F292104

General Info

Members Datasets Scaffolds Average Seq Length
190 151 189 171

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100114497|Ga0070708_1001144973
Length 182
Sequence VGGVVAGGAEGGDVPEFSVNPTRFDPYKNFKFRVKWDNKYVAGVTKMSPLRRITEVVEHREGGDPSTSRKSPGRTRYEPITLERGLTHDTAFEDWVNKVWKLGAGPGSEVTFADFRKDIIIDLFNEAGQKVFSYKVYRCWVSEYQALPDLDANADAVAIESIKLENEGWERDHDVVEPQEPT

Samples

Sample ID Description Type Environment
1 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
84 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
90 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
110 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
111 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
112 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
120 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
121 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
136 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
137 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
138 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
139 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
146 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.26
Metatranscriptomes 4.21
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.37
Nodule 0
Rhizoplane 3.16
Rhizosphere 85.79
Stem 0
Stem Tuber 0
Unclassified 3.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006759J45824_1073988 3300003163 Archaea 2589
2 Ga0006770J48903_1049240 3300003305 Archaea 1615
3 JGI25407J50210_10032618 3300003373 Bacteria 1347
4 Ga0007417J51691_1052814 3300003544 Archaea 2245
5 Ga0007416J51690_1087735 3300003577 Archaea 2187
6 Ga0032354_1070135 3300003693 Archaea 2947
7 Ga0058860_11515216 3300004801 Bacteria 588
8 Ga0065707_10295901 3300005295 Bacteria 1013
9 Ga0070689_100643503 3300005340 Bacteria 922
10 Ga0070689_101240901 3300005340 Bacteria 670
11 Ga0070692_10420532 3300005345 Bacteria 848
12 Ga0070668_100074581 3300005347 Bacteria 2647
13 Ga0070671_100070197 3300005355 Bacteria 2922
14 Ga0070674_100107556 3300005356 Bacteria 2042
15 Ga0070688_100982930 3300005365 Bacteria 670
16 Ga0070667_100448124 3300005367 Bacteria 1179
17 Ga0070714_100810865 3300005435 Bacteria 907
18 Ga0070713_100029346 3300005436 Bacteria 4355
19 Ga0070711_100092033 3300005439 Bacteria 2187
20 Ga0070708_100114497 3300005445 Bacteria 2481
21 Ga0068867_101176704 3300005459 Bacteria 703
22 Ga0070707_100000092 3300005468 Bacteria 80536
23 Ga0070698_100031632 3300005471 Bacteria 5485
24 Ga0070698_100129368 3300005471 Bacteria 2481
25 Ga0070699_100000385 3300005518 Bacteria 42861
26 Ga0070684_100496781 3300005535 Bacteria 1130
27 Ga0068853_100161499 3300005539 Bacteria 2022
28 Ga0068853_100642898 3300005539 Bacteria 1009
29 Ga0068853_101399556 3300005539 Bacteria 676
30 Ga0068854_100054594 3300005578 Bacteria 2874
31 Ga0068861_100361092 3300005719 Bacteria 1277
32 Ga0068851_10376414 3300005834 Bacteria 831
33 Ga0068858_100498170 3300005842 Bacteria 1177
34 Ga0068860_100488994 3300005843 Bacteria 1227
