F280137

General Info

Members Datasets Scaffolds Average Seq Length
183 141 175 177

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10158339|rootL2_101583392
Length 181
Sequence VKWIWRLVALALLAWAVGFAIFMFSIGKPLDRAIETDAIVVLTGGTGRIDRGIELMRAHAAKRMLISGAAPDVRPIELAVRYHADPRLFACCIDLGHEAVDTRSNADETADWVREHGFTSVRLVTSDWHMPRATLELRKALNAKVRVQGDGVPTEPGLRTVIREYHKYLVRRLVLMVGAAA

Samples

Sample ID Description Type Environment
1 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
2 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
3 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
4 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
5 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
6 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
7 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
8 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
9 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
10 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
11 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
48 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
49 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
67 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
80 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
81 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
84 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
85 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
86 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
87 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
88 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
89 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
90 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
91 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
92 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
93 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
94 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
95 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
96 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
97 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
107 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
108 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
115 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
116 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
117 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
118 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
121 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
127 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
128 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
129 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
130 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
131 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
132 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
133 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
134 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
135 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
136 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
137 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
138 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
141 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.54
Metatranscriptomes 1.09
Isolates 4.37

Biome Distribution

Category Percentage (%)
Aerial Root 2.73
Bulb 0
Endosphere 35.52
Nodule 0
Rhizoplane 2.73
Rhizosphere 46.99
Stem 0
Stem Tuber 0
Unclassified 12.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c001469 3300000043 Bacteria 2596
2 LJQas_1011303 3300000549 Bacteria 1062
3 ARCol0yngRDRAFT_1002066 3300000652 Bacteria 1546
4 JGI25150J39212_1000966 3300002774 Bacteria 9083
5 JGI25150J39212_1014513 3300002774 Bacteria 1337
6 JGI25151J46595_10005487 3300003187 Bacteria 6544
7 JGI25153J46596_10000055 3300003215 Bacteria 135518
8 JGI25153J46596_10026503 3300003215 Bacteria 2049
