001454 Ga0501047_0001454_9499_10305 265
108 3300049582 Ga0501048_0117687 Ga0501048_0117687_919_1725 265
109 3300049822 Ga0501035_0002623 Ga0501035_0002623_13455_14261 265
110 3300049823 Ga0501044_0003157 Ga0501044_0003157_13714_14520 265
111 3300005327 Ga0070658_10369373 Ga0070658_103693732 266
112 3300005328 Ga0070676_10066840 Ga0070676_100668402 266
113 3300005338 Ga0068868_100300818 Ga0068868_1003008181 266
114 3300005355 Ga0070671_100180959 Ga0070671_1001809592 266
115 3300005459 Ga0068867_100059733 Ga0068867_1000597333 266
116 3300005616 Ga0068852_100290794 Ga0068852_1002907942 266
117 3300013308 Ga0157375_10053981 Ga0157375_100539814 266
118 3300025907 Ga0207645_10076785 Ga0207645_100767852 266
119 3300025931 Ga0207644_10160172 Ga0207644_101601722 266
120 3300025937 Ga0207669_10405161 Ga0207669_104051612 266
121 3300025945 Ga0207679_10510712 Ga0207679_105107121 266
122 3300025986 Ga0207658_10002242 Ga0207658_1000224212 266
123 3300027876 Ga0209974_10003531 Ga0209974_100035315 266
124 3300031730 Ga0307516_10003676 Ga0307516_1000367613 266
125 3300037418 Ga0395900_0484431 Ga0395900_0484431_59_859 266
126 3300037466 Ga0395898_0067146 Ga0395898_0067146_2581_3381 266
127 3300053154 Ga0500619_000078 Ga0500619_000078_3824_4633 266
128 3300005367 Ga0070667_100000975 Ga0070667_10000097527 267
129 3300005455 Ga0070663_100001291 Ga0070663_1000012919 267
130 3300005616 Ga0068852_100012632 Ga0068852_1000126326 267
131 3300006846 Ga0075430_100121671 Ga0075430_1001216713 267
132 3300006880 Ga0075429_100005450 Ga0075429_1000054503 267
133 3300013297 Ga0157378_10233655 Ga0157378_102336553 267
134 3300025261 Ga0209233_1049120 Ga0209233_10491201 267
135 3300025297 Ga0209758_1035853 Ga0209758_10358532 267
136 3300026067 Ga0207678_10000458 Ga0207678_100004587 267
137 3300026142 Ga0207698_10007259 Ga0207698_100072594 267
138 3300028794 Ga0307515_10000233 Ga0307515_1000023371 267
139 3300028794 Ga0307515_10026741 Ga0307515_100267414 267
140 3300031456 Ga0307513_10018473 Ga0307513_100184736 267
141 3300032002 Ga0307416_100217913 Ga0307416_1002179132 267
142 3300042876 Ga0451577_0001028 Ga0451577_0001028_30661_31485 267
143 3300044712 Ga0453684_0578359 Ga0453684_0578359_337_1161 267
144 3300046660 Ga0495625_0119448 Ga0495625_0119448_859_1662 267
145 3300050508 nmdc:mga09592_38010_c2 nmdc:mga09592_38010_c2_1456_2262 267
146 3300050509 nmdc:mga0qj67_113834_c1 nmdc:mga0qj67_113834_c1_1011_1817 267
147 iso_pu_bacteria 2834641062 2834644003 267
148 iso_pu_bacteria 8003400568 8003404957 267
149 3300047472 Ga0495686_0000906 Ga0495686_0000906_10063_10872 268
150 3300028794 Ga0307515_10000026 Ga0307515_10000026178 269
151 3300039447 Ga0436361_1150385 Ga0436361_1150385_36698_37519 269
152 3300005459 Ga0068867_100078185 Ga0068867_1000781852 270
153 3300006178 Ga0075367_10055614 Ga0075367_100556141 270
154 3300006195 Ga0075366_10000111 Ga0075366_100001116 270
155 3300006195 Ga0075366_10003361 Ga0075366_100033614 270
156 3300006195 Ga0075366_10021743 Ga0075366_100217432 270
157 3300006195 Ga0075366_10097927 Ga0075366_100979272 270
158 3300006353 Ga0075370_10001093 Ga0075370_100010936 270
159 3300009148 Ga0105243_10010079 Ga0105243_100100797 270
160 3300025935 Ga0207709_10090094 Ga0207709_100900943 270
161 3300026089 Ga0207648_10058608 Ga0207648_100586083 270
162 3300028786 Ga0307517_10080417 Ga0307517_100804173 270
163 3300028794 Ga0307515_10272969 Ga0307515_102729692 270
164 3300031456 Ga0307513_10217660 Ga0307513_102176602 270
165 3300032004 Ga0307414_10008856 Ga0307414_100088564 270
166 3300046515 Ga0495620_0048795 Ga0495620_0048795_394_1206 270
167 3300046616 Ga0495668_0091918 Ga0495668_0091918_783_1598 270
168 3300046694 Ga0495649_0003929 Ga0495649_0003929_909_1721 270
169 3300046810 Ga0495660_0017712 Ga0495660_0017712_1772_2584 270
170 3300047443 Ga0495687_007438 Ga0495687_007438_2753_3565 270
171 3300047443 Ga0495687_007644 Ga0495687_007644_2763_3575 270
172 3300048091 Ga0495626_0038266 Ga0495626_0038266_1251_2063 270
173 3300048924 Ga0496121_0154809 Ga0496121_0154809_172_984 270