35 Ga0068862_100070600 3300005844 Bacteria 3015
36 Ga0081455_10018294 3300005937 Bacteria 6680
37 Ga0081455_10064848 3300005937 Bacteria 3057
38 Ga0081538_10014624 3300005981 Bacteria 6135
39 Ga0081538_10095160 3300005981 Bacteria 1523
40 Ga0081538_10124034 3300005981 Bacteria 1233
41 Ga0081539_10039178 3300005985 Bacteria 2800
42 Ga0070717_10500460 3300006028 Bacteria 1098
43 Ga0075365_10013352 3300006038 Bacteria 4908
44 Ga0075365_10044720 3300006038 Bacteria 2903
45 Ga0075364_10015080 3300006051 Bacteria 4785
46 Ga0070716_100016238 3300006173 Bacteria 3838
47 Ga0070716_100061021 3300006173 Bacteria 2180
48 Ga0075362_10015382 3300006177 Bacteria 3111
49 Ga0075367_10013653 3300006178 Bacteria 4375
50 Ga0075366_10000560 3300006195 Bacteria 17397
51 Ga0075370_10011816 3300006353 Bacteria 4597
52 Ga0075428_100002019 3300006844 Bacteria 21889
53 Ga0075428_100023128 3300006844 Bacteria 6875
54 Ga0075428_100107171 3300006844 Bacteria 3046
55 Ga0075430_100010064 3300006846 Bacteria 7999
56 Ga0075430_100134816 3300006846 Bacteria 2058
57 Ga0075431_100002007 3300006847 Bacteria 19419
58 Ga0075431_100227788 3300006847 Bacteria 1900
59 Ga0075431_100292568 3300006847 Bacteria 1647
60 Ga0075431_101064665 3300006847 Bacteria 774
61 Ga0075429_100002404 3300006880 Bacteria 15762
62 Ga0075429_100036312 3300006880 Bacteria 4286
63 Ga0068865_100025720 3300006881 Bacteria 3876
64 Ga0099795_10031662 3300007788 Bacteria 1823
65 Ga0105240_10115378 3300009093 Bacteria 3242
66 Ga0111539_10000427 3300009094 Bacteria 52916
67 Ga0111539_10040532 3300009094 Bacteria 5605
68 Ga0105247_10307655 3300009101 Bacteria 1102
69 Ga0114129_10002068 3300009147 Bacteria 27572
70 Ga0105243_10708750 3300009148 Bacteria 982
71 Ga0105241_10019364 3300009174 Bacteria 5019
72 Ga0105237_10025944 3300009545 Bacteria 5991
73 Ga0105239_10042495 3300010375 Bacteria 4981
74 Ga0105239_11104383 3300010375 Bacteria 913
75 Ga0105246_10640417 3300011119 Bacteria 924
76 Ga0157374_11416631 3300013296 Unclassified 718
77 Ga0213872_10005252 3300021361 Bacteria 6698
78 Ga0209455_1026079 3300025272 Bacteria 1053
79 Ga0207692_10034578 3300025898 Bacteria 2448
80 Ga0207695_10028571 3300025913 Bacteria 6179
81 Ga0207663_10121902 3300025916 Bacteria 1787
82 Ga0207646_10000047 3300025922 Bacteria 172446
83 Ga0207700_10045478 3300025928 Bacteria 3240
84 Ga0207664_11068707 3300025929 Bacteria 722
85 Ga0207644_10052422 3300025931 Bacteria 2932
86 Ga0207670_10578939 3300025936 Bacteria 920
87 Ga0207669_10129048 3300025937 Bacteria 1733
88 Ga0207704_10079761 3300025938 Bacteria 2111
89 Ga0207665_10013546 3300025939 Bacteria 5362
90 Ga0207665_10048470 3300025939 Bacteria 2851
91 Ga0207691_10108459 3300025940 Bacteria 2471
92 Ga0207667_11461941 3300025949 Bacteria 655
93 Ga0207640_10042831 3300025981 Bacteria 2889
94 Ga0207703_10369592 3300026035 Bacteria 1324
95 Ga0207639_10159224 3300026041 Bacteria 1901
96 Ga0207639_11157777 3300026041 Bacteria 726
97 Ga0207639_11184904 3300026041 Bacteria 717
98 Ga0207648_10043416 3300026089 Bacteria 3946