9 rootH2_10137660 3300003320 Bacteria 1885
10 rootH2_10193027 3300003320 Bacteria 1452
11 rootL2_10038485 3300003322 Bacteria 1801
12 rootL2_10158339 3300003322 Bacteria 1926
13 Ga0055526_1004036 3300003771 Bacteria 9020
14 Ga0055537_1002102 3300003773 Bacteria 6999
15 Ga0055537_1010622 3300003773 Bacteria 1928
16 Ga0055524_1000244 3300003775 Bacteria 56875
17 Ga0055536_1022115 3300003781 Bacteria 1907
18 Ga0055528_1037348 3300003790 Bacteria 1144
19 Ga0055530_10000429 3300003791 Bacteria 37251
20 Ga0055530_10005249 3300003791 Bacteria 6251
21 Ga0055540_1001899 3300003792 Bacteria 11712
22 Ga0055531_10000472 3300003794 Bacteria 37251
23 Ga0055531_10009286 3300003794 Bacteria 5048
24 Ga0055543_1010488 3300004625 Bacteria 1941
25 Ga0065165_1005617 3300005262 Bacteria 6945
26 Ga0065165_1007153 3300005262 Bacteria 5584
27 Ga0065165_1016117 3300005262 Bacteria 2814
28 Ga0065165_1068420 3300005262 Bacteria 950
29 Ga0065165_1071403 3300005262 Bacteria 921
30 Ga0065707_10288991 3300005295 Bacteria 1029
31 Ga0070680_100000263 3300005336 Bacteria 34685
32 Ga0070682_100117819 3300005337 Bacteria 1778
33 Ga0070662_100832746 3300005457 Bacteria 785
34 Ga0070679_100672278 3300005530 Bacteria 978
35 Ga0068853_100294253 3300005539 Bacteria 1499
36 Ga0068853_100596324 3300005539 Bacteria 1049
37 Ga0068852_100525552 3300005616 Unclassified 1181
38 Ga0068859_100008543 3300005617 Bacteria 10360
39 Ga0068859_100009113 3300005617 Bacteria 10021
40 Ga0068861_100000188 3300005719 Bacteria 32872
41 Ga0068860_100022370 3300005843 Bacteria 6117
42 Ga0081539_10046257 3300005985 Bacteria 2495
43 Ga0068871_100607380 3300006358 Bacteria 995
44 Ga0097620_100008543 3300006931 Bacteria 10360
45 Ga0097620_100009113 3300006931 Bacteria 10021
46 Ga0105248_10013626 3300009177 Bacteria 8950
47 Ga0105248_10022189 3300009177 Bacteria 7038
48 Ga0157370_10929826 3300013104 Bacteria 789
49 Ga0157372_10518607 3300013307 Bacteria 1389
50 Ga0157372_10777670 3300013307 Bacteria 1113
51 Ga0157372_11858330 3300013307 Bacteria 692
52 Ga0163161_10138568 3300017792 Bacteria 1841
53 Ga0206354_10999519 3300020081 Bacteria 5356
54 Ga0206353_12009786 3300020082 Bacteria 8481
55 Ga0213876_10035137 3300021384 Bacteria 2644
56 Ga0207425_1000005 3300025245 Bacteria 900502
57 Ga0207425_1011667 3300025245 Bacteria 2086
58 Ga0209129_1003496 3300025258 Bacteria 6786
59 Ga0209565_1000029 3300025263 Bacteria 340335
60 Ga0209565_1000251 3300025263 Bacteria 57054
61 Ga0209673_1009829 3300025273 Bacteria 4098
62 Ga0209673_1032919 3300025273 Bacteria 1589
63 Ga0209676_1015042 3300025292 Bacteria 2871
64 Ga0209676_1029845 3300025292 Bacteria 1677
65 Ga0209025_1000993 3300025294 Bacteria 42002
66 Ga0209564_1001873 3300025295 Bacteria 18970
67 Ga0209758_1000002 3300025297 Bacteria 1400310
68 Ga0209758_1010016 3300025297 Bacteria 5756
69 Ga0209050_1000001 3300025298 Bacteria 3563507
70 Ga0209050_1000167 3300025298 Bacteria 151608
71 Ga0209050_1001659 3300025298 Bacteria 22539
72 Ga0209050_1005376 3300025298 Bacteria 8093
73 Ga0209050_1033162 3300025298 Bacteria 1571
74 Ga0209256_1000008 3300025299 Bacteria 975723
75 Ga0209051_1000360 3300025303 Bacteria 67080
76 Ga0209257_1000028 3300025304 Bacteria 699493
77 Ga0209257_1000893 3300025304 Bacteria 41890
78 Ga0209257_1019507 3300025304 Bacteria 2550
79 Ga0209257_1043258 3300025304 Bacteria 1322
80 Ga0207711_10012204 3300025941 Bacteria 7144
81 Ga0207658_10827986 3300025986 Bacteria 841
82 Ga0207675_100000077 3300026118 Bacteria 75568
83 Ga0207698_10312525 3300026142 Bacteria 1468
84 Ga0209974_10042767 3300027876 Bacteria 1508
85 Ga0268266_10259955 3300028379 Bacteria 1609
86 Ga0268264_10033690 3300028381 Bacteria 4211
87 Ga0314311_1259885 3300030733 Bacteria 2670
88 Ga0307513_10007151 3300031456 Bacteria 14509
89 Ga0307408_100014585 3300031548 Bacteria 5222
90 Ga0307405_10141102 3300031731 Bacteria 1680
91 Ga0307413_10320108 3300031824 Bacteria 1184
92 Ga0307410_10236399 3300031852 Bacteria 1414
