F192422

General Info

Members Datasets Scaffolds Average Seq Length
144 101 288 234

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0292083|Ga0436361_0292083_414_1139
Length 241
Sequence LLSETNMAGKKYENAAKNIDRQKRYDLEDALKLVGANKVASFDETIEMAVRLNVDPRQADQNVRGTVVLPNGTGKVARVLVLAKGEKEKEARDAGADFVGGEDLVKKIQDENWLDFDRVIATPDIMGAVGRIGKILGPRGLMPNPRVGTVTFDVAKAVQEVKAGKVDYRVDKAGVIHARIGKISFGDQKLAENAHALLASILRAKPASAKGIYIKSVAVSSTMGPGVKVDTASTSKVATAA

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
21 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
31 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
36 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
41 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
49 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
50 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
54 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
55 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
58 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
59 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
70 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
71 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
78 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
79 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
80 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
81 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
82 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
87 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
93 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
94 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.03
Metatranscriptomes 15.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.69
Rhizosphere 95.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0292083 3300039447 Bacteria 1407
2 SwRhRL3b_contig_340023 2162886006 Bacteria 1548
3 Ga0058859_10128030 3300004798 Bacteria 9027
4 Ga0058860_10007800 3300004801 Bacteria 15153
5 Ga0058862_12566635 3300004803 Bacteria 1904
6 Ga0065704_10095262 3300005289 Bacteria 2497
7 Ga0065704_10107312 3300005289 Bacteria 2039
8 Ga0065704_10109117 3300005289 Bacteria 2011
9 Ga0065707_10206113 3300005295 Bacteria 1284
10 Ga0070658_10129323 3300005327 Bacteria 2104
11 Ga0070680_100008774 3300005336 Bacteria 7754
12 Ga0070668_100197810 3300005347 Bacteria 1649
13 Ga0070668_100241057 3300005347 Bacteria 1498
14 Ga0070706_100310416 3300005467 Bacteria 1471
15 Ga0070697_100099878 3300005536 Bacteria 2409
16 Ga0068860_100501065 3300005843 Bacteria 1212
17 Ga0068862_100072416 3300005844 Bacteria 2977
18 Ga0068862_100403760 3300005844 Bacteria 1279
19 Ga0068862_100743984 3300005844 Bacteria 953
20 Ga0081539_10080258 3300005985 Bacteria 1717
21 Ga0075428_100062632 3300006844 Bacteria 4072
22 Ga0075428_100481992 3300006844 Bacteria 1327
23 Ga0075430_100124305 3300006846 Bacteria 2151
24 Ga0075434_100125609 3300006871 Bacteria 2582
25 Ga0097620_100048124 3300006931 Bacteria 4283
26 Ga0099794_10009457 3300007265 Bacteria 4099
27 Ga0099795_10046373 3300007788 Bacteria 1566
28 Ga0105240_10414170 3300009093 Bacteria 1515
29 Ga0111539_10008277 3300009094 Bacteria 13237
30 Ga0114129_10298567 3300009147 Bacteria 2148
31 Ga0105249_10037370 3300009553 Bacteria 4406
32 Ga0105239_10193800 3300010375 Bacteria 2275
33 Ga0157325_1002458 3300012485 Bacteria 948
34 Ga0163162_10137714 3300013306 Bacteria 2553
35 Ga0157379_10280084 3300014968 Bacteria 1517
36 Ga0163161_10109266 3300017792 Bacteria 2066
37 Ga0184603_101692 3300019192 Bacteria 2163
38 Ga0197907_10758521 3300020069 Bacteria 8262
39 Ga0206356_11298773 3300020070 Bacteria 5862
40 Ga0206349_1684885 3300020075 Bacteria 3013
41 Ga0206355_1588215 3300020076 Bacteria 1953
42 Ga0206352_10599891 3300020078 Bacteria 2737
43 Ga0206350_11324818 3300020080 Bacteria 6093
44 Ga0206354_10643036 3300020081 Bacteria 4292
45 Ga0206353_12050789 3300020082 Bacteria 2346
46 Ga0213872_10096060 3300021361 Bacteria 1323
47 Ga0224712_10000881 3300022467 Bacteria 6434
