F316482

General Info

Members Datasets Scaffolds Average Seq Length
207 143 414 193

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10041537|Ga0157374_100415374
Length 232
Sequence LDIYFLVVDDPTSHPDAHEIDGRRGLKFIRDREMDMLKIAIVTGSTRPGRNNEAVSNWVYRIAKERKDAEFEIVDIASYNLPFFDEPMSPMWGRYTQEHTKVWSDKIATFDAYVFVTPEYNHSTSAALKNAIDFLYREWNDKAAGFVSYGGNGGGARAVEHLRLIMAEVMVATVRAQVLLSLFTDFENFRTFKPAPQHEKELHAMLDQVIAWGVALKALRFESSEKAALAGE

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
85 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
100 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
101 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
102 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
141 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 8002775197 Frankia nepalensis CN7 Isolate Nodule
143 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.65
Metatranscriptomes 3.38
Isolates 0.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0.48
Rhizoplane 0.48
Rhizosphere 96.62
Stem 0
Stem Tuber 0
Unclassified 4.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10041537 3300013296 Bacteria 4239
2 MRS1b_contig_8560833 2162886011 Bacteria 1379
3 Ga0006759J45824_1083468 3300003163 Bacteria 834
4 JGI25407J50210_10006981 3300003373 Archaea 2824
5 JGI25407J50210_10009926 3300003373 Archaea 2417
6 JGI25407J50210_10081550 3300003373 Unclassified 804
7 Ga0007417J51691_1032070 3300003544 Bacteria 1408
8 Ga0007410J51695_1057005 3300003574 Bacteria 827
9 Ga0007409J51694_1022610 3300003575 Bacteria 1050
10 Ga0007416J51690_1025553 3300003577 Bacteria 2992
11 Ga0007411J51799_116556 3300003611 Bacteria 816
12 Ga0032354_1032419 3300003693 Bacteria 1917
13 Ga0065704_10196001 3300005289 Bacteria 1167
14 Ga0065712_10076336 3300005290 Bacteria 3681
15 Ga0065707_10144534 3300005295 Bacteria 1730
16 Ga0065707_10264826 3300005295 Bacteria 1082
17 Ga0070680_100319837 3300005336 Bacteria 1317
18 Ga0070688_101198713 3300005365 Bacteria 610
19 Ga0070705_100559345 3300005440 Bacteria 878
20 Ga0070700_100127925 3300005441 Archaea 1710
21 Ga0070708_100004312 3300005445 Bacteria 11178
22 Ga0070708_100083254 3300005445 Bacteria 2900
23 Ga0070708_100693629 3300005445 Bacteria 959
24 Ga0070708_100854171 3300005445 Unclassified 855
25 Ga0070681_10137245 3300005458 Bacteria 2376
26 Ga0070685_10235250 3300005466 Bacteria 1207
27 Ga0070706_100065262 3300005467 Bacteria 3366
28 Ga0070706_100102593 3300005467 Bacteria 2659
29 Ga0070706_100237046 3300005467 Bacteria 1703
30 Ga0070707_100008055 3300005468 Bacteria 9784
31 Ga0070707_100256923 3300005468 Bacteria 1700
32 Ga0070698_100666571 3300005471 Bacteria 982
33 Ga0070699_100004143 3300005518 Bacteria 12811
34 Ga0070699_100769847 3300005518 Bacteria 881
35 Ga0070697_100218107 3300005536 Unclassified 1625
36 Ga0070697_100552025 3300005536 Unclassified 1010
37 Ga0070695_100110329 3300005545 Unclassified 1866
38 Ga0070696_100055713 3300005546 Bacteria 2757
39 Ga0070696_100223539 3300005546 Bacteria 1414
40 Ga0070704_100233663 3300005549 Bacteria 1501
41 Ga0070704_100595885 3300005549 Bacteria 971
42 Ga0068861_100256462 3300005719 Bacteria 1495
43 Ga0068860_100954347 3300005843 Bacteria 875
44 Ga0081538_10008384 3300005981 Archaea 8782
