F496812
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2445 | 473 | 4890 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300014745|Ga0157377_10754962|Ga0157377_107549622 |
| Length | 142 |
| Sequence | LFFVSFVADLLQTHRRGHVEGTMSEKEPTYDESQIAEQLKALPGWYFEDGWIRRVYKTDGWPTTLMLVNAIGYCAEAAYHHPDLSVTWGRVVVKLSTHSAGGITAKDFAVARRIEEVALWRPAEGGALTGTPNKFVRSGDPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 8 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 78 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 90 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 91 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 92 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 93 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 94 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 100 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 116 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 232 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 237 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 238 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 239 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 240 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 242 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 243 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 244 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 245 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 246 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 248 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 249 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 250 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 251 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 252 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 253 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 254 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 255 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 260 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 261 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 262 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 263 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 266 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 270 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 274 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 277 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 279 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 280 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 281 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 282 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 284 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 285 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 286 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 287 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 288 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 289 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 290 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 292 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 293 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 295 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 296 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 297 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 298 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 299 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 300 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 301 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 302 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 303 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 304 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 305 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 306 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 307 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 308 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 309 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 310 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 311 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 312 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 313 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 314 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 315 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 316 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 317 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 318 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 319 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 320 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 321 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 322 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 323 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 324 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 325 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 326 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 327 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 372 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 373 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 374 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 375 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 376 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 377 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 380 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 381 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 382 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 383 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 384 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 385 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 386 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 387 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 388 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 389 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 413 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 414 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 415 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 416 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 417 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 418 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 419 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 420 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 421 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 422 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 423 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 424 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 425 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 426 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 427 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 428 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 429 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 430 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 431 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 432 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 433 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 438 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 439 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 440 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 441 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 442 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 443 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 444 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 445 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 446 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 447 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 448 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 464 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 465 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 466 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 468 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 469 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 470 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 471 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 472 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.85 |
| Metatranscriptomes | 1.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.76 |