174 3300050493 nmdc:mga0k408_124895_c1 nmdc:mga0k408_124895_c1_428_1240 270
175 3300050493 nmdc:mga0k408_2495_c1 nmdc:mga0k408_2495_c1_101_952 270
176 3300050493 nmdc:mga0k408_37989_c1 nmdc:mga0k408_37989_c1_1375_2187 270
177 3300050493 nmdc:mga0k408_50255_c1 nmdc:mga0k408_50255_c1_149_1036 270
178 3300050493 nmdc:mga0k408_57759_c1 nmdc:mga0k408_57759_c1_842_1705 270
179 3300050496 nmdc:mga07m45_112266_c1 nmdc:mga07m45_112266_c1_82_894 270
180 3300050496 nmdc:mga07m45_35807_c1 nmdc:mga07m45_35807_c1_1344_2156 270
181 3300050496 nmdc:mga07m45_76256_c1 nmdc:mga07m45_76256_c1_741_1553 270
182 3300050496 nmdc:mga07m45_8985_c1 nmdc:mga07m45_8985_c1_2827_3639 270
183 3300053134 Ga0500658_0003762 Ga0500658_0003762_2842_3654 270
184 3300053139 Ga0500568_0037515 Ga0500568_0037515_61_909 270
185 iso_pu_bacteria 2941479691 2941480780 270
186 3300028794 Ga0307515_10001456 Ga0307515_100014562 271
187 3300031730 Ga0307516_10000017 Ga0307516_10000017135 271
188 3300048905 Ga0496102_0008471 Ga0496102_0008471_5428_6246 271
189 3300006353 Ga0075370_10190849 Ga0075370_101908491 272
190 3300025924 Ga0207694_10450374 Ga0207694_104503741 272
191 3300026121 Ga0207683_10685800 Ga0207683_106858001 272
192 3300050496 nmdc:mga07m45_201646_c1 nmdc:mga07m45_201646_c1_264_1082 272
193 3300025940 Ga0207691_10189417 Ga0207691_101894173 274
194 3300031456 Ga0307513_10055644 Ga0307513_100556443 274
195 3300033180 Ga0307510_10110026 Ga0307510_101100262 274
196 3300048920 Ga0496117_0023605 Ga0496117_0023605_2274_3101 274
197 3300048921 Ga0496118_0018290 Ga0496118_0018290_4219_5097 274
198 3300048921 Ga0496118_0044936 Ga0496118_0044936_1093_1920 274
199 3300048922 Ga0496119_0035407 Ga0496119_0035407_718_1545 274
200 3300048924 Ga0496121_0000601 Ga0496121_0000601_21671_22510 274
201 3300048925 Ga0496122_0098928 Ga0496122_0098928_981_1820 274
202 3300048928 Ga0496125_0000042 Ga0496125_0000042_294645_295523 274
203 3300048929 Ga0496126_0028265 Ga0496126_0028265_858_1736 274
204 3300050493 nmdc:mga0k408_139164_c1 nmdc:mga0k408_139164_c1_518_1369 274
205 3300053145 Ga0500586_032616 Ga0500586_032616_802_1653 274
206 3300053151 Ga0500604_0019960 Ga0500604_0019960_269_1348 274
207 3300003775 Ga0055524_1001503 Ga0055524_10015036 275
208 3300025926 Ga0207659_10024103 Ga0207659_100241034 275
209 3300025937 Ga0207669_10386808 Ga0207669_103868082 275
210 3300025972 Ga0207668_10377974 Ga0207668_103779742 275
211 3300026121 Ga0207683_10124261 Ga0207683_101242613 275
212 3300028794 Ga0307515_10155459 Ga0307515_101554592 275
213 3300053087 Ga0500643_064354 Ga0500643_064354_161_1015 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01904

DUF72

Protein of unknown function DUF72

56

296

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.732 14 272
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.7168 14 272
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.707 11 274
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.6843 11 274
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.679 15 274
ID Description Score Start End Superfamily
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.732 14 272 3.20.20.410
af_P37348_1_259_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7284 15 274 3.20.20.410
af_Q4E4B4_140_369_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7268 78 274 3.20.20.410
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7168 14 272 3.20.20.410
af_Q2FZX7_1_282_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.712 15 274 3.20.20.410
ID Description Score Start End GO Terms
AF-A0A4R9WRZ7-F1-model_v4 DUF72 domain-containing protein 0.993 112 200
AF-A0A401TZY1-F1-model_v4 DUF72 domain-containing protein 0.9912 121 274
AF-A0A5R2MWL3-F1-model_v4 DUF72 domain-containing protein 0.9906 116 219
AF-A0A529P163-F1-model_v4 DUF72 domain-containing protein 0.9902 127 274
AF-A0A530R533-F1-model_v4 DUF72 domain-containing protein 0.9884 124 274

Feature Viewer

pLDDT pTM Quality
91.08 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map