93 Ga0307406_10011396 3300031901 Bacteria 5045
94 Ga0307406_10426353 3300031901 Bacteria 1058
95 Ga0307412_10267730 3300031911 Bacteria 1335
96 Ga0307409_100579415 3300031995 Bacteria 1106
97 Ga0307416_100071325 3300032002 Bacteria 2885
98 Ga0307414_10142613 3300032004 Bacteria 1878
99 Ga0307414_10250737 3300032004 Bacteria 1471
100 Ga0307414_10760329 3300032004 Bacteria 881
101 Ga0307411_10022855 3300032005 Bacteria 3692
102 Ga0307415_100954419 3300032126 Unclassified 794
103 Ga0307510_10000369 3300033180 Bacteria 42647
104 Ga0237819_00565 3300038705 Bacteria 12459
105 Ga0237816_02899 3300039145 Bacteria 1288
106 Ga0436365_0403468 3300039437 Bacteria 1416
107 Ga0436365_0922968 3300039437 Bacteria 9993
108 Ga0439436_0006762 3300041404 Bacteria 3524
109 Ga0439436_0020833 3300041404 Bacteria 1952
110 Ga0439461_0000005 3300041410 Bacteria 28399
111 Ga0439466_0036975 3300041411 Bacteria 1646
112 Ga0439465_0005156 3300041413 Bacteria 4192
113 Ga0439431_0000066 3300041997 Bacteria 16712
114 Ga0439431_0023153 3300041997 Bacteria 1501
115 Ga0439442_048277 3300042002 Bacteria 897
116 Ga0439445_0003804 3300042004 Bacteria 3392
117 Ga0439432_008221 3300042006 Bacteria 3669
118 Ga0439452_007753 3300042010 Bacteria 3267
119 Ga0439457_008668 3300042014 Bacteria 2389
120 Ga0439462_0007685 3300042015 Bacteria 2704
121 Ga0450920_009013 3300042122 Bacteria 1835
122 Ga0450894_017955 3300042131 Bacteria 945
123 Ga0439446_0011609 3300042156 Bacteria 2394
124 Ga0439434_0005169 3300042435 Bacteria 3816
125 Ga0466961_0101145 3300044693 Bacteria 1816
126 Ga0466968_0004499 3300044735 Bacteria 5214
127 Ga0466968_0060834 3300044735 Bacteria 1628
128 Ga0466970_0205109 3300044765 Bacteria 1097
129 Ga0466967_0682011 3300045976 Bacteria 1017
130 Ga0495583_0014224 3300046506 Bacteria 4400
131 Ga0495668_0037161 3300046616 Bacteria 2726
132 Ga0495611_0232130 3300046648 Bacteria 857
133 Ga0495625_0029470 3300046660 Bacteria 4103
134 Ga0495670_0036441 3300046691 Bacteria 2451
135 Ga0495677_0009238 3300047445 Bacteria 3642
136 Ga0495681_0068853 3300047470 Bacteria 1609
137 Ga0495686_0009998 3300047472 Bacteria 6779
138 Ga0496102_0000010 3300048905 Bacteria 324617
139 Ga0496102_0068254 3300048905 Bacteria 3262
140 Ga0496103_0000029 3300048906 Bacteria 213326
141 Ga0496105_0070015 3300048908 Bacteria 2900
142 Ga0496115_0000665 3300048918 Bacteria 25387
143 Ga0496116_0003035 3300048919 Bacteria 16987
144 Ga0496117_0000037 3300048920 Bacteria 324960
145 Ga0496118_0000034 3300048921 Bacteria 322764
146 Ga0496119_0146201 3300048922 Bacteria 1271
147 Ga0496120_0064008 3300048923 Bacteria 2043
148 Ga0496121_0077527 3300048924 Bacteria 2646
149 Ga0496123_0119414 3300048926 Bacteria 1487
150 Ga0496124_0000033 3300048927 Bacteria 330586
151 Ga0496124_0368527 3300048927 Bacteria 1009
152 Ga0501034_0148997 3300049571 Bacteria 2316
153 Ga0501043_0021740 3300049579 Bacteria 5030
154 Ga0501035_0507504 3300049822 Bacteria 992
155 Ga0501044_0034270 3300049823 Bacteria 5326
156 Ga0501044_0706516 3300049823 Bacteria 893
157 Ga0500643_000044 3300053087 Bacteria 155319
158 Ga0500643_002398 3300053087 Bacteria 9713
159 Ga0500583_0286666 3300053092 Bacteria 808
160 Ga0500566_0004226 3300053094 Bacteria 8564
161 Ga0500641_0294543 3300053096 Bacteria 668
162 Ga0500555_030018 3300053103 Bacteria 1544
163 Ga0500562_015916 3300053108 Bacteria 1932
164 Ga0500595_001321 3300053119 Bacteria 13433
165 Ga0500626_093497 3300053128 Bacteria 1318
166 Ga0500652_222027 3300053131 Bacteria 759
167 Ga0500658_0001159 3300053134 Bacteria 10717
168 Ga0500658_0010532 3300053134 Bacteria 3410
169 Ga0500559_0001036 3300053136 Bacteria 16988
170 Ga0500568_0014837 3300053139 Bacteria 3504
171 Ga0500577_0098782 3300053142 Bacteria 1190
172 Ga0500616_0057722 3300053153 Bacteria 2022
173 Ga0500645_000842 3300053730 Bacteria 18101
174 Ga0500645_067936 3300053730 Bacteria 1025
175 Ga0500661_005075 3300055283 Bacteria 2465