| Rhizosphere | 96.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157377_10754962 | 3300014745 | Bacteria | 712 |
| 2 | MBSR1b_contig_8089602 | 2162886012 | Bacteria | 2607 |
| 3 | JGI24746J21847_1020812 | 3300001977 | Bacteria | 919 |
| 4 | JGI24740J21852_10169113 | 3300001979 | Bacteria | 542 |
| 5 | JGI24750J21931_1056453 | 3300002070 | Bacteria | 621 |
| 6 | JGI24749J21850_1033407 | 3300002076 | Bacteria | 743 |
| 7 | JGI24749J21850_1065638 | 3300002076 | Bacteria | 556 |
| 8 | JGI24035J26624_1017358 | 3300002126 | Bacteria | 746 |
| 9 | JGI24033J26618_1075630 | 3300002155 | Bacteria | 511 |
| 10 | JGI24742J22300_10088205 | 3300002244 | Unclassified | 591 |
| 11 | JGI24751J29686_10085517 | 3300002459 | Bacteria | 654 |
| 12 | Ga0058863_11447660 | 3300004799 | Unclassified | 558 |
| 13 | Ga0058863_11891130 | 3300004799 | Bacteria | 1251 |
| 14 | Ga0058861_11592764 | 3300004800 | Unclassified | 912 |
| 15 | Ga0058861_12052165 | 3300004800 | Bacteria | 564 |
| 16 | Ga0058862_12409730 | 3300004803 | Bacteria | 1073 |
| 17 | Ga0058862_12850276 | 3300004803 | Bacteria | 704 |
| 18 | Ga0058862_12877243 | 3300004803 | Bacteria | 920 |
| 19 | Ga0058862_12892988 | 3300004803 | Bacteria | 549 |
| 20 | Ga0065714_10244450 | 3300005288 | Bacteria | 785 |
| 21 | Ga0065704_10296262 | 3300005289 | Unclassified | 894 |
| 22 | Ga0065712_10031789 | 3300005290 | Unclassified | 2510 |
| 23 | Ga0065712_10080735 | 3300005290 | Bacteria | 3074 |
| 24 | Ga0065712_10087940 | 3300005290 | Bacteria | 2547 |
| 25 | Ga0065712_10237856 | 3300005290 | Bacteria | 992 |
| 26 | Ga0065712_10300471 | 3300005290 | Unclassified | 848 |
| 27 | Ga0065715_10000777 | 3300005293 | Bacteria | 8824 |
| 28 | Ga0065715_10056506 | 3300005293 | Bacteria | 1021 |
| 29 | Ga0065715_10079224 | 3300005293 | Unclassified | 592 |
| 30 | Ga0065715_10102254 | 3300005293 | Bacteria | 3131 |
| 31 | Ga0065715_10121937 | 3300005293 | Bacteria | 2217 |
| 32 | Ga0065715_10141340 | 3300005293 | Unclassified | 1849 |
| 33 | Ga0065715_10349685 | 3300005293 | Bacteria | 953 |
| 34 | Ga0065715_10428489 | 3300005293 | Unclassified | 850 |
| 35 | Ga0065715_10511348 | 3300005293 | Bacteria | 771 |
| 36 | Ga0065715_10551838 | 3300005293 | Bacteria | 740 |
| 37 | Ga0065715_10690883 | 3300005293 | Bacteria | 658 |
| 38 | Ga0065715_10896262 | 3300005293 | Bacteria | 576 |
| 39 | Ga0065707_10038352 | 3300005295 | Unclassified | 935 |
| 40 | Ga0065707_10172378 | 3300005295 | Bacteria | 1475 |
| 41 | Ga0065707_10179609 | 3300005295 | Bacteria | 1424 |
| 42 | Ga0065707_10276962 | 3300005295 | Unclassified | 1057 |
| 43 | Ga0065707_10350949 | 3300005295 | Unclassified | 918 |
| 44 | Ga0065707_10765100 | 3300005295 | Unclassified | 601 |
| 45 | Ga0070658_10081445 | 3300005327 | Bacteria | 2659 |
| 46 | Ga0070658_10170881 | 3300005327 | Bacteria | 1826 |
| 47 | Ga0070676_10005080 | 3300005328 | Bacteria | 6979 |
| 48 | Ga0070676_10037621 | 3300005328 | Bacteria | 2792 |
| 49 | Ga0070676_10125979 | 3300005328 | Bacteria | 1614 |
| 50 | Ga0070676_10329454 | 3300005328 | Unclassified | 1044 |
| 51 | Ga0070676_10752239 | 3300005328 | Unclassified | 716 |
| 52 | Ga0070676_10859594 | 3300005328 | Unclassified | 673 |
| 53 | Ga0070676_11302573 | 3300005328 | Unclassified | 555 |
| 54 | Ga0070683_100000764 | 3300005329 | Bacteria | 23609 |
| 55 | Ga0070683_100032682 | 3300005329 | Unclassified | 4739 |
| 56 | Ga0070690_100002022 | 3300005330 | Bacteria | 10812 |
| 57 | Ga0070690_100044091 | 3300005330 | Bacteria | 2831 |
| 58 | Ga0070690_100075357 | 3300005330 | Unclassified | 2199 |
| 59 | Ga0070690_100306852 | 3300005330 | Bacteria | 1139 |
| 60 | Ga0070690_100732091 | 3300005330 | Bacteria | 762 |
| 61 | Ga0070690_101139153 | 3300005330 | Unclassified | 620 |
| 62 | Ga0070670_100000634 | 3300005331 | Bacteria | 27387 |
| 63 | Ga0070670_100011366 | 3300005331 | Bacteria | 7609 |
| 64 | Ga0070670_100034413 | 3300005331 | Bacteria | 4359 |
| 65 | Ga0070670_100198760 | 3300005331 | Bacteria | 1742 |
| 66 | Ga0070670_100327493 | 3300005331 | Bacteria | 1343 |
| 67 | Ga0070670_100366380 | 3300005331 | Unclassified | 1268 |
| 68 | Ga0070670_100412540 | 3300005331 | Bacteria | 1193 |
| 69 | Ga0070670_100685656 | 3300005331 | Bacteria | 921 |
| 70 | Ga0070670_101081755 | 3300005331 | Unclassified | 731 |
| 71 | Ga0070670_101720982 | 3300005331 | Bacteria | 577 |
| 72 | Ga0070677_10006929 | 3300005333 | Bacteria | 3766 |
| 73 | Ga0070677_10020381 | 3300005333 | Bacteria | 2415 |
| 74 | Ga0070677_10028081 | 3300005333 | Bacteria | 2123 |
| 75 | Ga0070677_10028671 | 3300005333 | Bacteria | 2105 |
| 76 | Ga0070677_10161810 | 3300005333 | Bacteria | 1051 |
| 77 | Ga0070677_10347427 | 3300005333 | Unclassified | 767 |
| 78 | Ga0070677_10436101 | 3300005333 | Bacteria | 698 |
| 79 | Ga0070677_10561485 | 3300005333 | Bacteria | 627 |
| 80 | Ga0070677_10790508 | 3300005333 | Unclassified | 541 |
| 81 | Ga0068869_100002979 | 3300005334 | Bacteria | 10287 |
| 82 | Ga0068869_100038960 | 3300005334 | Bacteria | 3390 |
| 83 | Ga0068869_100090850 | 3300005334 | Unclassified | 2296 |
| 84 | Ga0068869_100381562 | 3300005334 | Bacteria | 1155 |
| 85 | Ga0068869_100581720 | 3300005334 | Bacteria | 944 |
| 86 | Ga0068869_101520335 | 3300005334 | Unclassified | 595 |
| 87 | Ga0070666_10003132 | 3300005335 | Bacteria | 10049 |
| 88 | Ga0070666_10013743 | 3300005335 | Bacteria | 5141 |
| 89 | Ga0070666_10042121 | 3300005335 | Bacteria | 3054 |
| 90 | Ga0070666_10069734 | 3300005335 | Bacteria | 2391 |
| 91 | Ga0070666_10313469 | 3300005335 | Bacteria | 1118 |
| 92 | Ga0070666_10346076 | 3300005335 | Bacteria | 1063 |
| 93 | Ga0070666_11077970 | 3300005335 | Bacteria | 597 |
| 94 | Ga0070666_11382548 | 3300005335 | Bacteria | 526 |
| 95 | Ga0070680_100008842 | 3300005336 | Bacteria | 7721 |
| 96 | Ga0070680_100028405 | 3300005336 | Bacteria | 4486 |
| 97 | Ga0070680_100059036 | 3300005336 | Bacteria | 3138 |
| 98 | Ga0070680_100115826 | 3300005336 | Bacteria | 2234 |
| 99 | Ga0070680_100116997 | 3300005336 | Bacteria | 2222 |
| 100 | Ga0070680_100187075 | 3300005336 | Bacteria | 1745 |
| 101 | Ga0070680_100365685 | 3300005336 | Bacteria | 1227 |
| 102 | Ga0070680_100710408 | 3300005336 | Bacteria | 865 |
| 103 | Ga0070680_100961014 | 3300005336 | Bacteria | 737 |
| 104 | Ga0070680_101130063 | 3300005336 | Bacteria | 677 |
| 105 | Ga0070680_101437756 | 3300005336 | Bacteria | 597 |
| 106 | Ga0070680_101677450 | 3300005336 | Bacteria | 551 |
| 107 | Ga0070682_100999980 | 3300005337 | Bacteria | 694 |
| 108 | Ga0068868_100010945 | 3300005338 | Bacteria | 6587 |
| 109 | Ga0068868_100080980 | 3300005338 | Bacteria | 2602 |
| 110 | Ga0068868_101580011 | 3300005338 | Bacteria | 616 |
| 111 | Ga0070660_100244837 | 3300005339 | Bacteria | 1461 |
| 112 | Ga0070660_100387024 | 3300005339 | Bacteria | 1155 |
| 113 | Ga0070660_100388544 | 3300005339 | Unclassified | 1152 |
| 114 | Ga0070660_100812240 | 3300005339 | Bacteria | 787 |
| 115 | Ga0070660_100910207 | 3300005339 | Bacteria | 742 |
| 116 | Ga0070660_101077502 | 3300005339 | Unclassified | 680 |
| 117 | Ga0070660_101559171 | 3300005339 | Unclassified | 562 |
| 118 | Ga0070689_100062271 | 3300005340 | Unclassified | 2903 |
| 119 | Ga0070689_100093808 | 3300005340 | Bacteria | 2369 |
| 120 | Ga0070689_100115240 | 3300005340 | Bacteria | 2142 |
| 121 | Ga0070689_100685176 | 3300005340 | Bacteria | 894 |
| 122 | Ga0070689_100802989 | 3300005340 | Bacteria | 827 |
| 123 | Ga0070689_101025110 | 3300005340 | Bacteria | 735 |
| 124 | Ga0070689_101877614 | 3300005340 | Unclassified | 547 |
| 125 | Ga0070691_11056250 | 3300005341 | Bacteria | 509 |
| 126 | Ga0070687_100007944 | 3300005343 | Bacteria | 4465 |
| 127 | Ga0070687_100011225 | 3300005343 | Bacteria | 3911 |
| 128 | Ga0070687_100031504 | 3300005343 | Bacteria | 2602 |
| 129 | Ga0070687_100477210 | 3300005343 | Unclassified | 835 |
| 130 | Ga0070687_100510172 | 3300005343 | Bacteria | 811 |
| 131 | Ga0070687_100568685 | 3300005343 | Bacteria | 774 |
| 132 | Ga0070687_100612432 | 3300005343 | Unclassified | 750 |
| 133 | Ga0070687_100633461 | 3300005343 | Bacteria | 739 |
| 134 | Ga0070661_100035888 | 3300005344 | Bacteria | 3603 |
| 135 | Ga0070661_100038013 | 3300005344 | Bacteria | 3503 |
| 136 | Ga0070661_100075035 | 3300005344 | Bacteria | 2491 |
| 137 | Ga0070661_100166732 | 3300005344 | Bacteria | 1671 |
| 138 | Ga0070661_100310354 | 3300005344 | Bacteria | 1230 |
| 139 | Ga0070661_100671615 | 3300005344 | Unclassified | 842 |
| 140 | Ga0070692_10033401 | 3300005345 | Unclassified | 2592 |