99 Ga0207428_10000887 3300027907 Bacteria 33591
100 Ga0207428_10155456 3300027907 Bacteria 1740
101 Ga0268265_10092053 3300028380 Bacteria 2426
102 Ga0268264_10419195 3300028381 Bacteria 1291
103 Ga0307515_10000008 3300028794 Bacteria 663660
104 Ga0307509_10163929 3300031507 Bacteria 2115
105 Ga0316576_10282287 3300031727 Bacteria 1243
106 Ga0316577_10052998 3300031733 Bacteria 2264
107 Ga0307416_101437978 3300032002 Bacteria 795
108 Ga0373956_0032054 3300035119 Bacteria 2305
109 Ga0373935_0007855 3300035692 Bacteria 6400
110 Ga0373937_0008634 3300036401 Bacteria 8852
111 Ga0373937_0100875 3300036401 Bacteria 2679
112 Ga0373937_1144399 3300036401 Unclassified 727
113 Ga0316582_0043606 3300036647 Bacteria 2815
114 Ga0316582_0070556 3300036647 Bacteria 2261
115 Ga0316582_0107010 3300036647 Unclassified 1858
116 Ga0316584_0056837 3300036712 Bacteria 2929
117 Ga0395905_0012656 3300037471 Bacteria 8118
118 Ga0395901_0822560 3300038443 Bacteria 916
119 Ga0400484_00936 3300038725 Bacteria 3055
120 Ga0400484_03661 3300038725 Bacteria 2442
121 Ga0436361_0642337 3300039447 Bacteria 6207
122 Ga0439466_0110420 3300041411 Bacteria 853
123 Ga0453683_0002090 3300044673 Bacteria 15951
124 Ga0466963_0032798 3300044694 Bacteria 3366
125 Ga0453684_0965463 3300044712 Bacteria 908
126 Ga0451576_0146136 3300045051 Bacteria 2465
127 Ga0451576_0902395 3300045051 Bacteria 927
128 Ga0466967_0212299 3300045976 Bacteria 1836
129 Ga0466967_0501290 3300045976 Bacteria 1191
130 Ga0495592_0000065 3300046454 Bacteria 95955
131 Ga0495651_0000001 3300046462 Bacteria 210544
132 Ga0495651_0415210 3300046462 Bacteria 876
133 Ga0495608_0002881 3300046511 Bacteria 12323
134 Ga0495618_0007986 3300046514 Bacteria 6403
135 Ga0495628_0000912 3300046516 Bacteria 27120
136 Ga0495652_0000015 3300046529 Bacteria 222624
137 Ga0495587_0000051 3300046536 Bacteria 101923
138 Ga0495645_0000036 3300046543 Bacteria 100735
139 Ga0495657_0025724 3300046675 Bacteria 4177
140 Ga0495599_0000049 3300046678 Bacteria 84569
141 Ga0495623_0000011 3300046679 Bacteria 120974
142 Ga0495646_0002994 3300046680 Bacteria 10478
143 Ga0495600_0064082 3300046809 Bacteria 2402
144 Ga0495604_0000004 3300047317 Bacteria 456385
145 Ga0495680_0015287 3300047322 Bacteria 6624
146 Ga0495675_0000018 3300047444 Bacteria 115435
147 Ga0495602_0000207 3300048088 Bacteria 54864
148 Ga0496101_0436309 3300048904 Bacteria 1033
149 Ga0496109_0185506 3300048912 Bacteria 1955
150 Ga0496110_0060682 3300048913 Bacteria 3336
151 Ga0496111_0049668 3300048914 Bacteria 3025
152 Ga0496112_0752235 3300048915 Bacteria 901
153 Ga0496114_0186535 3300048917 Bacteria 1813
154 Ga0496121_0000635 3300048924 Bacteria 65524
155 Ga0501033_0000895 3300049570 Bacteria 27246
156 Ga0501036_0444557 3300049572 Bacteria 1080
157 Ga0501037_0049382 3300049573 Bacteria 3081
158 Ga0501038_0000959 3300049574 Bacteria 25782
159 Ga0501047_0054330 3300049581 Bacteria 3874
160 Ga0501048_0403079 3300049582 Bacteria 978
161 Ga0501075_0988955 3300049591 Bacteria 639
162 Ga0501076_0360235 3300049592 Bacteria 1195