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003781 Ga0055536_1022115 Ga0055536_10221152 149
2 3300048927 Ga0496124_0368527 Ga0496124_0368527_14_463 149
3 3300013104 Ga0157370_10929826 Ga0157370_109298262 156
4 3300013307 Ga0157372_10518607 Ga0157372_105186072 156
5 iso_pu_bacteria 2928027323 2928029791 172
6 iso_pu_bacteria 2984555340 2984556650 172
7 iso_pu_bacteria 2984564862 2984565177 172
8 iso_pu_bacteria 2990265787 2990268244 172
9 iso_pu_bacteria 2993356040 2993356253 172
10 iso_pu_bacteria 2993693658 2993696724 172
11 3300039437 Ga0436365_0403468 Ga0436365_0403468_250_777 174
12 iso_pu_bacteria 2879163058 2879163694 174
13 3300005616 Ga0068852_100525552 Ga0068852_1005255522 175
14 3300006358 Ga0068871_100607380 Ga0068871_1006073801 175
15 3300013307 Ga0157372_10777670 Ga0157372_107776702 175
16 3300026142 Ga0207698_10312525 Ga0207698_103125252 175
17 3300031824 Ga0307413_10320108 Ga0307413_103201082 175
18 3300031901 Ga0307406_10426353 Ga0307406_104263532 175
19 3300032004 Ga0307414_10250737 Ga0307414_102507373 175
20 3300032005 Ga0307411_10022855 Ga0307411_100228554 175
21 3300044735 Ga0466968_0004499 Ga0466968_0004499_4479_5012 175
22 3300044735 Ga0466968_0060834 Ga0466968_0060834_163_696 175
23 3300000549 LJQas_1011303 LJQas_10113032 176
24 3300002774 JGI25150J39212_1000966 JGI25150J39212_10009667 176
25 3300003187 JGI25151J46595_10005487 JGI25151J46595_100054876 176
26 3300003215 JGI25153J46596_10000055 JGI25153J46596_100000553 176
27 3300003320 rootH2_10193027 rootH2_101930273 176
28 3300003771 Ga0055526_1004036 Ga0055526_10040367 176
29 3300003773 Ga0055537_1010622 Ga0055537_10106222 176
30 3300003792 Ga0055540_1001899 Ga0055540_10018997 176
31 3300005262 Ga0065165_1016117 Ga0065165_10161174 176
32 3300005262 Ga0065165_1068420 Ga0065165_10684202 176
33 3300005295 Ga0065707_10288991 Ga0065707_102889912 176
34 3300005336 Ga0070680_100000263 Ga0070680_1000002639 176
35 3300005337 Ga0070682_100117819 Ga0070682_1001178192 176
36 3300005457 Ga0070662_100832746 Ga0070662_1008327462 176
37 3300005530 Ga0070679_100672278 Ga0070679_1006722782 176
38 3300005539 Ga0068853_100294253 Ga0068853_1002942531 176
39 3300005539 Ga0068853_100596324 Ga0068853_1005963242 176
40 3300005617 Ga0068859_100008543 Ga0068859_1000085432 176
41 3300005843 Ga0068860_100022370 Ga0068860_1000223702 176
42 3300006931 Ga0097620_100008543 Ga0097620_1000085432 176
43 3300009177 Ga0105248_10013626 Ga0105248_100136269 176
44 3300013307 Ga0157372_11858330 Ga0157372_118583302 176
45 3300020081 Ga0206354_10999519 Ga0206354_109995194 176
46 3300020082 Ga0206353_12009786 Ga0206353_120097863 176
47 3300021384 Ga0213876_10035137 Ga0213876_100351374 176
48 3300025245 Ga0207425_1000005 Ga0207425_1000005693 176
49 3300025258 Ga0209129_1003496 Ga0209129_10034965 176
50 3300025263 Ga0209565_1000251 Ga0209565_100025134 176
51 3300025273 Ga0209673_1009829 Ga0209673_10098295 176
52 3300025292 Ga0209676_1015042 Ga0209676_10150422 176
53 3300025292 Ga0209676_1029845 Ga0209676_10298452 176
54 3300025294 Ga0209025_1000993 Ga0209025_100099328 176
55 3300025295 Ga0209564_1001873 Ga0209564_10018739 176
56 3300025297 Ga0209758_1000002 Ga0209758_1000002651 176
57 3300025298 Ga0209050_1000001 Ga0209050_1000001632 176
58 3300025298 Ga0209050_1001659 Ga0209050_10016592 176
59 3300025298 Ga0209050_1033162 Ga0209050_10331622 176
60 3300025303 Ga0209051_1000360 Ga0209051_100036058 176
61 3300025304 Ga0209257_1019507 Ga0209257_10195073 176
62 3300025986 Ga0207658_10827986 Ga0207658_108279862 176
63 3300027876 Ga0209974_10042767 Ga0209974_100427672 176
64 3300028381 Ga0268264_10033690 Ga0268264_100336905 176