48 Ga0207695_10283603 3300025913 Bacteria 1550
49 Ga0207700_10438284 3300025928 Bacteria 1150
50 Ga0207712_10015884 3300025961 Bacteria 4865
51 Ga0207703_10064705 3300026035 Bacteria 3002
52 Ga0268265_10532612 3300028380 Bacteria 1112
53 Ga0268264_10421424 3300028381 Bacteria 1287
54 Ga0265337_1041815 3300028556 Bacteria 1317
55 Ga0265319_1000071 3300028563 Bacteria 81543
56 Ga0265318_10000330 3300028577 Bacteria 37777
57 Ga0265338_10031297 3300028800 Bacteria 5219
58 Ga0265761_102377 3300030889 Bacteria 874
59 Ga0265330_10000207 3300031235 Bacteria 45606
60 Ga0265332_10000309 3300031238 Bacteria 37775
61 Ga0265332_10000774 3300031238 Bacteria 19607
62 Ga0265328_10007334 3300031239 Bacteria 4603
63 Ga0265320_10000346 3300031240 Bacteria 37771
64 Ga0265329_10002978 3300031242 Bacteria 7527
65 Ga0265340_10007191 3300031247 Bacteria 6064
66 Ga0265340_10096556 3300031247 Bacteria 1377
67 Ga0265339_10014886 3300031249 Bacteria 4677
68 Ga0265331_10000576 3300031250 Bacteria 32894
69 Ga0265327_10004242 3300031251 Bacteria 12852
70 Ga0265316_10000588 3300031344 Bacteria 40691
71 Ga0265313_10000590 3300031595 Bacteria 37758
72 Ga0265314_10000781 3300031711 Bacteria 37771
73 Ga0265314_10003494 3300031711 Bacteria 15169
74 Ga0265342_10000598 3300031712 Bacteria 38084
75 Ga0316593_10002170 3300032168 Bacteria 4579
76 Ga0316593_10003594 3300032168 Bacteria 3873
77 Ga0316593_10044378 3300032168 Bacteria 1488
78 Ga0316593_10080515 3300032168 Bacteria 1136
79 Ga0316592_1022290 3300033524 Bacteria 1353
80 Ga0316592_1038257 3300033524 Bacteria 1057
81 Ga0316588_1003479 3300033528 Bacteria 2881
82 Ga0316588_1006339 3300033528 Bacteria 2360
83 Ga0316588_1068686 3300033528 Bacteria 869
84 Ga0373926_0120395 3300035083 Bacteria 989
85 Ga0373951_0004059 3300035091 Bacteria 3503
86 Ga0373936_0182227 3300035113 Bacteria 922
87 Ga0316574_0162380 3300035398 Bacteria 1438
88 Ga0373927_0159774 3300035695 Bacteria 1476
89 Ga0373933_0384921 3300035724 Bacteria 914
90 Ga0373947_0616475 3300035725 Bacteria 740
91 Ga0373937_0178371 3300036401 Bacteria 1995
92 Ga0400490_33118 3300038726 Bacteria 2375
93 Ga0400489_96231 3300039093 Bacteria 5102
94 Ga0436362_0554804 3300039453 Bacteria 2371
95 Ga0436362_1153849 3300039453 Bacteria 998
96 Ga0451837_1659579 3300041494 Bacteria 2199
97 Ga0451577_0000001 3300042876 Bacteria 2461803
98 Ga0451577_0003967 3300042876 Bacteria 15959
99 Ga0451577_0028183 3300042876 Bacteria 5081
100 Ga0451577_0071647 3300042876 Bacteria 3090
101 Ga0451577_0099005 3300042876 Bacteria 2604
102 Ga0451577_0173135 3300042876 Bacteria 1945
103 Ga0451577_0459144 3300042876 Bacteria 1157
104 Ga0453683_0000075 3300044673 Bacteria 150395
105 Ga0453683_0002122 3300044673 Bacteria 15802
106 Ga0453683_0002194 3300044673 Bacteria 15527
107 Ga0453683_0002232 3300044673 Bacteria 15321
108 Ga0453683_0054006 3300044673 Bacteria 2515
109 Ga0453684_0001438 3300044712 Bacteria 67996
110 Ga0453684_0005920 3300044712 Bacteria 23717
111 Ga0453684_0009639 3300044712 Bacteria 16830
112 Ga0453684_0010338 3300044712 Bacteria 15977
113 Ga0453684_0014912 3300044712 Bacteria 12358
114 Ga0453684_0028706 3300044712 Bacteria 7924
115 Ga0453684_0029890 3300044712 Bacteria 7717
116 Ga0453684_0136769 3300044712 Bacteria 2932
117 Ga0453684_0181930 3300044712 Bacteria 2467
118 Ga0453684_0258716 3300044712 Bacteria 1995
119 Ga0453684_0310158 3300044712 Bacteria 1791
120 Ga0453684_0962731 3300044712 Bacteria 910
121 Ga0453684_1161366 3300044712 Bacteria 812
122 Ga0451576_0004781 3300045051 Bacteria 17359
123 Ga0451576_0007199 3300045051 Bacteria 13406
124 Ga0451576_0032803 3300045051 Bacteria 5523
125 Ga0451576_0336959 3300045051 Bacteria 1579
126 Ga0495582_0090421 3300046473 Bacteria 1706
127 Ga0495658_0001433 3300046683 Bacteria 12543
128 Ga0496104_0288013 3300048907 Bacteria 1555
129 Ga0501038_0526272 3300049574 Bacteria 902
130 Ga0501040_0179169 3300049576 Bacteria 1502
131 Ga0501042_0179674 3300049578 Bacteria 1527
132 Ga0501042_0528739 3300049578 Bacteria 857