| 141 | Ga0070692_10149929 | 3300005345 | Bacteria | 1327 |
| 142 | Ga0070692_10208889 | 3300005345 | Unclassified | 1148 |
| 143 | Ga0070692_10220142 | 3300005345 | Unclassified | 1122 |
| 144 | Ga0070692_10641295 | 3300005345 | Unclassified | 708 |
| 145 | Ga0070692_11122823 | 3300005345 | Bacteria | 556 |
| 146 | Ga0070668_100023211 | 3300005347 | Bacteria | 4692 |
| 147 | Ga0070668_100031330 | 3300005347 | Bacteria | 4045 |
| 148 | Ga0070668_100032702 | 3300005347 | Bacteria | 3957 |
| 149 | Ga0070668_100034586 | 3300005347 | Bacteria | 3851 |
| 150 | Ga0070668_100095066 | 3300005347 | Bacteria | 2354 |
| 151 | Ga0070668_100108357 | 3300005347 | Bacteria | 2209 |
| 152 | Ga0070668_100190401 | 3300005347 | Bacteria | 1680 |
| 153 | Ga0070668_100574498 | 3300005347 | Unclassified | 983 |
| 154 | Ga0070669_100002739 | 3300005353 | Bacteria | 12709 |
| 155 | Ga0070669_100007115 | 3300005353 | Bacteria | 8040 |
| 156 | Ga0070669_100009768 | 3300005353 | Bacteria | 6834 |
| 157 | Ga0070669_100016837 | 3300005353 | Bacteria | 5218 |
| 158 | Ga0070669_100143228 | 3300005353 | Unclassified | 1844 |
| 159 | Ga0070669_100153005 | 3300005353 | Bacteria | 1787 |
| 160 | Ga0070669_100188024 | 3300005353 | Bacteria | 1619 |
| 161 | Ga0070669_100192898 | 3300005353 | Unclassified | 1599 |
| 162 | Ga0070669_100366298 | 3300005353 | Bacteria | 1173 |
| 163 | Ga0070669_100533755 | 3300005353 | Unclassified | 977 |
| 164 | Ga0070669_100591866 | 3300005353 | Bacteria | 928 |
| 165 | Ga0070669_100759579 | 3300005353 | Bacteria | 822 |
| 166 | Ga0070669_100915038 | 3300005353 | Unclassified | 750 |
| 167 | Ga0070669_101807035 | 3300005353 | Bacteria | 533 |
| 168 | Ga0070675_100000592 | 3300005354 | Bacteria | 24826 |
| 169 | Ga0070675_100005419 | 3300005354 | Bacteria | 9756 |
| 170 | Ga0070675_100009716 | 3300005354 | Bacteria | 7493 |
| 171 | Ga0070675_100011526 | 3300005354 | Bacteria | 6925 |
| 172 | Ga0070675_100014415 | 3300005354 | Bacteria | 6233 |
| 173 | Ga0070675_100017993 | 3300005354 | Bacteria | 5624 |
| 174 | Ga0070675_100023257 | 3300005354 | Bacteria | 4953 |
| 175 | Ga0070675_100037925 | 3300005354 | Bacteria | 3927 |
| 176 | Ga0070675_100038174 | 3300005354 | Bacteria | 3913 |
| 177 | Ga0070675_100051924 | 3300005354 | Bacteria | 3370 |
| 178 | Ga0070675_100069979 | 3300005354 | Bacteria | 2908 |
| 179 | Ga0070675_100139369 | 3300005354 | Bacteria | 2072 |
| 180 | Ga0070675_100140026 | 3300005354 | Bacteria | 2067 |
| 181 | Ga0070675_100170187 | 3300005354 | Bacteria | 1878 |
| 182 | Ga0070675_100247593 | 3300005354 | Unclassified | 1559 |
| 183 | Ga0070675_100286076 | 3300005354 | Unclassified | 1450 |
| 184 | Ga0070675_100370775 | 3300005354 | Bacteria | 1273 |
| 185 | Ga0070675_100842998 | 3300005354 | Bacteria | 839 |
| 186 | Ga0070675_101078682 | 3300005354 | Unclassified | 738 |
| 187 | Ga0070675_101508999 | 3300005354 | Bacteria | 620 |
| 188 | Ga0070675_101742744 | 3300005354 | Bacteria | 575 |
| 189 | Ga0070671_100007962 | 3300005355 | Bacteria | 8476 |
| 190 | Ga0070671_100042508 | 3300005355 | Bacteria | 3778 |
| 191 | Ga0070671_100057254 | 3300005355 | Bacteria | 3244 |
| 192 | Ga0070674_100001731 | 3300005356 | Bacteria | 11820 |
| 193 | Ga0070674_100033533 | 3300005356 | Bacteria | 3419 |
| 194 | Ga0070674_100061397 | 3300005356 | Bacteria | 2623 |
| 195 | Ga0070674_100089912 | 3300005356 | Bacteria | 2213 |
| 196 | Ga0070674_100120160 | 3300005356 | Bacteria | 1944 |
| 197 | Ga0070674_100175645 | 3300005356 | Unclassified | 1636 |
| 198 | Ga0070674_100178676 | 3300005356 | Bacteria | 1624 |
| 199 | Ga0070674_100502945 | 3300005356 | Bacteria | 1009 |
| 200 | Ga0070674_100524425 | 3300005356 | Bacteria | 990 |
| 201 | Ga0070674_100559246 | 3300005356 | Bacteria | 961 |
| 202 | Ga0070674_101210384 | 3300005356 | Bacteria | 671 |
| 203 | Ga0070674_101844917 | 3300005356 | Bacteria | 549 |
| 204 | Ga0070673_100000603 | 3300005364 | Bacteria | 19619 |
| 205 | Ga0070673_100005191 | 3300005364 | Bacteria | 8320 |
| 206 | Ga0070673_100028468 | 3300005364 | Bacteria | 4155 |
| 207 | Ga0070673_100030517 | 3300005364 | Bacteria | 4036 |
| 208 | Ga0070673_100051997 | 3300005364 | Bacteria | 3212 |
| 209 | Ga0070673_100091456 | 3300005364 | Bacteria | 2488 |
| 210 | Ga0070673_100152864 | 3300005364 | Bacteria | 1956 |
| 211 | Ga0070673_100168060 | 3300005364 | Bacteria | 1870 |
| 212 | Ga0070673_100172100 | 3300005364 | Bacteria | 1849 |
| 213 | Ga0070673_100190913 | 3300005364 | Bacteria | 1759 |
| 214 | Ga0070673_100270474 | 3300005364 | Bacteria | 1487 |
| 215 | Ga0070673_100520933 | 3300005364 | Bacteria | 1077 |
| 216 | Ga0070688_100053260 | 3300005365 | Bacteria | 2530 |
| 217 | Ga0070688_100062021 | 3300005365 | Bacteria | 2366 |
| 218 | Ga0070688_100208530 | 3300005365 | Bacteria | 1371 |
| 219 | Ga0070688_100209788 | 3300005365 | Bacteria | 1367 |
| 220 | Ga0070688_100275840 | 3300005365 | Bacteria | 1206 |
| 221 | Ga0070688_100509761 | 3300005365 | Bacteria | 909 |
| 222 | Ga0070688_101356888 | 3300005365 | Unclassified | 575 |
| 223 | Ga0070688_101407706 | 3300005365 | Bacteria | 565 |
| 224 | Ga0070659_100075532 | 3300005366 | Unclassified | 2686 |
| 225 | Ga0070659_100081231 | 3300005366 | Bacteria | 2589 |
| 226 | Ga0070659_100122366 | 3300005366 | Bacteria | 2109 |
| 227 | Ga0070659_100168275 | 3300005366 | Bacteria | 1794 |
| 228 | Ga0070659_100797998 | 3300005366 | Unclassified | 821 |
| 229 | Ga0070667_100025795 | 3300005367 | Bacteria | 4888 |
| 230 | Ga0070667_100101067 | 3300005367 | Bacteria | 2490 |
| 231 | Ga0070667_100189904 | 3300005367 | Bacteria | 1820 |
| 232 | Ga0070667_101022953 | 3300005367 | Bacteria | 771 |
| 233 | Ga0070703_10072014 | 3300005406 | Bacteria | 1157 |
| 234 | Ga0070703_10400086 | 3300005406 | Bacteria | 598 |
| 235 | Ga0070709_10024824 | 3300005434 | Bacteria | 3533 |
| 236 | Ga0070709_10031608 | 3300005434 | Bacteria | 3185 |
| 237 | Ga0070709_10570167 | 3300005434 | Unclassified | 868 |
| 238 | Ga0070714_100006289 | 3300005435 | Bacteria | 9155 |
| 239 | Ga0070714_100647581 | 3300005435 | Bacteria | 1017 |
| 240 | Ga0070713_100035971 | 3300005436 | Bacteria | 3992 |
| 241 | Ga0070713_100143527 | 3300005436 | Bacteria | 2117 |
| 242 | Ga0070713_101373429 | 3300005436 | Unclassified | 685 |
| 243 | Ga0070710_10169835 | 3300005437 | Bacteria | 1358 |
| 244 | Ga0070710_10842079 | 3300005437 | Unclassified | 658 |
| 245 | Ga0070710_10951460 | 3300005437 | Bacteria | 623 |
| 246 | Ga0070701_10011016 | 3300005438 | Bacteria | 4023 |
| 247 | Ga0070701_10104009 | 3300005438 | Bacteria | 1577 |
| 248 | Ga0070701_10279870 | 3300005438 | Bacteria | 1018 |
| 249 | Ga0070701_10421199 | 3300005438 | Bacteria | 851 |
| 250 | Ga0070701_10854080 | 3300005438 | Bacteria | 625 |
| 251 | Ga0070701_11321836 | 3300005438 | Bacteria | 516 |
| 252 | Ga0070711_100000009 | 3300005439 | Bacteria | 172420 |
| 253 | Ga0070711_100164024 | 3300005439 | Bacteria | 1687 |
| 254 | Ga0070711_100284123 | 3300005439 | Bacteria | 1310 |
| 255 | Ga0070705_100007880 | 3300005440 | Bacteria | 5260 |
| 256 | Ga0070705_100015346 | 3300005440 | Bacteria | 3959 |
| 257 | Ga0070705_100030981 | 3300005440 | Bacteria | 2957 |
| 258 | Ga0070705_100038162 | 3300005440 | Bacteria | 2716 |
| 259 | Ga0070705_100110291 | 3300005440 | Unclassified | 1757 |
| 260 | Ga0070705_100357444 | 3300005440 | Unclassified | 1067 |
| 261 | Ga0070705_100466508 | 3300005440 | Bacteria | 951 |
| 262 | Ga0070705_100531497 | 3300005440 | Bacteria | 898 |
| 263 | Ga0070705_100650081 | 3300005440 | Bacteria | 822 |
| 264 | Ga0070705_100690419 | 3300005440 | Bacteria | 800 |
| 265 | Ga0070705_100785768 | 3300005440 | Unclassified | 756 |
| 266 | Ga0070700_100057525 | 3300005441 | Bacteria | 2440 |
| 267 | Ga0070700_100127887 | 3300005441 | Bacteria | 1710 |
| 268 | Ga0070700_100130838 | 3300005441 | Unclassified | 1693 |
| 269 | Ga0070700_100176094 | 3300005441 | Unclassified | 1485 |
| 270 | Ga0070700_100380134 | 3300005441 | Bacteria | 1056 |
| 271 | Ga0070700_100545678 | 3300005441 | Bacteria | 900 |
| 272 | Ga0070700_100757772 | 3300005441 | Bacteria | 777 |
| 273 | Ga0070700_100910284 | 3300005441 | Unclassified | 717 |
| 274 | Ga0070700_101073027 | 3300005441 | Bacteria | 666 |
| 275 | Ga0070700_101233229 | 3300005441 | Bacteria | 626 |
| 276 | Ga0070700_101355347 | 3300005441 | Bacteria | 600 |
| 277 | Ga0070694_100003241 | 3300005444 | Bacteria | 9716 |
| 278 | Ga0070694_100026629 | 3300005444 | Bacteria | 3749 |