65 3300031548 Ga0307408_100014585 Ga0307408_1000145853 176
66 3300031731 Ga0307405_10141102 Ga0307405_101411022 176
67 3300031852 Ga0307410_10236399 Ga0307410_102363992 176
68 3300031901 Ga0307406_10011396 Ga0307406_100113966 176
69 3300031911 Ga0307412_10267730 Ga0307412_102677302 176
70 3300031995 Ga0307409_100579415 Ga0307409_1005794151 176
71 3300032002 Ga0307416_100071325 Ga0307416_1000713252 176
72 3300032004 Ga0307414_10142613 Ga0307414_101426132 176
73 3300032004 Ga0307414_10760329 Ga0307414_107603291 176
74 3300032126 Ga0307415_100954419 Ga0307415_1009544192 176
75 3300038705 Ga0237819_00565 Ga0237819_00565_11735_12265 176
76 3300039145 Ga0237816_02899 Ga0237816_02899_277_807 176
77 3300039437 Ga0436365_0922968 Ga0436365_0922968_2510_3040 176
78 3300045976 Ga0466967_0682011 Ga0466967_0682011_31_561 176
79 3300046648 Ga0495611_0232130 Ga0495611_0232130_163_693 176
80 3300046691 Ga0495670_0036441 Ga0495670_0036441_518_1051 176
81 3300048905 Ga0496102_0000010 Ga0496102_0000010_293784_294314 176
82 3300048905 Ga0496102_0068254 Ga0496102_0068254_1672_2202 176
83 3300048906 Ga0496103_0000029 Ga0496103_0000029_182493_183023 176
84 3300048908 Ga0496105_0070015 Ga0496105_0070015_387_917 176
85 3300048918 Ga0496115_0000665 Ga0496115_0000665_13146_13676 176
86 3300048919 Ga0496116_0003035 Ga0496116_0003035_11946_12476 176
87 3300048920 Ga0496117_0000037 Ga0496117_0000037_294386_294916 176
88 3300048921 Ga0496118_0000034 Ga0496118_0000034_292190_292720 176
89 3300048922 Ga0496119_0146201 Ga0496119_0146201_223_753 176
90 3300048923 Ga0496120_0064008 Ga0496120_0064008_818_1348 176
91 3300048924 Ga0496121_0077527 Ga0496121_0077527_1236_1769 176
92 3300048926 Ga0496123_0119414 Ga0496123_0119414_434_964 176
93 3300048927 Ga0496124_0000033 Ga0496124_0000033_292190_292720 176
94 3300049571 Ga0501034_0148997 Ga0501034_0148997_881_1411 176
95 3300049579 Ga0501043_0021740 Ga0501043_0021740_824_1360 176
96 3300049823 Ga0501044_0034270 Ga0501044_0034270_3562_4098 176
97 3300053087 Ga0500643_000044 Ga0500643_000044_142082_142612 176
98 3300053092 Ga0500583_0286666 Ga0500583_0286666_90_623 176
99 3300053096 Ga0500641_0294543 Ga0500641_0294543_71_604 176
100 3300053108 Ga0500562_015916 Ga0500562_015916_715_1248 176
101 3300053119 Ga0500595_001321 Ga0500595_001321_9001_9534 176
102 3300053136 Ga0500559_0001036 Ga0500559_0001036_12793_13323 176
103 3300053139 Ga0500568_0014837 Ga0500568_0014837_2174_2707 176
104 3300053142 Ga0500577_0098782 Ga0500577_0098782_630_1160 176
105 3300053153 Ga0500616_0057722 Ga0500616_0057722_860_1393 176
106 3300055283 Ga0500661_005075 Ga0500661_005075_812_1342 176
107 iso_pu_bacteria 2643221622 2644127341 176
108 3300003320 rootH2_10137660 rootH2_101376602 177
109 3300003322 rootL2_10038485 rootL2_100384852 177
110 3300003322 rootL2_10158339 rootL2_101583392 177
111 3300005617 Ga0068859_100009113 Ga0068859_1000091136 177
112 3300005719 Ga0068861_100000188 Ga0068861_10000018827 177
113 3300005985 Ga0081539_10046257 Ga0081539_100462572 177
114 3300006931 Ga0097620_100009113 Ga0097620_1000091137 177
115 3300009177 Ga0105248_10022189 Ga0105248_100221895 177
116 3300017792 Ga0163161_10138568 Ga0163161_101385682 177
117 3300025941 Ga0207711_10012204 Ga0207711_100122045 177
118 3300026118 Ga0207675_100000077 Ga0207675_10000007726 177
119 3300031456 Ga0307513_10007151 Ga0307513_1000715110 177
120 3300033180 Ga0307510_10000369 Ga0307510_1000036937 177
121 3300044693 Ga0466961_0101145 Ga0466961_0101145_108_647 177
122 3300044765 Ga0466970_0205109 Ga0466970_0205109_307_849 177
123 3300046506 Ga0495583_0014224 Ga0495583_0014224_1956_2492 177
124 3300046616 Ga0495668_0037161 Ga0495668_0037161_1110_1646 177