45 Ga0081538_10013274 3300005981 Archaea 6532
46 Ga0081538_10015043 3300005981 Bacteria 6017
47 Ga0081538_10044459 3300005981 Archaea 2770
48 Ga0070717_10053015 3300006028 Bacteria 3343
49 Ga0075432_10026239 3300006058 Bacteria 2001
50 Ga0070712_100690002 3300006175 Bacteria 870
51 Ga0075427_10004262 3300006194 Bacteria 1999
52 Ga0075428_100058524 3300006844 Bacteria 4219
53 Ga0075428_100102865 3300006844 Bacteria 3115
54 Ga0075428_100115250 3300006844 Bacteria 2927
55 Ga0075428_100155784 3300006844 Bacteria 2482
56 Ga0075428_100296238 3300006844 Unclassified 1740
57 Ga0075428_100635670 3300006844 Bacteria 1138
58 Ga0075430_100135142 3300006846 Bacteria 2055
59 Ga0075430_100220713 3300006846 Bacteria 1573
60 Ga0075431_100030298 3300006847 Bacteria 5573
61 Ga0075431_100176884 3300006847 Bacteria 2191
62 Ga0075431_100848880 3300006847 Bacteria 884
63 Ga0075433_10127839 3300006852 Bacteria 2257
64 Ga0075434_100049026 3300006871 Bacteria 4191
65 Ga0075434_100268232 3300006871 Bacteria 1726
66 Ga0075434_100744412 3300006871 Unclassified 997
67 Ga0075429_100098539 3300006880 Bacteria 2550
68 Ga0075429_100292757 3300006880 Bacteria 1425
69 Ga0075429_100347310 3300006880 Bacteria 1299
70 Ga0068865_100671416 3300006881 Bacteria 883
71 Ga0075436_100548014 3300006914 Bacteria 849
72 Ga0099794_10012446 3300007265 Bacteria 3673
73 Ga0105240_10104930 3300009093 Bacteria 3431
74 Ga0111539_10079640 3300009094 Bacteria 3854
75 Ga0111539_10355624 3300009094 Bacteria 1704
76 Ga0114129_10010116 3300009147 Bacteria 13448
77 Ga0114129_10030362 3300009147 Bacteria 7648
78 Ga0114129_10284341 3300009147 Bacteria 2209
79 Ga0114129_10304426 3300009147 Bacteria 2123
80 Ga0114129_10333443 3300009147 Bacteria 2014
81 Ga0114129_10382070 3300009147 Bacteria 1860
82 Ga0114129_10944004 3300009147 Bacteria 1090
83 Ga0105242_10702174 3300009176 Bacteria 990
84 Ga0105237_10001811 3300009545 Bacteria 27564
85 Ga0105249_10991952 3300009553 Bacteria 908
86 Ga0157370_10845663 3300013104 Bacteria 832
87 Ga0157369_10344842 3300013105 Bacteria 1547
88 Ga0157378_10661681 3300013297 Archaea 1061
89 Ga0163162_10280218 3300013306 Bacteria 1799
90 Ga0157372_11615027 3300013307 Bacteria 746
91 Ga0157375_10609965 3300013308 Bacteria 1250
92 Ga0157375_11452055 3300013308 Bacteria 809
93 Ga0157377_10497254 3300014745 Archaea 851
94 Ga0163161_10549807 3300017792 Bacteria 946
95 Ga0207692_10345108 3300025898 Bacteria 917
96 Ga0207699_10955813 3300025906 Bacteria 633
97 Ga0207684_10010285 3300025910 Bacteria 8236
98 Ga0207684_10075180 3300025910 Bacteria 2871
99 Ga0207684_10163541 3300025910 Bacteria 1917
100 Ga0207707_10275885 3300025912 Bacteria 1457
101 Ga0207695_10112329 3300025913 Bacteria 2703
102 Ga0207671_10000014 3300025914 Bacteria 461481
103 Ga0207646_10036897 3300025922 Bacteria 4410
104 Ga0207646_10133793 3300025922 Bacteria 2232
105 Ga0207669_10434036 3300025937 Archaea 1037
106 Ga0207708_10171904 3300026075 Archaea 1716
107 Ga0207648_10127269 3300026089 Bacteria 2241
108 Ga0207674_10419489 3300026116 Archaea 1293
109 Ga0209969_1000757 3300027360 Bacteria 4330
110 Ga0209967_1000508 3300027364 Bacteria 5122
111 Ga0209981_1001187 3300027378 Bacteria 3299