133 Ga0501048_0188909 3300049582 Bacteria 1460
134 Ga0501067_0089137 3300049583 Bacteria 1712
135 Ga0501072_0126016 3300049588 Bacteria 2041
136 Ga0501045_0316273 3300049824 Bacteria 1162
137 nmdc:mga05p37_235722_c1 3300050507 Bacteria 2203
138 nmdc:mga0qj67_40639_c1 3300050509 Bacteria 3655
139 nmdc:mga06r32_523819_c1 3300050510 Bacteria 1161
140 nmdc:mga08y16_52795_c1 3300050511 Bacteria 4252
141 nmdc:mga0n895_28590_c1 3300050512 Bacteria 5305
142 nmdc:mga0a205_327009_c1 3300050515 Bacteria 1403
143 nmdc:mga0a205_59833_c1 3300050515 Bacteria 3680
144 Ga0501082_0169869 3300060353 Bacteria 1896
145 Ga0436361_0292083
146 SwRhRL3b_contig_340023
147 Ga0058859_10128030
148 Ga0058860_10007800
149 Ga0058862_12566635
150 Ga0065704_10095262
151 Ga0065704_10107312
152 Ga0065704_10109117
153 Ga0065707_10206113
154 Ga0070658_10129323
155 Ga0070680_100008774
156 Ga0070668_100197810
157 Ga0070668_100241057
158 Ga0070706_100310416
159 Ga0070697_100099878
160 Ga0068860_100501065
161 Ga0068862_100072416
162 Ga0068862_100403760
163 Ga0068862_100743984
164 Ga0081539_10080258
165 Ga0075428_100062632
166 Ga0075428_100481992
167 Ga0075430_100124305
168 Ga0075434_100125609
169 Ga0097620_100048124
170 Ga0099794_10009457
171 Ga0099795_10046373
172 Ga0105240_10414170
173 Ga0111539_10008277
174 Ga0114129_10298567
175 Ga0105249_10037370
176 Ga0105239_10193800
177 Ga0157325_1002458
178 Ga0163162_10137714
179 Ga0157379_10280084
180 Ga0163161_10109266
181 Ga0184603_101692
182 Ga0197907_10758521
183 Ga0206356_11298773
184 Ga0206349_1684885
185 Ga0206355_1588215
186 Ga0206352_10599891
187 Ga0206350_11324818
188 Ga0206354_10643036
189 Ga0206353_12050789
190 Ga0213872_10096060
191 Ga0224712_10000881
192 Ga0207695_10283603
193 Ga0207700_10438284
194 Ga0207712_10015884
195 Ga0207703_10064705
196 Ga0268265_10532612
197 Ga0268264_10421424
198 Ga0265337_1041815
199 Ga0265319_1000071
200 Ga0265318_10000330
201 Ga0265338_10031297
202 Ga0265761_102377
203 Ga0265330_10000207
204 Ga0265332_10000309
205 Ga0265332_10000774
206 Ga0265328_10007334
207 Ga0265320_10000346
208 Ga0265329_10002978
209 Ga0265340_10007191
210 Ga0265340_10096556
211 Ga0265339_10014886
212 Ga0265331_10000576
213 Ga0265327_10004242
214 Ga0265316_10000588
215 Ga0265313_10000590
216 Ga0265314_10000781
217 Ga0265314_10003494
218 Ga0265342_10000598
219 Ga0316593_10002170
220 Ga0316593_10003594
221 Ga0316593_10044378
222 Ga0316593_10080515
223 Ga0316592_1022290
224 Ga0316592_1038257
225 Ga0316588_1003479
226 Ga0316588_1006339
227 Ga0316588_1068686
228 Ga0373926_0120395
229 Ga0373951_0004059
230 Ga0373936_0182227
231 Ga0316574_0162380
232 Ga0373927_0159774
233 Ga0373933_0384921
234 Ga0373947_0616475
235 Ga0373937_0178371
236 Ga0400490_33118
237 Ga0400489_96231
238 Ga0436362_0554804
239 Ga0436362_1153849
240 Ga0451837_1659579
241 Ga0451577_0000001
242 Ga0451577_0003967
243 Ga0451577_0028183
244 Ga0451577_0071647
245 Ga0451577_0099005
246 Ga0451577_0173135
247 Ga0451577_0459144
248 Ga0453683_0000075
249 Ga0453683_0002122
250 Ga0453683_0002194
251 Ga0453683_0002232
252 Ga0453683_0054006
253 Ga0453684_0001438
254 Ga0453684_0005920
255 Ga0453684_0009639
256 Ga0453684_0010338
257 Ga0453684_0014912
258 Ga0453684_0028706
259 Ga0453684_0029890
260 Ga0453684_0136769
261 Ga0453684_0181930
262 Ga0453684_0258716
263 Ga0453684_0310158
264 Ga0453684_0962731
265 Ga0453684_1161366
266 Ga0451576_0004781
267 Ga0451576_0007199
268 Ga0451576_0032803
269 Ga0451576_0336959
270 Ga0495582_0090421
271 Ga0495658_0001433
272 Ga0496104_0288013
273 Ga0501038_0526272
274 Ga0501040_0179169
275 Ga0501042_0179674
276 Ga0501042_0528739
277 Ga0501048_0188909
278 Ga0501067_0089137
279 Ga0501072_0126016
280 Ga0501045_0316273
281 nmdc:mga05p37_235722_c1
282 nmdc:mga0qj67_40639_c1
283 nmdc:mga06r32_523819_c1
284 nmdc:mga08y16_52795_c1
285 nmdc:mga0n895_28590_c1
286 nmdc:mga0a205_327009_c1
287 nmdc:mga0a205_59833_c1
288 Ga0501082_0169869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00687