163 Ga0501269_027861 3300049766 Bacteria 718
164 Ga0501045_0191250 3300049824 Bacteria 1525
165 Ga0501045_0515463 3300049824 Bacteria 888
166 Ga0501045_0613644 3300049824 Bacteria 805
167 nmdc:mga03683_76374_c1 3300050489 Bacteria 1440
168 nmdc:mga0yw44_255962_c1 3300050492 Bacteria 1166
169 nmdc:mga0yw44_397330_c1 3300050492 Bacteria 932
170 nmdc:mga0k408_6501_c1 3300050493 Bacteria 6229
171 nmdc:mga06z11_599890_c1 3300050494 Bacteria 670
172 nmdc:mga07m45_15065_c1 3300050496 Bacteria 4129
173 nmdc:mga05p37_843_c1 3300050507 Bacteria 34407
174 nmdc:mga09592_45592_c1 3300050508 Bacteria 3693
175 nmdc:mga09592_55_c1 3300050508 Bacteria 62203
176 nmdc:mga09592_634238_c1 3300050508 Bacteria 913
177 nmdc:mga0qj67_1_c2 3300050509 Bacteria 129768
178 nmdc:mga0qj67_544221_c1 3300050509 Unclassified 931
179 nmdc:mga0qj67_78797_c1 3300050509 Bacteria 2637
180 nmdc:mga0qj67_85255_c1 3300050509 Bacteria 2533
181 nmdc:mga06r32_107_c1 3300050510 Bacteria 58634
182 nmdc:mga08y16_1069_c1 3300050511 Bacteria 26946
183 nmdc:mga08y16_11675_c1 3300050511 Bacteria 9228
184 Ga0495601_0004689 3300053077 Bacteria 7918
185 Ga0495595_0063641 3300053084 Bacteria 1732
186 Ga0495619_0003698 3300053085 Bacteria 9861
187 Ga0501084_1302976 3300054114 Bacteria 609
188 Ga0587085_007314 3300059506 Unclassified 1374
189 Ga0587109_001612 3300059624 Unclassified 2682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050492 nmdc:mga0yw44_397330_c1 nmdc:mga0yw44_397330_c1_464_883 129
2 3300013296 Ga0157374_11416631 Ga0157374_114166311 133
3 3300036401 Ga0373937_1144399 Ga0373937_1144399_100_549 136
4 3300049570 Ga0501033_0000895 Ga0501033_0000895_21818_22345 146
5 3300049574 Ga0501038_0000959 Ga0501038_0000959_3988_4515 146
6 3300049824 Ga0501045_0515463 Ga0501045_0515463_163_690 148
7 3300036647 Ga0316582_0107010 Ga0316582_0107010_462_929 151
8 3300006844 Ga0075428_100002019 Ga0075428_10000201914 152
9 3300006846 Ga0075430_100010064 Ga0075430_1000100649 152
10 3300006847 Ga0075431_100002007 Ga0075431_10000200716 152
11 3300006880 Ga0075429_100002404 Ga0075429_10000240414 152
12 3300009147 Ga0114129_10002068 Ga0114129_100020683 152
13 3300050507 nmdc:mga05p37_843_c1 nmdc:mga05p37_843_c1_12074_12583 152
14 3300050508 nmdc:mga09592_55_c1 nmdc:mga09592_55_c1_31907_32416 152
15 3300050509 nmdc:mga0qj67_1_c2 nmdc:mga0qj67_1_c2_83550_84059 152
16 3300050510 nmdc:mga06r32_107_c1 nmdc:mga06r32_107_c1_27091_27600 152
17 iso_pu_bacteria 8002869464 8002872572 153
18 3300004801 Ga0058860_11515216 Ga0058860_115152161 154
19 3300005295 Ga0065707_10295901 Ga0065707_102959012 154
20 3300005468 Ga0070707_100000092 Ga0070707_10000009252 154
21 3300005937 Ga0081455_10018294 Ga0081455_100182946 154
22 3300005937 Ga0081455_10064848 Ga0081455_100648483 154
23 3300005981 Ga0081538_10095160 Ga0081538_100951601 154
24 3300005981 Ga0081538_10124034 Ga0081538_101240342 154
25 3300006844 Ga0075428_100107171 Ga0075428_1001071712 154
26 3300006847 Ga0075431_100227788 Ga0075431_1002277882 154