| 279 | Ga0070694_100070308 | 3300005444 | Bacteria | 2410 |
| 280 | Ga0070694_100089455 | 3300005444 | Bacteria | 2157 |
| 281 | Ga0070694_100440224 | 3300005444 | Unclassified | 1027 |
| 282 | Ga0070708_100004458 | 3300005445 | Bacteria | 11009 |
| 283 | Ga0070708_100005480 | 3300005445 | Bacteria | 10061 |
| 284 | Ga0070708_100024315 | 3300005445 | Bacteria | 5166 |
| 285 | Ga0070708_100025392 | 3300005445 | Bacteria | 5065 |
| 286 | Ga0070708_100058470 | 3300005445 | Bacteria | 3435 |
| 287 | Ga0070708_100161097 | 3300005445 | Unclassified | 2091 |
| 288 | Ga0070708_100192871 | 3300005445 | Bacteria | 1906 |
| 289 | Ga0070708_100193562 | 3300005445 | Bacteria | 1902 |
| 290 | Ga0070708_100256968 | 3300005445 | Bacteria | 1642 |
| 291 | Ga0070708_100444044 | 3300005445 | Bacteria | 1224 |
| 292 | Ga0070708_100504136 | 3300005445 | Unclassified | 1142 |
| 293 | Ga0070708_100621017 | 3300005445 | Bacteria | 1019 |
| 294 | Ga0070708_100941134 | 3300005445 | Bacteria | 811 |
| 295 | Ga0070708_100969105 | 3300005445 | Bacteria | 798 |
| 296 | Ga0070708_101395228 | 3300005445 | Bacteria | 654 |
| 297 | Ga0070708_101454249 | 3300005445 | Bacteria | 639 |
| 298 | Ga0070663_100023756 | 3300005455 | Bacteria | 4114 |
| 299 | Ga0070663_100029666 | 3300005455 | Bacteria | 3740 |
| 300 | Ga0070663_100143020 | 3300005455 | Bacteria | 1828 |
| 301 | Ga0070663_100435421 | 3300005455 | Bacteria | 1078 |
| 302 | Ga0070663_100563207 | 3300005455 | Bacteria | 954 |
| 303 | Ga0070663_100815170 | 3300005455 | Unclassified | 801 |
| 304 | Ga0070663_102147927 | 3300005455 | Unclassified | 504 |
| 305 | Ga0070678_100041914 | 3300005456 | Bacteria | 3249 |
| 306 | Ga0070678_100225645 | 3300005456 | Bacteria | 1559 |
| 307 | Ga0070678_100245458 | 3300005456 | Bacteria | 1499 |
| 308 | Ga0070678_100388165 | 3300005456 | Unclassified | 1210 |
| 309 | Ga0070678_100463109 | 3300005456 | Unclassified | 1113 |
| 310 | Ga0070678_100512756 | 3300005456 | Unclassified | 1060 |
| 311 | Ga0070678_100683884 | 3300005456 | Bacteria | 923 |
| 312 | Ga0070678_100684327 | 3300005456 | Bacteria | 923 |
| 313 | Ga0070678_101083477 | 3300005456 | Bacteria | 739 |
| 314 | Ga0070678_102252427 | 3300005456 | Bacteria | 517 |
| 315 | Ga0070662_100007121 | 3300005457 | Bacteria | 7237 |
| 316 | Ga0070662_100132760 | 3300005457 | Unclassified | 1922 |
| 317 | Ga0070662_100135371 | 3300005457 | Bacteria | 1904 |
| 318 | Ga0070662_100136299 | 3300005457 | Unclassified | 1898 |
| 319 | Ga0070662_100243567 | 3300005457 | Unclassified | 1443 |
| 320 | Ga0070662_100291122 | 3300005457 | Bacteria | 1324 |
| 321 | Ga0070662_100404256 | 3300005457 | Bacteria | 1127 |
| 322 | Ga0070662_100516135 | 3300005457 | Bacteria | 998 |
| 323 | Ga0070662_100590436 | 3300005457 | Unclassified | 933 |
| 324 | Ga0070662_100615578 | 3300005457 | Unclassified | 914 |
| 325 | Ga0070662_100808860 | 3300005457 | Bacteria | 797 |
| 326 | Ga0070662_101454180 | 3300005457 | Bacteria | 591 |
| 327 | Ga0070681_10032018 | 3300005458 | Bacteria | 5278 |
| 328 | Ga0070681_10039527 | 3300005458 | Bacteria | 4728 |
| 329 | Ga0070681_10083546 | 3300005458 | Bacteria | 3147 |
| 330 | Ga0070681_10158976 | 3300005458 | Bacteria | 2183 |
| 331 | Ga0070681_10243224 | 3300005458 | Bacteria | 1713 |
| 332 | Ga0070681_10379858 | 3300005458 | Bacteria | 1323 |
| 333 | Ga0070681_10928973 | 3300005458 | Bacteria | 789 |
| 334 | Ga0070681_11586591 | 3300005458 | Bacteria | 580 |
| 335 | Ga0070681_11745436 | 3300005458 | Bacteria | 549 |
| 336 | Ga0068867_100012221 | 3300005459 | Bacteria | 6068 |
| 337 | Ga0068867_100015663 | 3300005459 | Bacteria | 5380 |
| 338 | Ga0068867_100138694 | 3300005459 | Bacteria | 1899 |
| 339 | Ga0068867_100151483 | 3300005459 | Bacteria | 1822 |
| 340 | Ga0068867_100238892 | 3300005459 | Bacteria | 1472 |
| 341 | Ga0068867_100393890 | 3300005459 | Unclassified | 1167 |
| 342 | Ga0068867_100494035 | 3300005459 | Unclassified | 1051 |
| 343 | Ga0068867_100507573 | 3300005459 | Bacteria | 1037 |
| 344 | Ga0068867_101059777 | 3300005459 | Unclassified | 738 |
| 345 | Ga0068867_101327265 | 3300005459 | Bacteria | 665 |
| 346 | Ga0068867_101577395 | 3300005459 | Unclassified | 613 |
| 347 | Ga0070685_10058735 | 3300005466 | Bacteria | 2243 |
| 348 | Ga0070685_11171030 | 3300005466 | Bacteria | 583 |
| 349 | Ga0070685_11472612 | 3300005466 | Bacteria | 524 |
| 350 | Ga0070685_11541351 | 3300005466 | Bacteria | 513 |
| 351 | Ga0070706_100007472 | 3300005467 | Bacteria | 10245 |
| 352 | Ga0070706_100024789 | 3300005467 | Bacteria | 5522 |
| 353 | Ga0070706_100196691 | 3300005467 | Bacteria | 1883 |
| 354 | Ga0070706_100254096 | 3300005467 | Bacteria | 1641 |
| 355 | Ga0070706_100333133 | 3300005467 | Bacteria | 1415 |
| 356 | Ga0070706_100527137 | 3300005467 | Unclassified | 1099 |
| 357 | Ga0070706_100705672 | 3300005467 | Bacteria | 935 |
| 358 | Ga0070707_100002824 | 3300005468 | Bacteria | 16527 |
| 359 | Ga0070707_100018730 | 3300005468 | Bacteria | 6518 |
| 360 | Ga0070707_100030365 | 3300005468 | Bacteria | 5145 |
| 361 | Ga0070707_100051564 | 3300005468 | Bacteria | 3944 |
| 362 | Ga0070707_100138128 | 3300005468 | Bacteria | 2371 |
| 363 | Ga0070707_100151094 | 3300005468 | Bacteria | 2261 |
| 364 | Ga0070707_100162154 | 3300005468 | Bacteria | 2179 |
| 365 | Ga0070707_100241333 | 3300005468 | Bacteria | 1759 |
| 366 | Ga0070707_100491666 | 3300005468 | Unclassified | 1188 |
| 367 | Ga0070707_100677633 | 3300005468 | Bacteria | 994 |
| 368 | Ga0070707_100947536 | 3300005468 | Bacteria | 826 |
| 369 | Ga0070707_101475092 | 3300005468 | Bacteria | 647 |
| 370 | Ga0070707_101783699 | 3300005468 | Bacteria | 583 |
| 371 | Ga0070698_100000520 | 3300005471 | Bacteria | 41001 |
| 372 | Ga0070698_100040967 | 3300005471 | Bacteria | 4757 |
| 373 | Ga0070698_100059590 | 3300005471 | Bacteria | 3855 |
| 374 | Ga0070698_100173809 | 3300005471 | Bacteria | 2094 |
| 375 | Ga0070698_100223385 | 3300005471 | Unclassified | 1817 |
| 376 | Ga0070698_100375501 | 3300005471 | Bacteria | 1354 |
| 377 | Ga0070698_100397396 | 3300005471 | Bacteria | 1311 |
| 378 | Ga0070698_100492937 | 3300005471 | Bacteria | 1163 |
| 379 | Ga0070698_100944074 | 3300005471 | Bacteria | 809 |
| 380 | Ga0070698_100967834 | 3300005471 | Bacteria | 798 |
| 381 | Ga0070698_102141723 | 3300005471 | Bacteria | 513 |
| 382 | Ga0070698_102194428 | 3300005471 | Bacteria | 506 |
| 383 | Ga0070699_100012245 | 3300005518 | Bacteria | 7400 |
| 384 | Ga0070699_100024357 | 3300005518 | Bacteria | 5216 |
| 385 | Ga0070699_100032538 | 3300005518 | Bacteria | 4504 |
| 386 | Ga0070699_100032879 | 3300005518 | Bacteria | 4481 |
| 387 | Ga0070699_100038201 | 3300005518 | Unclassified | 4157 |
| 388 | Ga0070699_100043802 | 3300005518 | Bacteria | 3874 |
| 389 | Ga0070699_100053558 | 3300005518 | Bacteria | 3492 |
| 390 | Ga0070699_100158199 | 3300005518 | Bacteria | 2005 |
| 391 | Ga0070699_100163219 | 3300005518 | Bacteria | 1972 |
| 392 | Ga0070699_100344609 | 3300005518 | Unclassified | 1341 |
| 393 | Ga0070699_100541574 | 3300005518 | Bacteria | 1059 |
| 394 | Ga0070699_100684370 | 3300005518 | Bacteria | 937 |
| 395 | Ga0070699_100763223 | 3300005518 | Bacteria | 885 |
| 396 | Ga0070699_100860784 | 3300005518 | Bacteria | 830 |
| 397 | Ga0070699_100887684 | 3300005518 | Bacteria | 816 |
| 398 | Ga0070699_101768861 | 3300005518 | Unclassified | 566 |
| 399 | Ga0070679_100003010 | 3300005530 | Bacteria | 15398 |
| 400 | Ga0070679_100010452 | 3300005530 | Bacteria | 8803 |
| 401 | Ga0070679_100010649 | 3300005530 | Bacteria | 8726 |
| 402 | Ga0070679_100068413 | 3300005530 | Bacteria | 3542 |
| 403 | Ga0070679_100103935 | 3300005530 | Bacteria | 2827 |
| 404 | Ga0070679_100105325 | 3300005530 | Bacteria | 2807 |
| 405 | Ga0070679_100177781 | 3300005530 | Unclassified | 2101 |
| 406 | Ga0070679_100249172 | 3300005530 | Bacteria | 1733 |
| 407 | Ga0070679_100443796 | 3300005530 | Unclassified | 1242 |
| 408 | Ga0070679_100538362 | 3300005530 | Bacteria | 1111 |
| 409 | Ga0070679_100694481 | 3300005530 | Bacteria | 960 |
| 410 | Ga0070679_100774356 | 3300005530 | Unclassified | 902 |
| 411 | Ga0070679_100919285 | 3300005530 | Unclassified | 818 |
| 412 | Ga0070679_100923975 | 3300005530 | Bacteria | 816 |
| 413 | Ga0070679_101216364 | 3300005530 | Bacteria | 699 |
| 414 | Ga0070684_100103746 | 3300005535 | Unclassified | 2544 |
| 415 | Ga0070684_100824233 | 3300005535 | Bacteria | 868 |
| 416 | Ga0070684_100842885 | 3300005535 | Bacteria | 858 |