112 Ga0210000_1000253 3300027462 Bacteria 7625
113 Ga0209995_1001001 3300027471 Bacteria 4343
114 Ga0209968_1030546 3300027526 Bacteria 900
115 Ga0209971_1002501 3300027682 Bacteria 4410
116 Ga0209974_10002424 3300027876 Bacteria 6754
117 Ga0207428_10138939 3300027907 Bacteria 1856
118 Ga0207428_10323199 3300027907 Bacteria 1139
119 Ga0268265_10204764 3300028380 Bacteria 1715
120 Ga0268264_10391282 3300028381 Bacteria 1334
121 Ga0265318_10048302 3300028577 Bacteria 1603
122 Ga0307515_10008048 3300028794 Bacteria 20659
123 Ga0265338_10008723 3300028800 Bacteria 12255
124 Ga0265320_10100382 3300031240 Bacteria 1333
125 Ga0265329_10157872 3300031242 Bacteria 736
126 Ga0265339_10227025 3300031249 Bacteria 911
127 Ga0265316_10019935 3300031344 Bacteria 5720
128 Ga0265314_10072711 3300031711 Bacteria 2296
129 Ga0307405_11261771 3300031731 Bacteria 641
130 Ga0307410_10170626 3300031852 Bacteria 1639
131 Ga0326468_10000135 3300031889 Bacteria 6956
132 Ga0307406_10041312 3300031901 Bacteria 2873
133 Ga0307406_10059094 3300031901 Bacteria 2467
134 Ga0307407_10106578 3300031903 Bacteria 1751
135 Ga0307412_10098527 3300031911 Bacteria 2062
136 Ga0307412_10336382 3300031911 Bacteria 1207
137 Ga0307409_100485829 3300031995 Bacteria 1199
138 Ga0307416_100210891 3300032002 Bacteria 1853
139 Ga0307414_10835196 3300032004 Bacteria 842
140 Ga0307415_100020358 3300032126 Bacteria 4051
141 Ga0439447_042404 3300041407 Bacteria 1105
142 Ga0439461_0126661 3300041410 Unclassified 643
143 Ga0451837_0140314 3300041494 Bacteria 760
144 Ga0439449_0009704 3300042007 Bacteria 3642
145 Ga0451577_0000086 3300042876 Bacteria 207669
146 Ga0466972_0001833 3300044658 Bacteria 10400
147 Ga0453683_0000600 3300044673 Bacteria 39631
148 Ga0453683_0102393 3300044673 Bacteria 1798
149 Ga0466965_0003079 3300044683 Bacteria 7264
150 Ga0466964_0027060 3300044706 Bacteria 2249
151 Ga0453684_0000303 3300044712 Bacteria 207582
152 Ga0453684_0002128 3300044712 Bacteria 49836
153 Ga0453684_0015470 3300044712 Bacteria 12062
154 Ga0453684_0029367 3300044712 Bacteria 7808
155 Ga0451576_0000612 3300045051 Bacteria 75183
156 Ga0451576_0008251 3300045051 Bacteria 12248
157 Ga0495638_0096970 3300046460 Bacteria 1769
158 Ga0495653_0001958 3300046463 Bacteria 16215
159 Ga0495639_0354287 3300046475 Bacteria 737
160 Ga0495649_0179268 3300046694 Bacteria 1106
161 Ga0495676_0023213 3300047321 Bacteria 5387
162 Ga0495686_0002359 3300047472 Bacteria 18011
163 Ga0496104_1028108 3300048907 Bacteria 728
164 Ga0496126_0128057 3300048929 Bacteria 2196
165 Ga0501032_0121747 3300049569 Archaea 1724
166 Ga0501034_0094722 3300049571 Bacteria 2983
167 Ga0501037_0005790 3300049573 Archaea 9026
168 Ga0501038_0074505 3300049574 Archaea 2871
169 Ga0501039_0032881 3300049575 Archaea 4000
170 Ga0501040_0165451 3300049576 Archaea 1564
171 Ga0501043_0242224 3300049579 Bacteria 1391
172 Ga0501046_0010107 3300049580 Archaea 8122
173 Ga0501076_0759529 3300049592 Archaea 800
174 Ga0501221_058866 3300049704 Bacteria 884
175 Ga0501080_0396254 3300049742 Archaea 1242
176 Ga0501081_0361461 3300049743 Archaea 1071
177 Ga0501044_0043394 3300049823 Bacteria 4671
178 Ga0501044_0163332 3300049823 Archaea 2202
179 Ga0501045_0068881 3300049824 Archaea 2600