27 3300006847 Ga0075431_101064665 Ga0075431_1010646651 154
28 3300007788 Ga0099795_10031662 Ga0099795_100316622 154
29 3300009094 Ga0111539_10040532 Ga0111539_100405323 154
30 3300011119 Ga0105246_10640417 Ga0105246_106404172 154
31 3300025898 Ga0207692_10034578 Ga0207692_100345786 154
32 3300025922 Ga0207646_10000047 Ga0207646_1000004717 154
33 3300026089 Ga0207648_10043416 Ga0207648_100434162 154
34 3300027907 Ga0207428_10155456 Ga0207428_101554563 154
35 3300036401 Ga0373937_0100875 Ga0373937_0100875_782_1285 154
36 3300038725 Ga0400484_03661 Ga0400484_03661_1162_1683 154
37 3300044673 Ga0453683_0002090 Ga0453683_0002090_3376_3864 154
38 3300048917 Ga0496114_0186535 Ga0496114_0186535_1004_1504 154
39 3300048924 Ga0496121_0000635 Ga0496121_0000635_58860_59360 154
40 3300049591 Ga0501075_0988955 Ga0501075_0988955_104_604 154
41 3300049824 Ga0501045_0191250 Ga0501045_0191250_123_623 154
42 3300050509 nmdc:mga0qj67_544221_c1 nmdc:mga0qj67_544221_c1_282_782 154
43 3300050509 nmdc:mga0qj67_85255_c1 nmdc:mga0qj67_85255_c1_44_544 154
44 3300050511 nmdc:mga08y16_11675_c1 nmdc:mga08y16_11675_c1_1365_1865 154
45 3300003373 JGI25407J50210_10032618 JGI25407J50210_100326181 155
46 3300005535 Ga0070684_100496781 Ga0070684_1004967812 155
47 3300005981 Ga0081538_10014624 Ga0081538_100146243 155
48 3300006881 Ga0068865_100025720 Ga0068865_1000257204 155
49 3300025938 Ga0207704_10079761 Ga0207704_100797612 155
50 3300025949 Ga0207667_11461941 Ga0207667_114619412 155
51 3300026041 Ga0207639_10159224 Ga0207639_101592243 155
52 3300031733 Ga0316577_10052998 Ga0316577_100529985 155
53 3300035119 Ga0373956_0032054 Ga0373956_0032054_58_582 155
54 3300036401 Ga0373937_0008634 Ga0373937_0008634_3563_4087 155
55 3300036647 Ga0316582_0043606 Ga0316582_0043606_2225_2725 155
56 3300038725 Ga0400484_00936 Ga0400484_00936_1829_2362 155
57 3300045051 Ga0451576_0902395 Ga0451576_0902395_137_664 155
58 3300045976 Ga0466967_0501290 Ga0466967_0501290_410_934 155
59 3300046454 Ga0495592_0000065 Ga0495592_0000065_12651_13175 155
60 3300046462 Ga0495651_0000001 Ga0495651_0000001_32138_32662 155
61 3300046511 Ga0495608_0002881 Ga0495608_0002881_9804_10328 155
62 3300046514 Ga0495618_0007986 Ga0495618_0007986_721_1245 155
63 3300046516 Ga0495628_0000912 Ga0495628_0000912_23136_23660 155
64 3300046529 Ga0495652_0000015 Ga0495652_0000015_104666_105190 155
65 3300046536 Ga0495587_0000051 Ga0495587_0000051_21614_22138 155
66 3300046543 Ga0495645_0000036 Ga0495645_0000036_25989_26513 155
67 3300046675 Ga0495657_0025724 Ga0495657_0025724_690_1214 155
68 3300046678 Ga0495599_0000049 Ga0495599_0000049_57878_58402 155
69 3300046679 Ga0495623_0000011 Ga0495623_0000011_53510_54034 155
70 3300046680 Ga0495646_0002994 Ga0495646_0002994_6333_6857 155
71 3300046809 Ga0495600_0064082 Ga0495600_0064082_1379_1903 155
72 3300047317 Ga0495604_0000004 Ga0495604_0000004_423660_424184 155
73 3300047322 Ga0495680_0015287 Ga0495680_0015287_1352_1876 155
74 3300047444 Ga0495675_0000018 Ga0495675_0000018_69025_69549 155