| 417 | Ga0070684_102206656 | 3300005535 | Bacteria | 519 |
| 418 | Ga0070697_100008704 | 3300005536 | Bacteria | 7928 |
| 419 | Ga0070697_100019301 | 3300005536 | Bacteria | 5384 |
| 420 | Ga0070697_100033507 | 3300005536 | Bacteria | 4137 |
| 421 | Ga0070697_100070472 | 3300005536 | Bacteria | 2866 |
| 422 | Ga0070697_100080732 | 3300005536 | Bacteria | 2679 |
| 423 | Ga0070697_100132661 | 3300005536 | Bacteria | 2090 |
| 424 | Ga0070697_100235333 | 3300005536 | Unclassified | 1563 |
| 425 | Ga0070697_100289179 | 3300005536 | Bacteria | 1407 |
| 426 | Ga0070697_100325076 | 3300005536 | Bacteria | 1325 |
| 427 | Ga0070697_100357713 | 3300005536 | Bacteria | 1262 |
| 428 | Ga0070697_100389854 | 3300005536 | Unclassified | 1207 |
| 429 | Ga0070697_100392116 | 3300005536 | Bacteria | 1204 |
| 430 | Ga0070697_100398876 | 3300005536 | Bacteria | 1193 |
| 431 | Ga0070697_100417678 | 3300005536 | Unclassified | 1165 |
| 432 | Ga0070697_101161141 | 3300005536 | Bacteria | 688 |
| 433 | Ga0070697_101577108 | 3300005536 | Unclassified | 587 |
| 434 | Ga0070697_102107904 | 3300005536 | Bacteria | 505 |
| 435 | Ga0068853_100019614 | 3300005539 | Bacteria | 5611 |
| 436 | Ga0068853_100277845 | 3300005539 | Bacteria | 1543 |
| 437 | Ga0068853_100459431 | 3300005539 | Bacteria | 1198 |
| 438 | Ga0068853_100491273 | 3300005539 | Unclassified | 1158 |
| 439 | Ga0068853_100680998 | 3300005539 | Unclassified | 980 |
| 440 | Ga0068853_101540998 | 3300005539 | Bacteria | 644 |
| 441 | Ga0068853_102024316 | 3300005539 | Unclassified | 558 |
| 442 | Ga0070672_100013626 | 3300005543 | Bacteria | 5748 |
| 443 | Ga0070672_100016159 | 3300005543 | Bacteria | 5338 |
| 444 | Ga0070672_100021951 | 3300005543 | Bacteria | 4679 |
| 445 | Ga0070672_100074044 | 3300005543 | Bacteria | 2716 |
| 446 | Ga0070672_100085953 | 3300005543 | Bacteria | 2529 |
| 447 | Ga0070672_100092375 | 3300005543 | Bacteria | 2443 |
| 448 | Ga0070672_100188935 | 3300005543 | Bacteria | 1719 |
| 449 | Ga0070672_100191240 | 3300005543 | Bacteria | 1709 |
| 450 | Ga0070672_100194743 | 3300005543 | Bacteria | 1693 |
| 451 | Ga0070672_100206958 | 3300005543 | Bacteria | 1642 |
| 452 | Ga0070672_100491146 | 3300005543 | Bacteria | 1061 |
| 453 | Ga0070672_100915807 | 3300005543 | Bacteria | 775 |
| 454 | Ga0070672_100949792 | 3300005543 | Bacteria | 761 |
| 455 | Ga0070672_101008290 | 3300005543 | Bacteria | 738 |
| 456 | Ga0070672_101515421 | 3300005543 | Unclassified | 601 |
| 457 | Ga0070672_101546777 | 3300005543 | Bacteria | 595 |
| 458 | Ga0070672_101761556 | 3300005543 | Bacteria | 557 |
| 459 | Ga0070686_100002279 | 3300005544 | Bacteria | 10593 |
| 460 | Ga0070686_100007091 | 3300005544 | Bacteria | 6248 |
| 461 | Ga0070686_100084126 | 3300005544 | Bacteria | 2113 |
| 462 | Ga0070686_100220758 | 3300005544 | Bacteria | 1370 |
| 463 | Ga0070686_100564737 | 3300005544 | Bacteria | 892 |
| 464 | Ga0070686_100601702 | 3300005544 | Bacteria | 866 |
| 465 | Ga0070686_100671900 | 3300005544 | Bacteria | 823 |
| 466 | Ga0070686_101415057 | 3300005544 | Unclassified | 584 |
| 467 | Ga0070686_101725424 | 3300005544 | Bacteria | 532 |
| 468 | Ga0070695_100014472 | 3300005545 | Bacteria | 4756 |
| 469 | Ga0070695_100089522 | 3300005545 | Bacteria | 2052 |
| 470 | Ga0070695_100120396 | 3300005545 | Bacteria | 1795 |
| 471 | Ga0070695_100128703 | 3300005545 | Bacteria | 1742 |
| 472 | Ga0070695_100153550 | 3300005545 | Bacteria | 1609 |
| 473 | Ga0070695_100156911 | 3300005545 | Bacteria | 1593 |
| 474 | Ga0070695_100295961 | 3300005545 | Bacteria | 1195 |
| 475 | Ga0070695_100506108 | 3300005545 | Bacteria | 935 |
| 476 | Ga0070695_100574410 | 3300005545 | Bacteria | 882 |
| 477 | Ga0070696_100003268 | 3300005546 | Bacteria | 10812 |
| 478 | Ga0070696_100089645 | 3300005546 | Bacteria | 2187 |
| 479 | Ga0070696_100092155 | 3300005546 | Bacteria | 2159 |
| 480 | Ga0070696_100113559 | 3300005546 | Bacteria | 1953 |
| 481 | Ga0070696_100119710 | 3300005546 | Bacteria | 1904 |
| 482 | Ga0070696_100162043 | 3300005546 | Bacteria | 1648 |
| 483 | Ga0070696_100180514 | 3300005546 | Bacteria | 1566 |
| 484 | Ga0070696_100258889 | 3300005546 | Bacteria | 1319 |
| 485 | Ga0070696_100312695 | 3300005546 | Bacteria | 1206 |
| 486 | Ga0070696_100521954 | 3300005546 | Bacteria | 948 |
| 487 | Ga0070696_100772087 | 3300005546 | Bacteria | 789 |
| 488 | Ga0070696_101096299 | 3300005546 | Unclassified | 669 |
| 489 | Ga0070693_100168653 | 3300005547 | Unclassified | 1400 |
| 490 | Ga0070693_100828907 | 3300005547 | Bacteria | 688 |
| 491 | Ga0070693_101416434 | 3300005547 | Bacteria | 541 |
| 492 | Ga0070665_100048682 | 3300005548 | Bacteria | 4255 |
| 493 | Ga0070665_100315756 | 3300005548 | Unclassified | 1567 |
| 494 | Ga0070665_100355107 | 3300005548 | Bacteria | 1471 |
| 495 | Ga0070665_100714843 | 3300005548 | Bacteria | 1015 |
| 496 | Ga0070665_101293301 | 3300005548 | Bacteria | 739 |
| 497 | Ga0070665_102536340 | 3300005548 | Bacteria | 514 |
| 498 | Ga0070704_100026654 | 3300005549 | Bacteria | 3823 |
| 499 | Ga0070704_100033958 | 3300005549 | Bacteria | 3454 |
| 500 | Ga0070704_100035692 | 3300005549 | Bacteria | 3382 |
| 501 | Ga0070704_100228384 | 3300005549 | Bacteria | 1517 |
| 502 | Ga0070704_100273086 | 3300005549 | Unclassified | 1397 |
| 503 | Ga0070704_100572866 | 3300005549 | Bacteria | 989 |
| 504 | Ga0068855_100065198 | 3300005563 | Bacteria | 4246 |
| 505 | Ga0068855_100070564 | 3300005563 | Bacteria | 4064 |
| 506 | Ga0068855_100100245 | 3300005563 | Bacteria | 3335 |
| 507 | Ga0068855_100635005 | 3300005563 | Bacteria | 1148 |
| 508 | Ga0068855_100822658 | 3300005563 | Bacteria | 986 |
| 509 | Ga0068855_101197144 | 3300005563 | Bacteria | 790 |
| 510 | Ga0068855_101366830 | 3300005563 | Bacteria | 731 |
| 511 | Ga0068855_101424111 | 3300005563 | Bacteria | 713 |
| 512 | Ga0070664_100002135 | 3300005564 | Bacteria | 15844 |
| 513 | Ga0070664_100033775 | 3300005564 | Bacteria | 4287 |
| 514 | Ga0070664_100194633 | 3300005564 | Bacteria | 1807 |
| 515 | Ga0070664_100206069 | 3300005564 | Unclassified | 1756 |
| 516 | Ga0070664_100240325 | 3300005564 | Bacteria | 1626 |
| 517 | Ga0070664_100411241 | 3300005564 | Bacteria | 1238 |
| 518 | Ga0070664_100466183 | 3300005564 | Bacteria | 1161 |
| 519 | Ga0070664_100558833 | 3300005564 | Bacteria | 1058 |
| 520 | Ga0070664_101122345 | 3300005564 | Bacteria | 741 |
| 521 | Ga0070664_101421993 | 3300005564 | Unclassified | 656 |
| 522 | Ga0070664_101580372 | 3300005564 | Bacteria | 621 |
| 523 | Ga0068857_100011112 | 3300005577 | Bacteria | 7831 |
| 524 | Ga0068857_100151852 | 3300005577 | Bacteria | 2099 |
| 525 | Ga0068857_100239801 | 3300005577 | Bacteria | 1660 |
| 526 | Ga0068857_100323433 | 3300005577 | Bacteria | 1425 |
| 527 | Ga0068857_101113734 | 3300005577 | Unclassified | 763 |
| 528 | Ga0068857_102081853 | 3300005577 | Unclassified | 557 |
| 529 | Ga0068854_100026682 | 3300005578 | Bacteria | 3973 |
| 530 | Ga0068854_100040433 | 3300005578 | Bacteria | 3290 |
| 531 | Ga0068854_100082085 | 3300005578 | Bacteria | 2382 |
| 532 | Ga0068854_100115138 | 3300005578 | Bacteria | 2033 |
| 533 | Ga0068854_100147625 | 3300005578 | Bacteria | 1810 |
| 534 | Ga0068854_100793305 | 3300005578 | Bacteria | 825 |
| 535 | Ga0068854_101514808 | 3300005578 | Bacteria | 609 |
| 536 | Ga0068854_101670611 | 3300005578 | Bacteria | 582 |
| 537 | Ga0068856_100068962 | 3300005614 | Bacteria | 3496 |
| 538 | Ga0068856_100353143 | 3300005614 | Bacteria | 1489 |
| 539 | Ga0068856_100677467 | 3300005614 | Unclassified | 1052 |
| 540 | Ga0070702_100078203 | 3300005615 | Bacteria | 1974 |
| 541 | Ga0070702_100802243 | 3300005615 | Unclassified | 728 |
| 542 | Ga0070702_100959789 | 3300005615 | Bacteria | 674 |
| 543 | Ga0070702_101262047 | 3300005615 | Unclassified | 598 |
| 544 | Ga0070702_101894167 | 3300005615 | Bacteria | 500 |
| 545 | Ga0068852_100010221 | 3300005616 | Bacteria | 6996 |
| 546 | Ga0068852_100038875 | 3300005616 | Bacteria | 4003 |
| 547 | Ga0068852_100099243 | 3300005616 | Bacteria | 2624 |
| 548 | Ga0068852_100190203 | 3300005616 | Bacteria | 1936 |
| 549 | Ga0068852_101203060 | 3300005616 | Bacteria | 779 |
| 550 | Ga0068859_100028923 | 3300005617 | Bacteria | 5559 |
| 551 | Ga0068859_100193216 | 3300005617 | Unclassified | 2120 |
| 552 | Ga0068859_100233515 | 3300005617 | Bacteria | 1928 |
| 553 | Ga0068859_100260860 | 3300005617 | Unclassified | 1824 |
| 554 | Ga0068859_100262069 | 3300005617 | Bacteria | 1820 |