180 nmdc:mga05p37_159306_c1 3300050507 Bacteria 2757
181 nmdc:mga05p37_164776_c1 3300050507 Bacteria 2706
182 nmdc:mga05p37_722950_c1 3300050507 Bacteria 1102
183 nmdc:mga05p37_725730_c1 3300050507 Bacteria 1100
184 nmdc:mga05p37_9805_c1 3300050507 Bacteria 11367
185 nmdc:mga09592_54906_c1 3300050508 Bacteria 3366
186 nmdc:mga0qj67_125076_c1 3300050509 Bacteria 2081
187 nmdc:mga0qj67_467241_c1 3300050509 Bacteria 1016
188 nmdc:mga0qj67_590970_c1 3300050509 Bacteria 888
189 nmdc:mga06r32_129037_c1 3300050510 Bacteria 2498
190 nmdc:mga06r32_155789_c1 3300050510 Bacteria 2266
191 nmdc:mga06r32_999314_c1 3300050510 Bacteria 789
192 nmdc:mga08y16_1084515_c1 3300050511 Bacteria 777
193 nmdc:mga08y16_1396125_c1 3300050511 Archaea 664
194 nmdc:mga08y16_150835_c1 3300050511 Bacteria 2416
195 nmdc:mga08y16_65128_c1 3300050511 Bacteria 3804
196 nmdc:mga0n895_275685_c1 3300050512 Bacteria 1706
197 nmdc:mga0n895_277562_c1 3300050512 Bacteria 1699
198 nmdc:mga0n895_559468_c1 3300050512 Bacteria 1149
199 nmdc:mga0n895_898991_c1 3300050512 Unclassified 871
200 nmdc:mga0rr50_452281_c1 3300050513 Bacteria 1089
201 nmdc:mga0a205_324301_c1 3300050515 Bacteria 1411
202 nmdc:mga0a205_349893_c1 3300050515 Bacteria 1345
203 nmdc:mga0a205_930085_c1 3300050515 Unclassified 716
204 Ga0500577_0000501 3300053142 Bacteria 10068
205 Ga0590077_006368 3300059426 Bacteria 2419
206 8002779777 8002775197 Bacteria 10728764
207 8023628110 8023623736 Bacteria 8593882
208 Ga0157374_10041537
209 MRS1b_contig_8560833
210 Ga0006759J45824_1083468
211 JGI25407J50210_10006981
212 JGI25407J50210_10009926
213 JGI25407J50210_10081550
214 Ga0007417J51691_1032070
215 Ga0007410J51695_1057005
216 Ga0007409J51694_1022610
217 Ga0007416J51690_1025553
218 Ga0007411J51799_116556
219 Ga0032354_1032419
220 Ga0065704_10196001
221 Ga0065712_10076336
222 Ga0065707_10144534
223 Ga0065707_10264826
224 Ga0070680_100319837
225 Ga0070688_101198713
226 Ga0070705_100559345
227 Ga0070700_100127925
228 Ga0070708_100004312
229 Ga0070708_100083254
230 Ga0070708_100693629
231 Ga0070708_100854171
232 Ga0070681_10137245
233 Ga0070685_10235250
234 Ga0070706_100065262
235 Ga0070706_100102593
236 Ga0070706_100237046
237 Ga0070707_100008055
238 Ga0070707_100256923
239 Ga0070698_100666571
240 Ga0070699_100004143
241 Ga0070699_100769847
242 Ga0070697_100218107
243 Ga0070697_100552025
244 Ga0070695_100110329
245 Ga0070696_100055713
246 Ga0070696_100223539
247 Ga0070704_100233663
248 Ga0070704_100595885
249 Ga0068861_100256462
250 Ga0068860_100954347
251 Ga0081538_10008384
252 Ga0081538_10013274
253 Ga0081538_10015043
254 Ga0081538_10044459
255 Ga0070717_10053015
256 Ga0075432_10026239
257 Ga0070712_100690002
258 Ga0075427_10004262
259 Ga0075428_100058524
260 Ga0075428_100102865
261 Ga0075428_100115250
262 Ga0075428_100155784
263 Ga0075428_100296238
264 Ga0075428_100635670
265 Ga0075430_100135142
266 Ga0075430_100220713
267 Ga0075431_100030298
268 Ga0075431_100176884
269 Ga0075431_100848880
270 Ga0075433_10127839
271 Ga0075434_100049026
272 Ga0075434_100268232
273 Ga0075434_100744412
274 Ga0075429_100098539
275 Ga0075429_100292757
276 Ga0075429_100347310
277 Ga0068865_100671416
278 Ga0075436_100548014
279 Ga0099794_10012446