75 3300048088 Ga0495602_0000207 Ga0495602_0000207_41679_42203 155
76 3300048904 Ga0496101_0436309 Ga0496101_0436309_120_647 155
77 3300048912 Ga0496109_0185506 Ga0496109_0185506_1130_1657 155
78 3300048915 Ga0496112_0752235 Ga0496112_0752235_228_755 155
79 3300053077 Ga0495601_0004689 Ga0495601_0004689_3852_4376 155
80 3300053084 Ga0495595_0063641 Ga0495595_0063641_232_756 155
81 3300053085 Ga0495619_0003698 Ga0495619_0003698_4974_5498 155
82 3300005340 Ga0070689_100643503 Ga0070689_1006435032 156
83 3300005340 Ga0070689_101240901 Ga0070689_1012409011 156
84 3300005345 Ga0070692_10420532 Ga0070692_104205321 156
85 3300005347 Ga0070668_100074581 Ga0070668_1000745812 156
86 3300005355 Ga0070671_100070197 Ga0070671_1000701972 156
87 3300005356 Ga0070674_100107556 Ga0070674_1001075562 156
88 3300005365 Ga0070688_100982930 Ga0070688_1009829301 156
89 3300005367 Ga0070667_100448124 Ga0070667_1004481241 156
90 3300005435 Ga0070714_100810865 Ga0070714_1008108652 156
91 3300005436 Ga0070713_100029346 Ga0070713_1000293462 156
92 3300005439 Ga0070711_100092033 Ga0070711_1000920332 156
93 3300005445 Ga0070708_100114497 Ga0070708_1001144973 156
94 3300005459 Ga0068867_101176704 Ga0068867_1011767041 156
95 3300005471 Ga0070698_100031632 Ga0070698_1000316325 156
96 3300005471 Ga0070698_100129368 Ga0070698_1001293683 156
97 3300005518 Ga0070699_100000385 Ga0070699_1000003858 156
98 3300005539 Ga0068853_100161499 Ga0068853_1001614993 156
99 3300005539 Ga0068853_100642898 Ga0068853_1006428981 156
100 3300005539 Ga0068853_101399556 Ga0068853_1013995561 156
101 3300005578 Ga0068854_100054594 Ga0068854_1000545943 156
102 3300005719 Ga0068861_100361092 Ga0068861_1003610922 156
103 3300005834 Ga0068851_10376414 Ga0068851_103764141 156
104 3300005842 Ga0068858_100498170 Ga0068858_1004981702 156
105 3300005843 Ga0068860_100488994 Ga0068860_1004889942 156
106 3300005844 Ga0068862_100070600 Ga0068862_1000706002 156
107 3300005985 Ga0081539_10039178 Ga0081539_100391783 156
108 3300006028 Ga0070717_10500460 Ga0070717_105004602 156
109 3300006038 Ga0075365_10013352 Ga0075365_100133523 156
110 3300006038 Ga0075365_10044720 Ga0075365_100447203 156
111 3300006051 Ga0075364_10015080 Ga0075364_100150803 156
112 3300006173 Ga0070716_100016238 Ga0070716_1000162382 156
113 3300006173 Ga0070716_100061021 Ga0070716_1000610212 156
114 3300006177 Ga0075362_10015382 Ga0075362_100153823 156
115 3300006178 Ga0075367_10013653 Ga0075367_100136534 156
116 3300006195 Ga0075366_10000560 Ga0075366_1000056013 156
117 3300006353 Ga0075370_10011816 Ga0075370_100118163 156
118 3300006844 Ga0075428_100023128 Ga0075428_1000231285 156
119 3300006846 Ga0075430_100134816 Ga0075430_1001348162 156
120 3300006847 Ga0075431_100292568 Ga0075431_1002925682 156
121 3300006880 Ga0075429_100036312 Ga0075429_1000363122 156
122 3300009093 Ga0105240_10115378 Ga0105240_101153782 156
123 3300009094 Ga0111539_10000427 Ga0111539_1000042721 156
124 3300009101 Ga0105247_10307655 Ga0105247_103076552 156
125 3300009148 Ga0105243_10708750 Ga0105243_107087502 156