| 555 | Ga0068859_100270773 | 3300005617 | Bacteria | 1790 |
| 556 | Ga0068859_100272505 | 3300005617 | Bacteria | 1785 |
| 557 | Ga0068859_100292411 | 3300005617 | Bacteria | 1722 |
| 558 | Ga0068859_102288692 | 3300005617 | Bacteria | 596 |
| 559 | Ga0068864_100044927 | 3300005618 | Bacteria | 3788 |
| 560 | Ga0068864_100075307 | 3300005618 | Bacteria | 2947 |
| 561 | Ga0068864_100298150 | 3300005618 | Bacteria | 1508 |
| 562 | Ga0068864_100312904 | 3300005618 | Bacteria | 1473 |
| 563 | Ga0068864_100443295 | 3300005618 | Bacteria | 1241 |
| 564 | Ga0068864_100446734 | 3300005618 | Unclassified | 1236 |
| 565 | Ga0068864_100502321 | 3300005618 | Bacteria | 1167 |
| 566 | Ga0068864_100543757 | 3300005618 | Bacteria | 1122 |
| 567 | Ga0068864_102131957 | 3300005618 | Bacteria | 567 |
| 568 | Ga0068866_10034973 | 3300005718 | Bacteria | 2451 |
| 569 | Ga0068866_10067468 | 3300005718 | Bacteria | 1878 |
| 570 | Ga0068866_10072666 | 3300005718 | Bacteria | 1823 |
| 571 | Ga0068866_10158412 | 3300005718 | Unclassified | 1318 |
| 572 | Ga0068866_10265208 | 3300005718 | Unclassified | 1057 |
| 573 | Ga0068866_11184402 | 3300005718 | Unclassified | 551 |
| 574 | Ga0068866_11248870 | 3300005718 | Bacteria | 538 |
| 575 | Ga0068861_100029332 | 3300005719 | Bacteria | 4025 |
| 576 | Ga0068861_100030899 | 3300005719 | Bacteria | 3929 |
| 577 | Ga0068861_100044274 | 3300005719 | Bacteria | 3346 |
| 578 | Ga0068861_100111723 | 3300005719 | Bacteria | 2190 |
| 579 | Ga0068861_100258200 | 3300005719 | Unclassified | 1490 |
| 580 | Ga0068861_100282654 | 3300005719 | Bacteria | 1430 |
| 581 | Ga0068861_100331829 | 3300005719 | Unclassified | 1328 |
| 582 | Ga0068861_100599255 | 3300005719 | Bacteria | 1011 |
| 583 | Ga0068861_101095402 | 3300005719 | Bacteria | 765 |
| 584 | Ga0068861_101513212 | 3300005719 | Unclassified | 659 |
| 585 | Ga0068861_102292287 | 3300005719 | Bacteria | 542 |
| 586 | Ga0068851_10008330 | 3300005834 | Bacteria | 4793 |
| 587 | Ga0068870_10001300 | 3300005840 | Bacteria | 10054 |
| 588 | Ga0068870_10001633 | 3300005840 | Bacteria | 9146 |
| 589 | Ga0068870_10070077 | 3300005840 | Unclassified | 1910 |
| 590 | Ga0068870_10093138 | 3300005840 | Bacteria | 1689 |
| 591 | Ga0068870_10175962 | 3300005840 | Unclassified | 1281 |
| 592 | Ga0068870_10227024 | 3300005840 | Bacteria | 1146 |
| 593 | Ga0068870_10286765 | 3300005840 | Bacteria | 1034 |
| 594 | Ga0068870_10295454 | 3300005840 | Bacteria | 1021 |
| 595 | Ga0068870_10546452 | 3300005840 | Bacteria | 779 |
| 596 | Ga0068863_100038250 | 3300005841 | Bacteria | 4565 |
| 597 | Ga0068863_100048204 | 3300005841 | Bacteria | 4040 |
| 598 | Ga0068863_100195048 | 3300005841 | Unclassified | 1947 |
| 599 | Ga0068863_100257070 | 3300005841 | Bacteria | 1688 |
| 600 | Ga0068863_100283463 | 3300005841 | Bacteria | 1606 |
| 601 | Ga0068863_100424957 | 3300005841 | Bacteria | 1302 |
| 602 | Ga0068863_100452050 | 3300005841 | Bacteria | 1261 |
| 603 | Ga0068863_101498965 | 3300005841 | Unclassified | 683 |
| 604 | Ga0068858_100017073 | 3300005842 | Bacteria | 6813 |
| 605 | Ga0068858_100030962 | 3300005842 | Bacteria | 4969 |
| 606 | Ga0068858_100054231 | 3300005842 | Bacteria | 3707 |
| 607 | Ga0068858_100097626 | 3300005842 | Bacteria | 2739 |
| 608 | Ga0068858_100254281 | 3300005842 | Bacteria | 1669 |
| 609 | Ga0068858_100392388 | 3300005842 | Bacteria | 1333 |
| 610 | Ga0068858_100534810 | 3300005842 | Bacteria | 1134 |
| 611 | Ga0068858_100683151 | 3300005842 | Bacteria | 998 |
| 612 | Ga0068858_100773927 | 3300005842 | Bacteria | 936 |
| 613 | Ga0068858_101379088 | 3300005842 | Bacteria | 694 |
| 614 | Ga0068860_100039378 | 3300005843 | Bacteria | 4521 |
| 615 | Ga0068860_100082687 | 3300005843 | Bacteria | 3054 |
| 616 | Ga0068860_100090769 | 3300005843 | Bacteria | 2910 |
| 617 | Ga0068860_100099290 | 3300005843 | Bacteria | 2777 |
| 618 | Ga0068860_100165563 | 3300005843 | Bacteria | 2134 |
| 619 | Ga0068860_100333943 | 3300005843 | Bacteria | 1489 |
| 620 | Ga0068860_100383341 | 3300005843 | Bacteria | 1388 |
| 621 | Ga0068860_100545110 | 3300005843 | Bacteria | 1162 |
| 622 | Ga0068860_100880500 | 3300005843 | Bacteria | 911 |
| 623 | Ga0068860_101031932 | 3300005843 | Bacteria | 841 |
| 624 | Ga0068860_101051118 | 3300005843 | Unclassified | 833 |
| 625 | Ga0068860_101087656 | 3300005843 | Unclassified | 819 |
| 626 | Ga0068860_101678394 | 3300005843 | Bacteria | 657 |
| 627 | Ga0068862_100013299 | 3300005844 | Bacteria | 6808 |
| 628 | Ga0068862_100047732 | 3300005844 | Bacteria | 3655 |
| 629 | Ga0068862_100111235 | 3300005844 | Bacteria | 2404 |
| 630 | Ga0068862_100268664 | 3300005844 | Bacteria | 1559 |
| 631 | Ga0068862_100286115 | 3300005844 | Bacteria | 1512 |
| 632 | Ga0068862_100293778 | 3300005844 | Bacteria | 1493 |
| 633 | Ga0068862_100306119 | 3300005844 | Bacteria | 1463 |
| 634 | Ga0068862_100355664 | 3300005844 | Bacteria | 1360 |
| 635 | Ga0068862_100413838 | 3300005844 | Bacteria | 1264 |
| 636 | Ga0068862_100492625 | 3300005844 | Unclassified | 1162 |
| 637 | Ga0068862_100691711 | 3300005844 | Bacteria | 987 |
| 638 | Ga0068862_100827062 | 3300005844 | Bacteria | 906 |
| 639 | Ga0068862_100956798 | 3300005844 | Unclassified | 845 |
| 640 | Ga0068862_101190983 | 3300005844 | Unclassified | 760 |
| 641 | Ga0081455_10057868 | 3300005937 | Unclassified | 3283 |
| 642 | Ga0081538_10152633 | 3300005981 | Bacteria | 1043 |
| 643 | Ga0081540_1137386 | 3300005983 | Bacteria | 987 |
| 644 | Ga0081539_10000108 | 3300005985 | Bacteria | 195322 |
| 645 | Ga0081539_10007860 | 3300005985 | Bacteria | 9519 |
| 646 | Ga0081539_10179236 | 3300005985 | Bacteria | 995 |
| 647 | Ga0070717_10728661 | 3300006028 | Bacteria | 901 |
| 648 | Ga0075432_10390965 | 3300006058 | Bacteria | 598 |
| 649 | Ga0070715_10047289 | 3300006163 | Bacteria | 1833 |
| 650 | Ga0070715_10134085 | 3300006163 | Bacteria | 1195 |
| 651 | Ga0070715_10423250 | 3300006163 | Bacteria | 745 |
| 652 | Ga0070716_100023189 | 3300006173 | Bacteria | 3288 |
| 653 | Ga0070716_100032485 | 3300006173 | Bacteria | 2847 |
| 654 | Ga0070716_100256523 | 3300006173 | Bacteria | 1194 |
| 655 | Ga0070716_101333953 | 3300006173 | Bacteria | 581 |
| 656 | Ga0070712_100330337 | 3300006175 | Bacteria | 1242 |
| 657 | Ga0070712_100391468 | 3300006175 | Bacteria | 1146 |
| 658 | Ga0075427_10028816 | 3300006194 | Bacteria | 906 |
| 659 | Ga0097621_100025219 | 3300006237 | Bacteria | 4649 |
| 660 | Ga0097621_100078017 | 3300006237 | Bacteria | 2751 |
| 661 | Ga0097621_100218377 | 3300006237 | Bacteria | 1660 |
| 662 | Ga0097621_100582596 | 3300006237 | Bacteria | 1021 |
| 663 | Ga0097621_100832559 | 3300006237 | Bacteria | 856 |
| 664 | Ga0097621_101513991 | 3300006237 | Unclassified | 637 |
| 665 | Ga0097621_101554126 | 3300006237 | Bacteria | 628 |
| 666 | Ga0068871_100026774 | 3300006358 | Bacteria | 4503 |
| 667 | Ga0068871_100041914 | 3300006358 | Bacteria | 3672 |
| 668 | Ga0068871_100094937 | 3300006358 | Bacteria | 2490 |
| 669 | Ga0068871_100097568 | 3300006358 | Unclassified | 2457 |
| 670 | Ga0068871_100162369 | 3300006358 | Bacteria | 1911 |
| 671 | Ga0068871_100217152 | 3300006358 | Bacteria | 1655 |
| 672 | Ga0068871_100443768 | 3300006358 | Unclassified | 1162 |
| 673 | Ga0068871_100456545 | 3300006358 | Bacteria | 1146 |
| 674 | Ga0068871_100517313 | 3300006358 | Unclassified | 1077 |
| 675 | Ga0068871_100595415 | 3300006358 | Bacteria | 1005 |
| 676 | Ga0068871_100597052 | 3300006358 | Bacteria | 1004 |
| 677 | Ga0068871_101269132 | 3300006358 | Bacteria | 692 |
| 678 | Ga0075428_100002503 | 3300006844 | Bacteria | 19950 |
| 679 | Ga0075428_100006937 | 3300006844 | Bacteria | 12581 |
| 680 | Ga0075428_100012836 | 3300006844 | Bacteria | 9321 |
| 681 | Ga0075428_100020220 | 3300006844 | Bacteria | 7372 |
| 682 | Ga0075428_100061510 | 3300006844 | Bacteria | 4112 |
| 683 | Ga0075428_100090128 | 3300006844 | Bacteria | 3345 |
| 684 | Ga0075428_100130458 | 3300006844 | Bacteria | 2734 |
| 685 | Ga0075428_100327232 | 3300006844 | Bacteria | 1646 |
| 686 | Ga0075428_100491466 | 3300006844 | Bacteria | 1313 |
| 687 | Ga0075428_100738262 | 3300006844 | Bacteria | 1048 |
| 688 | Ga0075428_100790527 | 3300006844 | Bacteria | 1009 |
| 689 | Ga0075428_101000891 | 3300006844 | Bacteria | 885 |
| 690 | Ga0075428_101032446 | 3300006844 | Bacteria | 870 |
| 691 | Ga0075428_101623033 | 3300006844 | Bacteria | 676 |
| 692 | Ga0075428_102162335 | 3300006844 | Unclassified | 575 |