125 3300046660 Ga0495625_0029470 Ga0495625_0029470_1596_2132 177
126 3300047445 Ga0495677_0009238 Ga0495677_0009238_198_734 177
127 3300047472 Ga0495686_0009998 Ga0495686_0009998_355_891 177
128 3300049822 Ga0501035_0507504 Ga0501035_0507504_312_848 177
129 3300049823 Ga0501044_0706516 Ga0501044_0706516_303_839 177
130 3300053087 Ga0500643_002398 Ga0500643_002398_7211_7747 177
131 3300053131 Ga0500652_222027 Ga0500652_222027_17_553 177
132 3300053730 Ga0500645_000842 Ga0500645_000842_2865_3398 177
133 3300053730 Ga0500645_067936 Ga0500645_067936_186_722 177
134 3300000043 ARcpr5yngRDRAFT_c001469 ARcpr5yngRDRAFT_0014692 180
135 3300000652 ARCol0yngRDRAFT_1002066 ARCol0yngRDRAFT_10020662 180
136 3300002774 JGI25150J39212_1014513 JGI25150J39212_10145132 180
137 3300003215 JGI25153J46596_10026503 JGI25153J46596_100265032 180
138 3300003773 Ga0055537_1002102 Ga0055537_10021027 180
139 3300003775 Ga0055524_1000244 Ga0055524_100024454 180
140 3300003790 Ga0055528_1037348 Ga0055528_10373482 180
141 3300003791 Ga0055530_10000429 Ga0055530_1000042938 180
142 3300003791 Ga0055530_10005249 Ga0055530_100052495 180
143 3300003794 Ga0055531_10000472 Ga0055531_1000047238 180
144 3300003794 Ga0055531_10009286 Ga0055531_100092862 180
145 3300004625 Ga0055543_1010488 Ga0055543_10104882 180
146 3300005262 Ga0065165_1005617 Ga0065165_10056172 180
147 3300005262 Ga0065165_1007153 Ga0065165_10071535 180
148 3300005262 Ga0065165_1071403 Ga0065165_10714032 180
149 3300025245 Ga0207425_1011667 Ga0207425_10116673 180
150 3300025263 Ga0209565_1000029 Ga0209565_1000029122 180
151 3300025273 Ga0209673_1032919 Ga0209673_10329192 180
152 3300025297 Ga0209758_1010016 Ga0209758_10100165 180
153 3300025298 Ga0209050_1000167 Ga0209050_100016720 180
154 3300025298 Ga0209050_1005376 Ga0209050_10053762 180
155 3300025299 Ga0209256_1000008 Ga0209256_1000008731 180
156 3300025304 Ga0209257_1000028 Ga0209257_1000028716 180
157 3300025304 Ga0209257_1000893 Ga0209257_100089320 180
158 3300025304 Ga0209257_1043258 Ga0209257_10432582 180
159 3300028379 Ga0268266_10259955 Ga0268266_102599552 180
160 3300030733 Ga0314311_1259885 Ga0314311_12598853 180
161 3300041404 Ga0439436_0006762 Ga0439436_0006762_303_845 180
162 3300041404 Ga0439436_0020833 Ga0439436_0020833_1027_1569 180
163 3300041410 Ga0439461_0000005 Ga0439461_0000005_6868_7410 180
164 3300041411 Ga0439466_0036975 Ga0439466_0036975_434_976 180
165 3300041413 Ga0439465_0005156 Ga0439465_0005156_2013_2555 180
166 3300041997 Ga0439431_0000066 Ga0439431_0000066_14529_15071 180
167 3300041997 Ga0439431_0023153 Ga0439431_0023153_674_1216 180
168 3300042002 Ga0439442_048277 Ga0439442_048277_169_711 180
169 3300042004 Ga0439445_0003804 Ga0439445_0003804_838_1380 180
170 3300042006 Ga0439432_008221 Ga0439432_008221_1759_2301 180
171 3300042010 Ga0439452_007753 Ga0439452_007753_653_1195 180
172 3300042014 Ga0439457_008668 Ga0439457_008668_509_1051 180
173 3300042015 Ga0439462_0007685 Ga0439462_0007685_1506_2048 180
174 3300042122 Ga0450920_009013 Ga0450920_009013_568_1110 180
175 3300042131 Ga0450894_017955 Ga0450894_017955_348_890 180
176 3300042156 Ga0439446_0011609 Ga0439446_0011609_1064_1606 180
177 3300042435 Ga0439434_0005169 Ga0439434_0005169_268_810 180
178 3300047470 Ga0495681_0068853 Ga0495681_0068853_700_1242 180
179 3300053094 Ga0500566_0004226 Ga0500566_0004226_6715_7257 180
180 3300053103 Ga0500555_030018 Ga0500555_030018_570_1112 180
181 3300053128 Ga0500626_093497 Ga0500626_093497_25_567 180
182 3300053134 Ga0500658_0001159 Ga0500658_0001159_8285_8827 180
183 3300053134 Ga0500658_0010532 Ga0500658_0010532_1018_1560 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02698