126 3300009174 Ga0105241_10019364 Ga0105241_100193642 156
127 3300009545 Ga0105237_10025944 Ga0105237_100259442 156
128 3300010375 Ga0105239_10042495 Ga0105239_100424952 156
129 3300010375 Ga0105239_11104383 Ga0105239_111043831 156
130 3300021361 Ga0213872_10005252 Ga0213872_100052522 156
131 3300025272 Ga0209455_1026079 Ga0209455_10260792 156
132 3300025913 Ga0207695_10028571 Ga0207695_100285713 156
133 3300025916 Ga0207663_10121902 Ga0207663_101219022 156
134 3300025928 Ga0207700_10045478 Ga0207700_100454784 156
135 3300025929 Ga0207664_11068707 Ga0207664_110687071 156
136 3300025931 Ga0207644_10052422 Ga0207644_100524223 156
137 3300025936 Ga0207670_10578939 Ga0207670_105789392 156
138 3300025937 Ga0207669_10129048 Ga0207669_101290482 156
139 3300025939 Ga0207665_10013546 Ga0207665_100135464 156
140 3300025939 Ga0207665_10048470 Ga0207665_100484702 156
141 3300025940 Ga0207691_10108459 Ga0207691_101084592 156
142 3300025981 Ga0207640_10042831 Ga0207640_100428312 156
143 3300026035 Ga0207703_10369592 Ga0207703_103695922 156
144 3300026041 Ga0207639_11157777 Ga0207639_111577771 156
145 3300026041 Ga0207639_11184904 Ga0207639_111849042 156
146 3300027907 Ga0207428_10000887 Ga0207428_1000088714 156
147 3300028380 Ga0268265_10092053 Ga0268265_100920532 156
148 3300028381 Ga0268264_10419195 Ga0268264_104191952 156
149 3300028794 Ga0307515_10000008 Ga0307515_10000008131 156
150 3300031507 Ga0307509_10163929 Ga0307509_101639292 156
151 3300031727 Ga0316576_10282287 Ga0316576_102822871 156
152 3300032002 Ga0307416_101437978 Ga0307416_1014379782 156
153 3300035692 Ga0373935_0007855 Ga0373935_0007855_1375_1899 156
154 3300036647 Ga0316582_0070556 Ga0316582_0070556_1287_1811 156
155 3300036712 Ga0316584_0056837 Ga0316584_0056837_826_1350 156
156 3300037471 Ga0395905_0012656 Ga0395905_0012656_7211_7735 156
157 3300038443 Ga0395901_0822560 Ga0395901_0822560_68_586 156
158 3300039447 Ga0436361_0642337 Ga0436361_0642337_2497_3024 156
159 3300041411 Ga0439466_0110420 Ga0439466_0110420_117_659 156
160 3300044694 Ga0466963_0032798 Ga0466963_0032798_1976_2497 156
161 3300044712 Ga0453684_0965463 Ga0453684_0965463_51_560 156
162 3300045051 Ga0451576_0146136 Ga0451576_0146136_1503_2027 156
163 3300045976 Ga0466967_0212299 Ga0466967_0212299_301_822 156
164 3300046462 Ga0495651_0415210 Ga0495651_0415210_310_837 156
165 3300048913 Ga0496110_0060682 Ga0496110_0060682_35_541 156
166 3300048914 Ga0496111_0049668 Ga0496111_0049668_1550_2056 156
167 3300049572 Ga0501036_0444557 Ga0501036_0444557_48_575 156
168 3300049573 Ga0501037_0049382 Ga0501037_0049382_1311_1826 156
169 3300049581 Ga0501047_0054330 Ga0501047_0054330_2816_3343 156
170 3300049582 Ga0501048_0403079 Ga0501048_0403079_40_555 156
171 3300049592 Ga0501076_0360235 Ga0501076_0360235_419_952 156
172 3300049766 Ga0501269_027861 Ga0501269_027861_176_703 156
173 3300049824 Ga0501045_0613644 Ga0501045_0613644_217_744 156
174 3300050489 nmdc:mga03683_76374_c1 nmdc:mga03683_76374_c1_726_1235 156
175 3300050492 nmdc:mga0yw44_255962_c1 nmdc:mga0yw44_255962_c1_542_1051 156