| 693 | Ga0075428_102601258 | 3300006844 | Unclassified | 517 |
| 694 | Ga0075430_100000873 | 3300006846 | Bacteria | 23681 |
| 695 | Ga0075430_100015060 | 3300006846 | Bacteria | 6582 |
| 696 | Ga0075430_100018191 | 3300006846 | Bacteria | 5981 |
| 697 | Ga0075430_100026375 | 3300006846 | Bacteria | 4944 |
| 698 | Ga0075430_100043483 | 3300006846 | Bacteria | 3797 |
| 699 | Ga0075430_100049041 | 3300006846 | Bacteria | 3564 |
| 700 | Ga0075430_100055897 | 3300006846 | Bacteria | 3319 |
| 701 | Ga0075430_100064554 | 3300006846 | Bacteria | 3076 |
| 702 | Ga0075430_100074105 | 3300006846 | Bacteria | 2854 |
| 703 | Ga0075430_100085976 | 3300006846 | Bacteria | 2633 |
| 704 | Ga0075430_100265303 | 3300006846 | Bacteria | 1422 |
| 705 | Ga0075430_100289868 | 3300006846 | Unclassified | 1354 |
| 706 | Ga0075430_100372556 | 3300006846 | Unclassified | 1179 |
| 707 | Ga0075430_100591977 | 3300006846 | Bacteria | 915 |
| 708 | Ga0075430_100897384 | 3300006846 | Bacteria | 730 |
| 709 | Ga0075431_100003195 | 3300006847 | Bacteria | 15850 |
| 710 | Ga0075431_100004132 | 3300006847 | Bacteria | 14165 |
| 711 | Ga0075431_100007106 | 3300006847 | Bacteria | 11124 |
| 712 | Ga0075431_100009445 | 3300006847 | Bacteria | 9790 |
| 713 | Ga0075431_100010296 | 3300006847 | Bacteria | 9396 |
| 714 | Ga0075431_100024633 | 3300006847 | Bacteria | 6169 |
| 715 | Ga0075431_100034803 | 3300006847 | Bacteria | 5188 |
| 716 | Ga0075431_100066052 | 3300006847 | Bacteria | 3735 |
| 717 | Ga0075431_100177843 | 3300006847 | Bacteria | 2184 |
| 718 | Ga0075431_100247943 | 3300006847 | Bacteria | 1810 |
| 719 | Ga0075431_100385160 | 3300006847 | Bacteria | 1405 |
| 720 | Ga0075431_100652861 | 3300006847 | Bacteria | 1032 |
| 721 | Ga0075431_100867741 | 3300006847 | Unclassified | 873 |
| 722 | Ga0075431_101027438 | 3300006847 | Bacteria | 790 |
| 723 | Ga0075431_101731710 | 3300006847 | Unclassified | 582 |
| 724 | Ga0075433_10001964 | 3300006852 | Bacteria | 15468 |
| 725 | Ga0075433_10002635 | 3300006852 | Bacteria | 13703 |
| 726 | Ga0075433_10002785 | 3300006852 | Bacteria | 13380 |
| 727 | Ga0075433_10012123 | 3300006852 | Bacteria | 6952 |
| 728 | Ga0075433_10045690 | 3300006852 | Bacteria | 3808 |
| 729 | Ga0075433_10099334 | 3300006852 | Bacteria | 2576 |
| 730 | Ga0075433_10108052 | 3300006852 | Bacteria | 2467 |
| 731 | Ga0075433_10148605 | 3300006852 | Unclassified | 2084 |
| 732 | Ga0075433_10177930 | 3300006852 | Bacteria | 1893 |
| 733 | Ga0075433_10198405 | 3300006852 | Bacteria | 1785 |
| 734 | Ga0075433_10222377 | 3300006852 | Bacteria | 1677 |
| 735 | Ga0075433_10223755 | 3300006852 | Bacteria | 1671 |
| 736 | Ga0075433_10229109 | 3300006852 | Bacteria | 1650 |
| 737 | Ga0075433_10268775 | 3300006852 | Unclassified | 1511 |
| 738 | Ga0075433_10416266 | 3300006852 | Bacteria | 1185 |
| 739 | Ga0075433_10550524 | 3300006852 | Unclassified | 1014 |
| 740 | Ga0075433_10865046 | 3300006852 | Bacteria | 789 |
| 741 | Ga0075434_100001499 | 3300006871 | Bacteria | 19717 |
| 742 | Ga0075434_100002432 | 3300006871 | Bacteria | 16367 |
| 743 | Ga0075434_100007378 | 3300006871 | Bacteria | 10180 |
| 744 | Ga0075434_100014134 | 3300006871 | Bacteria | 7624 |
| 745 | Ga0075434_100014265 | 3300006871 | Bacteria | 7593 |
| 746 | Ga0075434_100014411 | 3300006871 | Bacteria | 7556 |
| 747 | Ga0075434_100024080 | 3300006871 | Bacteria | 5946 |
| 748 | Ga0075434_100030949 | 3300006871 | Bacteria | 5275 |
| 749 | Ga0075434_100031338 | 3300006871 | Bacteria | 5242 |
| 750 | Ga0075434_100054964 | 3300006871 | Bacteria | 3956 |
| 751 | Ga0075434_100071219 | 3300006871 | Bacteria | 3468 |
| 752 | Ga0075434_100098646 | 3300006871 | Bacteria | 2927 |
| 753 | Ga0075434_100105863 | 3300006871 | Bacteria | 2822 |
| 754 | Ga0075434_100117136 | 3300006871 | Bacteria | 2677 |
| 755 | Ga0075434_100399683 | 3300006871 | Unclassified | 1395 |
| 756 | Ga0075434_100444826 | 3300006871 | Bacteria | 1317 |
| 757 | Ga0075434_100477442 | 3300006871 | Bacteria | 1268 |
| 758 | Ga0075434_100772640 | 3300006871 | Bacteria | 977 |
| 759 | Ga0075434_101183738 | 3300006871 | Bacteria | 776 |
| 760 | Ga0075434_101360941 | 3300006871 | Unclassified | 720 |
| 761 | Ga0075434_101537998 | 3300006871 | Unclassified | 674 |
| 762 | Ga0075429_100001904 | 3300006880 | Bacteria | 17304 |
| 763 | Ga0075429_100008495 | 3300006880 | Bacteria | 8935 |
| 764 | Ga0075429_100028175 | 3300006880 | Bacteria | 4876 |
| 765 | Ga0075429_100067128 | 3300006880 | Bacteria | 3122 |
| 766 | Ga0075429_100093453 | 3300006880 | Unclassified | 2623 |
| 767 | Ga0075429_100101061 | 3300006880 | Bacteria | 2517 |
| 768 | Ga0075429_100152221 | 3300006880 | Bacteria | 2025 |
| 769 | Ga0075429_100238837 | 3300006880 | Unclassified | 1592 |
| 770 | Ga0068865_100013773 | 3300006881 | Bacteria | 5123 |
| 771 | Ga0068865_100016245 | 3300006881 | Bacteria | 4758 |
| 772 | Ga0068865_100095830 | 3300006881 | Unclassified | 2163 |
| 773 | Ga0068865_100170272 | 3300006881 | Unclassified | 1669 |
| 774 | Ga0068865_100230435 | 3300006881 | Bacteria | 1453 |
| 775 | Ga0068865_100232903 | 3300006881 | Unclassified | 1446 |
| 776 | Ga0068865_100386714 | 3300006881 | Bacteria | 1142 |
| 777 | Ga0068865_100389233 | 3300006881 | Bacteria | 1139 |
| 778 | Ga0068865_100437653 | 3300006881 | Bacteria | 1078 |
| 779 | Ga0068865_101687496 | 3300006881 | Bacteria | 571 |
| 780 | Ga0075436_100000356 | 3300006914 | Bacteria | 29209 |
| 781 | Ga0075436_100002771 | 3300006914 | Bacteria | 12020 |
| 782 | Ga0075436_100017107 | 3300006914 | Bacteria | 4963 |
| 783 | Ga0075436_100023294 | 3300006914 | Bacteria | 4252 |
| 784 | Ga0075436_100032806 | 3300006914 | Bacteria | 3579 |
| 785 | Ga0075436_100039317 | 3300006914 | Bacteria | 3265 |
| 786 | Ga0075436_100043036 | 3300006914 | Bacteria | 3113 |
| 787 | Ga0075436_100050959 | 3300006914 | Bacteria | 2857 |
| 788 | Ga0075436_100051726 | 3300006914 | Bacteria | 2834 |
| 789 | Ga0075436_100250228 | 3300006914 | Bacteria | 1262 |
| 790 | Ga0075436_100279350 | 3300006914 | Bacteria | 1194 |
| 791 | Ga0075436_100375987 | 3300006914 | Bacteria | 1027 |
| 792 | Ga0075436_100407963 | 3300006914 | Bacteria | 985 |
| 793 | Ga0075436_100524808 | 3300006914 | Bacteria | 868 |
| 794 | Ga0075436_100670170 | 3300006914 | Bacteria | 767 |
| 795 | Ga0075436_100716082 | 3300006914 | Bacteria | 742 |
| 796 | Ga0097620_100028926 | 3300006931 | Bacteria | 5559 |
| 797 | Ga0097620_100193212 | 3300006931 | Unclassified | 2120 |
| 798 | Ga0097620_100233500 | 3300006931 | Bacteria | 1928 |
| 799 | Ga0097620_100260867 | 3300006931 | Unclassified | 1824 |
| 800 | Ga0097620_100262034 | 3300006931 | Bacteria | 1820 |
| 801 | Ga0097620_100270779 | 3300006931 | Bacteria | 1790 |
| 802 | Ga0097620_100272534 | 3300006931 | Bacteria | 1785 |
| 803 | Ga0097620_100292439 | 3300006931 | Bacteria | 1722 |
| 804 | Ga0097620_102289330 | 3300006931 | Bacteria | 596 |
| 805 | Ga0075435_100000113 | 3300007076 | Bacteria | 44786 |
| 806 | Ga0075435_100004401 | 3300007076 | Bacteria | 9668 |
| 807 | Ga0075435_100013013 | 3300007076 | Bacteria | 6176 |
| 808 | Ga0075435_100020007 | 3300007076 | Bacteria | 5118 |
| 809 | Ga0075435_100026283 | 3300007076 | Bacteria | 4539 |
| 810 | Ga0075435_100027142 | 3300007076 | Bacteria | 4474 |
| 811 | Ga0075435_100178030 | 3300007076 | Bacteria | 1796 |
| 812 | Ga0075435_100183672 | 3300007076 | Bacteria | 1768 |
| 813 | Ga0075435_100313277 | 3300007076 | Bacteria | 1343 |
| 814 | Ga0075435_100350279 | 3300007076 | Bacteria | 1266 |
| 815 | Ga0075435_100662809 | 3300007076 | Bacteria | 906 |
| 816 | Ga0099794_10000007 | 3300007265 | Bacteria | 128667 |
| 817 | Ga0099794_10024997 | 3300007265 | Bacteria | 2746 |
| 818 | Ga0105240_10002683 | 3300009093 | Bacteria | 28334 |
| 819 | Ga0105240_10003253 | 3300009093 | Bacteria | 25423 |
| 820 | Ga0105240_10104835 | 3300009093 | Bacteria | 3433 |
| 821 | Ga0105240_10126706 | 3300009093 | Unclassified | 3067 |
| 822 | Ga0105240_10203280 | 3300009093 | Bacteria | 2320 |
| 823 | Ga0105240_10327750 | 3300009093 | Bacteria | 1743 |
| 824 | Ga0105240_10479287 | 3300009093 | Bacteria | 1387 |
| 825 | Ga0105240_10516841 | 3300009093 | Bacteria | 1326 |
| 826 | Ga0105240_10568342 | 3300009093 | Bacteria | 1252 |
| 827 | Ga0105240_12669976 | 3300009093 | Bacteria | 516 |
| 828 | Ga0111539_10001040 | 3300009094 | Bacteria | 36436 |
| 829 | Ga0111539_10001085 | 3300009094 | Bacteria | 35942 |
| 830 | Ga0111539_10002183 | 3300009094 | Bacteria | 26127 |