280 Ga0105240_10104930
281 Ga0111539_10079640
282 Ga0111539_10355624
283 Ga0114129_10010116
284 Ga0114129_10030362
285 Ga0114129_10284341
286 Ga0114129_10304426
287 Ga0114129_10333443
288 Ga0114129_10382070
289 Ga0114129_10944004
290 Ga0105242_10702174
291 Ga0105237_10001811
292 Ga0105249_10991952
293 Ga0157370_10845663
294 Ga0157369_10344842
295 Ga0157378_10661681
296 Ga0163162_10280218
297 Ga0157372_11615027
298 Ga0157375_10609965
299 Ga0157375_11452055
300 Ga0157377_10497254
301 Ga0163161_10549807
302 Ga0207692_10345108
303 Ga0207699_10955813
304 Ga0207684_10010285
305 Ga0207684_10075180
306 Ga0207684_10163541
307 Ga0207707_10275885
308 Ga0207695_10112329
309 Ga0207671_10000014
310 Ga0207646_10036897
311 Ga0207646_10133793
312 Ga0207669_10434036
313 Ga0207708_10171904
314 Ga0207648_10127269
315 Ga0207674_10419489
316 Ga0209969_1000757
317 Ga0209967_1000508
318 Ga0209981_1001187
319 Ga0210000_1000253
320 Ga0209995_1001001
321 Ga0209968_1030546
322 Ga0209971_1002501
323 Ga0209974_10002424
324 Ga0207428_10138939
325 Ga0207428_10323199
326 Ga0268265_10204764
327 Ga0268264_10391282
328 Ga0265318_10048302
329 Ga0307515_10008048
330 Ga0265338_10008723
331 Ga0265320_10100382
332 Ga0265329_10157872
333 Ga0265339_10227025
334 Ga0265316_10019935
335 Ga0265314_10072711
336 Ga0307405_11261771
337 Ga0307410_10170626
338 Ga0326468_10000135
339 Ga0307406_10041312
340 Ga0307406_10059094
341 Ga0307407_10106578
342 Ga0307412_10098527
343 Ga0307412_10336382
344 Ga0307409_100485829
345 Ga0307416_100210891
346 Ga0307414_10835196
347 Ga0307415_100020358
348 Ga0439447_042404
349 Ga0439461_0126661
350 Ga0451837_0140314
351 Ga0439449_0009704
352 Ga0451577_0000086
353 Ga0466972_0001833
354 Ga0453683_0000600
355 Ga0453683_0102393
356 Ga0466965_0003079
357 Ga0466964_0027060
358 Ga0453684_0000303
359 Ga0453684_0002128
360 Ga0453684_0015470
361 Ga0453684_0029367
362 Ga0451576_0000612
363 Ga0451576_0008251
364 Ga0495638_0096970
365 Ga0495653_0001958
366 Ga0495639_0354287
367 Ga0495649_0179268
368 Ga0495676_0023213
369 Ga0495686_0002359
370 Ga0496104_1028108
371 Ga0496126_0128057
372 Ga0501032_0121747
373 Ga0501034_0094722
374 Ga0501037_0005790
375 Ga0501038_0074505
376 Ga0501039_0032881
377 Ga0501040_0165451
378 Ga0501043_0242224
379 Ga0501046_0010107
380 Ga0501076_0759529
381 Ga0501221_058866
382 Ga0501080_0396254
383 Ga0501081_0361461
384 Ga0501044_0043394
385 Ga0501044_0163332
386 Ga0501045_0068881
387 nmdc:mga05p37_159306_c1
388 nmdc:mga05p37_164776_c1
389 nmdc:mga05p37_722950_c1
390 nmdc:mga05p37_725730_c1
391 nmdc:mga05p37_9805_c1
392 nmdc:mga09592_54906_c1
393 nmdc:mga0qj67_125076_c1
394 nmdc:mga0qj67_467241_c1
395 nmdc:mga0qj67_590970_c1
396 nmdc:mga06r32_129037_c1
397 nmdc:mga06r32_155789_c1
398 nmdc:mga06r32_999314_c1
399 nmdc:mga08y16_1084515_c1
400 nmdc:mga08y16_1396125_c1
401 nmdc:mga08y16_150835_c1
402 nmdc:mga08y16_65128_c1
403 nmdc:mga0n895_275685_c1
404 nmdc:mga0n895_277562_c1
405 nmdc:mga0n895_559468_c1
406 nmdc:mga0n895_898991_c1
407 nmdc:mga0rr50_452281_c1
408 nmdc:mga0a205_324301_c1
409 nmdc:mga0a205_349893_c1
410 nmdc:mga0a205_930085_c1
411 Ga0500577_0000501
412 Ga0590077_006368
413 8002779777
414 8023628110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