176 3300050493 nmdc:mga0k408_6501_c1 nmdc:mga0k408_6501_c1_556_1065 156
177 3300050494 nmdc:mga06z11_599890_c1 nmdc:mga06z11_599890_c1_145_654 156
178 3300050496 nmdc:mga07m45_15065_c1 nmdc:mga07m45_15065_c1_683_1192 156
179 3300050508 nmdc:mga09592_45592_c1 nmdc:mga09592_45592_c1_997_1506 156
180 3300050508 nmdc:mga09592_634238_c1 nmdc:mga09592_634238_c1_95_622 156
181 3300050509 nmdc:mga0qj67_78797_c1 nmdc:mga0qj67_78797_c1_734_1243 156
182 3300050511 nmdc:mga08y16_1069_c1 nmdc:mga08y16_1069_c1_5293_5802 156
183 3300054114 Ga0501084_1302976 Ga0501084_1302976_52_597 156
184 3300059506 Ga0587085_007314 Ga0587085_007314_405_914 156
185 3300059624 Ga0587109_001612 Ga0587109_001612_1947_2456 156
186 3300003163 Ga0006759J45824_1073988 Ga0006759J45824_10739882 158
187 3300003305 Ga0006770J48903_1049240 Ga0006770J48903_10492402 158
188 3300003544 Ga0007417J51691_1052814 Ga0007417J51691_10528142 158
189 3300003577 Ga0007416J51690_1087735 Ga0007416J51690_10877352 158
190 3300003693 Ga0032354_1070135 Ga0032354_10701352 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06841

Phage_T4_gp19

T4-like virus tail tube protein gp19

28

170

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j0f-assembly1.cif.gz_a cryo-em structure of an extracellular contractile injection system, pvc sheath/tube terminator in extended state 0.6658 16 158
6j0n-assembly1.cif.gz_n cryo-em structure of an extracellular contractile injection system, baseplate in extended state, refined in c6 symmetry 0.6651 14 157
8gra-assembly1.cif.gz_E structure of type vi secretion system cargo delivery vehicle hcp-vgrg-paar 0.642 14 157
7aeb-assembly1.cif.gz_Y cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the baseplate complex in extended state applied 6-fold symmetry. 0.6377 15 158
7b5h-assembly1.cif.gz_AM cryo-em structure of the contractile injection system base plate from anabaena pcc7120 0.6291 14 158
ID Description Score Start End Superfamily
af_P9WGT5_11_158_3.30.1330.90 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;D-3-phosphoglycerate dehydrogenase; domain 3 0.6996 102 123 3.30.1330.90
1lrzA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.6834 101 136 3.40.630.30
af_K7LE88_1237_1369_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6753 101 122 3.30.420.10
af_A0A0P0WZ39_9_84_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6469 94 118 3.30.420.10
af_O17609_194_349_3.40.630.90 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase; 0.6468 98 122 3.40.630.90
ID Description Score Start End GO Terms
AF-A0A3C0E4N7-F1-model_v4 Phage tail protein 0.8349 15 158 GO:0005198
AF-A0A661XWU2-F1-model_v4 Phage tail protein 0.8223 14 158 GO:0005198
AF-A0A3M1H4Z0-F1-model_v4 Uncharacterized protein 0.8049 13 158 GO:0005198
AF-A0A3C0E4N7-F1-model_v4 Phage tail protein 0.7974 15 158 GO:0005198
AF-A0A2H3LAJ6-F1-model_v4 Phage tail protein 0.7799 11 157 GO:0005198

Feature Viewer

pLDDT pTM Quality
78.15 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map