Ribosomal_L1

Ribosomal protein L1p/L10e family

34

225

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vpl-assembly1.cif.gz_A the structure of the complex between the first domain of l1 protein from thermus thermophilus and mrna from methanococcus jannaschii 0.959 6 225
4wpo-assembly1.cif.gz_AC crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g in the pre-translocational state 0.9508 6 225
2ov7-assembly3.cif.gz_C the first domain of the ribosomal protein l1 from thermus thermophilus 0.9357 13 225
6wdj-assembly1.cif.gz_a cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (non-cognate structure v-a1) 0.9355 6 225
4v7k-assembly1.cif.gz_AC structure of rele nuclease bound to the 70s ribosome (postcleavage state) 0.9348 6 225
ID Description Score Start End Superfamily
2wrrC01 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.945 16 225 3.30.190.20
af_I1L5L1_126_340_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9311 18 231 3.30.190.20
af_P9WHC7_16_229_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9278 16 225 3.30.190.20
af_I1L5L1_126_340_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9228 18 231 3.30.190.20
2wrrC01 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9151 16 225 3.30.190.20
ID Description Score Start End GO Terms
AF-A0A524Q1E0-F1-model_v4 Large ribosomal subunit protein uL1 0.9432 6 229 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A656YT43-F1-model_v4 deleted 0.9417 1 228
AF-A0A5N6Q3M0-F1-model_v4 Large ribosomal subunit protein uL1c (Endopeptidase S2P) 0.9374 6 230 GO:0003735
GO:0004222
GO:0005737
GO:0006412
GO:0012505
GO:0015934
GO:0016020
GO:0019843
GO:0031293
GO:1905897
AF-A0A1F4W0B7-F1-model_v4 Ribosomal protein 0.9363 6 228 GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A0T5ZWW3-F1-model_v4 Large ribosomal subunit protein uL1 0.9359 6 229 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843

Map