37

185

0.95

PF02525

Flavodoxin_2

Flavodoxin-like fold

37

174

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gfq-assembly1.cif.gz_A structure of yhda, k109l variant 0.8625 5 179
2gsw-assembly2.cif.gz_D crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 0.8571 5 179
3gfr-assembly2.cif.gz_B structure of yhda, d137l variant 0.856 5 178
3gfq-assembly1.cif.gz_A structure of yhda, k109l variant 0.8483 5 179
2gsw-assembly2.cif.gz_D crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 0.8431 5 179
ID Description Score Start End Superfamily
af_Q9USJ6_13_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9618 4 145 3.40.50.360
af_Q54QT4_9_187_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8385 4 174 3.40.50.360
2gswD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8347 7 179 3.40.50.360
af_Q2G135_1_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.832 4 181 3.40.50.360
af_Q9USJ6_13_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8261 4 145 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A1M6TS00-F1-model_v4 NAD(P)H-dependent FMN reductase 0.999 1 184 GO:0005829
GO:0010181
GO:0016491
AF-A0A066U3V4-F1-model_v4 NADPH-dependent FMN reductase-like domain-containing protein 0.9989 1 185 GO:0005829
GO:0010181
GO:0016491
GO:0030638
AF-A0A1H3C706-F1-model_v4 NAD(P)H-dependent FMN reductase 0.9984 1 183 GO:0005829
GO:0010181
GO:0016491
AF-A0A7Y6IFD9-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9983 1 185 GO:0005829
GO:0010181
GO:0016491
AF-V6KP05-F1-model_v4 deleted 0.9981 2 184

Map