DUF218

DUF218 domain

37

167

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c2f-assembly1.cif.gz_A k428a mutant nuclease domain of the large terminase subunit gp2 of bacterial virus sf6 with manganese and beta-thujaplicinol 0.703 94 148
4cvn-assembly3.cif.gz_H structure of the fap7-rps14 complex 0.7016 99 150
5c2d-assembly1.cif.gz_A k428a mutant gp2c of large terminase subunit from bacteriophage sf6 with calcium 0.6802 93 150
4cw7-assembly3.cif.gz_F structure of the fap7-rps14 complex in complex with atp 0.677 99 150
2dfe-assembly1.cif.gz_A crystal structure of tk-rnase hii(1-200)-c 0.6742 99 148
ID Description Score Start End Superfamily
af_P42598_32_210_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6919 16 174 3.40.50.620
af_Q54FL1_98_236_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6799 33 145 3.40.50.620
2fi1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.6479 32 145 3.40.50.1000
af_A0A1D6HR89_2_270_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6369 29 96 3.50.50.60
3ovkD00 Alpha Beta;3-Layer(aba) Sandwich;Creatine Amidinohydrolase; Chain A, domain 1;Creatinase/prolidase N-terminal domain 0.6348 90 148 3.40.350.10
ID Description Score Start End GO Terms
AF-A0A2E2ZYA6-F1-model_v4 deleted 0.97 23 178
AF-A0A2W5BJK1-F1-model_v4 deleted 0.9669 82 180
AF-A0A0Q4IEB2-F1-model_v4 DUF218 domain-containing protein 0.9664 39 178
AF-A0A0Q4KYJ1-F1-model_v4 DUF218 domain-containing protein 0.9612 23 178
AF-A0A165Q3A6-F1-model_v4 deleted 0.9542 1 174

Feature Viewer

pLDDT pTM Quality
91.01 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map