| 831 | Ga0111539_10006175 | 3300009094 | Bacteria | 15466 |
| 832 | Ga0111539_10016472 | 3300009094 | Bacteria | 9165 |
| 833 | Ga0111539_10047130 | 3300009094 | Bacteria | 5153 |
| 834 | Ga0111539_10052961 | 3300009094 | Bacteria | 4830 |
| 835 | Ga0111539_10066706 | 3300009094 | Bacteria | 4250 |
| 836 | Ga0111539_10071582 | 3300009094 | Bacteria | 4091 |
| 837 | Ga0111539_10078900 | 3300009094 | Bacteria | 3872 |
| 838 | Ga0111539_10096368 | 3300009094 | Bacteria | 3475 |
| 839 | Ga0111539_10131226 | 3300009094 | Unclassified | 2934 |
| 840 | Ga0111539_10163847 | 3300009094 | Bacteria | 2600 |
| 841 | Ga0111539_10293546 | 3300009094 | Bacteria | 1892 |
| 842 | Ga0111539_10408753 | 3300009094 | Unclassified | 1581 |
| 843 | Ga0111539_10567793 | 3300009094 | Unclassified | 1321 |
| 844 | Ga0111539_11031329 | 3300009094 | Bacteria | 956 |
| 845 | Ga0111539_11184079 | 3300009094 | Bacteria | 888 |
| 846 | Ga0111539_11216711 | 3300009094 | Unclassified | 875 |
| 847 | Ga0111539_12973914 | 3300009094 | Bacteria | 548 |
| 848 | Ga0105245_10033892 | 3300009098 | Bacteria | 4526 |
| 849 | Ga0105245_10124755 | 3300009098 | Bacteria | 2409 |
| 850 | Ga0105245_10218985 | 3300009098 | Bacteria | 1836 |
| 851 | Ga0105245_10719633 | 3300009098 | Bacteria | 1032 |
| 852 | Ga0105245_11904214 | 3300009098 | Unclassified | 648 |
| 853 | Ga0105245_12114435 | 3300009098 | Unclassified | 617 |
| 854 | Ga0105245_12253917 | 3300009098 | Bacteria | 598 |
| 855 | Ga0105245_13243345 | 3300009098 | Bacteria | 504 |
| 856 | Ga0105247_10207655 | 3300009101 | Bacteria | 1319 |
| 857 | Ga0105247_10682958 | 3300009101 | Bacteria | 771 |
| 858 | Ga0105247_11517464 | 3300009101 | Bacteria | 547 |
| 859 | Ga0114129_10001846 | 3300009147 | Bacteria | 28863 |
| 860 | Ga0114129_10002364 | 3300009147 | Bacteria | 26182 |
| 861 | Ga0114129_10007495 | 3300009147 | Bacteria | 15539 |
| 862 | Ga0114129_10009760 | 3300009147 | Bacteria | 13687 |
| 863 | Ga0114129_10017684 | 3300009147 | Bacteria | 10150 |
| 864 | Ga0114129_10030411 | 3300009147 | Bacteria | 7640 |
| 865 | Ga0114129_10049144 | 3300009147 | Bacteria | 5928 |
| 866 | Ga0114129_10078971 | 3300009147 | Bacteria | 4576 |
| 867 | Ga0114129_10110713 | 3300009147 | Bacteria | 3790 |
| 868 | Ga0114129_10112552 | 3300009147 | Bacteria | 3753 |
| 869 | Ga0114129_10186126 | 3300009147 | Bacteria | 2822 |
| 870 | Ga0114129_10188429 | 3300009147 | Bacteria | 2803 |
| 871 | Ga0114129_10238632 | 3300009147 | Bacteria | 2445 |
| 872 | Ga0114129_10278451 | 3300009147 | Bacteria | 2236 |
| 873 | Ga0114129_10311447 | 3300009147 | Bacteria | 2095 |
| 874 | Ga0114129_10326076 | 3300009147 | Bacteria | 2040 |
| 875 | Ga0114129_10394335 | 3300009147 | Unclassified | 1825 |
| 876 | Ga0114129_10454294 | 3300009147 | Bacteria | 1680 |
| 877 | Ga0114129_10575343 | 3300009147 | Bacteria | 1462 |
| 878 | Ga0114129_10704166 | 3300009147 | Unclassified | 1298 |
| 879 | Ga0114129_10731174 | 3300009147 | Bacteria | 1269 |
| 880 | Ga0114129_10764679 | 3300009147 | Bacteria | 1236 |
| 881 | Ga0114129_12096045 | 3300009147 | Bacteria | 682 |
| 882 | Ga0105243_10015027 | 3300009148 | Bacteria | 5860 |
| 883 | Ga0105243_10152190 | 3300009148 | Unclassified | 1985 |
| 884 | Ga0105243_10316841 | 3300009148 | Bacteria | 1420 |
| 885 | Ga0105243_10402377 | 3300009148 | Unclassified | 1272 |
| 886 | Ga0105243_10556551 | 3300009148 | Bacteria | 1097 |
| 887 | Ga0105243_10575253 | 3300009148 | Bacteria | 1080 |
| 888 | Ga0105243_11765444 | 3300009148 | Unclassified | 649 |
| 889 | Ga0105243_12378397 | 3300009148 | Bacteria | 568 |
| 890 | Ga0105241_10085831 | 3300009174 | Bacteria | 2474 |
| 891 | Ga0105241_10354963 | 3300009174 | Bacteria | 1274 |
| 892 | Ga0105241_11812499 | 3300009174 | Bacteria | 596 |
| 893 | Ga0105242_10015390 | 3300009176 | Bacteria | 5939 |
| 894 | Ga0105242_10027708 | 3300009176 | Bacteria | 4503 |
| 895 | Ga0105242_10118795 | 3300009176 | Bacteria | 2265 |
| 896 | Ga0105242_10129402 | 3300009176 | Bacteria | 2177 |
| 897 | Ga0105242_10179613 | 3300009176 | Bacteria | 1866 |
| 898 | Ga0105242_10232274 | 3300009176 | Bacteria | 1653 |
| 899 | Ga0105242_11178438 | 3300009176 | Bacteria | 784 |
| 900 | Ga0105242_12208377 | 3300009176 | Bacteria | 596 |
| 901 | Ga0105242_13038370 | 3300009176 | Bacteria | 520 |
| 902 | Ga0105248_10021241 | 3300009177 | Bacteria | 7193 |
| 903 | Ga0105248_10075790 | 3300009177 | Bacteria | 3780 |
| 904 | Ga0105248_10168406 | 3300009177 | Bacteria | 2469 |
| 905 | Ga0105248_10172992 | 3300009177 | Bacteria | 2434 |
| 906 | Ga0105248_10225357 | 3300009177 | Bacteria | 2110 |
| 907 | Ga0105248_10255790 | 3300009177 | Bacteria | 1971 |
| 908 | Ga0105248_10815054 | 3300009177 | Unclassified | 1053 |
| 909 | Ga0105248_10920619 | 3300009177 | Bacteria | 987 |
| 910 | Ga0105248_10968478 | 3300009177 | Bacteria | 961 |
| 911 | Ga0105248_11452407 | 3300009177 | Bacteria | 776 |
| 912 | Ga0105248_12280263 | 3300009177 | Bacteria | 616 |
| 913 | Ga0105248_12489132 | 3300009177 | Bacteria | 590 |
| 914 | Ga0105237_10508580 | 3300009545 | Unclassified | 1211 |
| 915 | Ga0105238_10002348 | 3300009551 | Bacteria | 19032 |
| 916 | Ga0105238_10057028 | 3300009551 | Bacteria | 3917 |
| 917 | Ga0105238_10124984 | 3300009551 | Bacteria | 2552 |
| 918 | Ga0105238_10127262 | 3300009551 | Bacteria | 2526 |
| 919 | Ga0105238_10169090 | 3300009551 | Bacteria | 2162 |
| 920 | Ga0105238_11442205 | 3300009551 | Bacteria | 716 |
| 921 | Ga0105238_11638091 | 3300009551 | Bacteria | 674 |
| 922 | Ga0105249_10000825 | 3300009553 | Bacteria | 27921 |
| 923 | Ga0105249_10044702 | 3300009553 | Bacteria | 4027 |
| 924 | Ga0105249_10165860 | 3300009553 | Bacteria | 2138 |
| 925 | Ga0105249_10474714 | 3300009553 | Bacteria | 1293 |
| 926 | Ga0105249_10479170 | 3300009553 | Bacteria | 1287 |
| 927 | Ga0105249_10869617 | 3300009553 | Bacteria | 967 |
| 928 | Ga0105249_10890373 | 3300009553 | Unclassified | 957 |
| 929 | Ga0105249_12707172 | 3300009553 | Unclassified | 568 |
| 930 | Ga0105249_13213033 | 3300009553 | Bacteria | 525 |
| 931 | Ga0099796_10105567 | 3300010159 | Bacteria | 1066 |
| 932 | Ga0105239_10004786 | 3300010375 | Bacteria | 16066 |
| 933 | Ga0105239_13408506 | 3300010375 | Bacteria | 517 |
| 934 | Ga0105246_10009743 | 3300011119 | Bacteria | 5921 |
| 935 | Ga0105246_10209617 | 3300011119 | Bacteria | 1520 |
| 936 | Ga0105246_10294862 | 3300011119 | Bacteria | 1306 |
| 937 | Ga0105246_10661881 | 3300011119 | Bacteria | 910 |
| 938 | Ga0157373_10011946 | 3300013100 | Bacteria | 6381 |
| 939 | Ga0157373_10016274 | 3300013100 | Bacteria | 5427 |
| 940 | Ga0157373_10023468 | 3300013100 | Bacteria | 4471 |
| 941 | Ga0157373_10044551 | 3300013100 | Bacteria | 3167 |
| 942 | Ga0157371_10929898 | 3300013102 | Bacteria | 660 |
| 943 | Ga0157371_11367586 | 3300013102 | Bacteria | 549 |
| 944 | Ga0157370_10001452 | 3300013104 | Bacteria | 29347 |
| 945 | Ga0157370_10005166 | 3300013104 | Bacteria | 14723 |
| 946 | Ga0157370_10052762 | 3300013104 | Bacteria | 3881 |
| 947 | Ga0157370_10053557 | 3300013104 | Bacteria | 3847 |
| 948 | Ga0157370_10178566 | 3300013104 | Bacteria | 1973 |
| 949 | Ga0157370_11142105 | 3300013104 | Bacteria | 703 |
| 950 | Ga0157369_10007789 | 3300013105 | Bacteria | 12325 |
| 951 | Ga0157369_10040763 | 3300013105 | Bacteria | 5069 |
| 952 | Ga0157369_10180770 | 3300013105 | Bacteria | 2219 |
| 953 | Ga0157369_10490860 | 3300013105 | Bacteria | 1271 |
| 954 | Ga0157369_10613123 | 3300013105 | Bacteria | 1123 |
| 955 | Ga0157369_11490482 | 3300013105 | Bacteria | 688 |
| 956 | Ga0157374_10191057 | 3300013296 | Bacteria | 2003 |
| 957 | Ga0157374_10338552 | 3300013296 | Bacteria | 1493 |
| 958 | Ga0157378_10338601 | 3300013297 | Bacteria | 1466 |
| 959 | Ga0157378_10758291 | 3300013297 | Bacteria | 994 |
| 960 | Ga0157378_11122575 | 3300013297 | Bacteria | 824 |
| 961 | Ga0157378_12556740 | 3300013297 | Bacteria | 563 |
| 962 | Ga0157378_13067751 | 3300013297 | Bacteria | 518 |
| 963 | Ga0157378_13291542 | 3300013297 | Bacteria | 502 |
| 964 | Ga0163162_10001847 | 3300013306 | Bacteria | 19926 |
| 965 | Ga0163162_10507677 | 3300013306 | Bacteria | 1336 |
| 966 | Ga0163162_11170273 | 3300013306 | Unclassified | 872 |
| 967 | Ga0163162_11958896 | 3300013306 | Unclassified | 671 |
| 968 | Ga0163162_12832122 | 3300013306 | Unclassified | 558 |
| 969 | Ga0163162_12920677 | 3300013306 | Unclassified | 550 |
| 970 | Ga0157372_10005429 | 3300013307 | Bacteria | 13547 |
| 971 | Ga0157372_10036630 | 3300013307 | Bacteria | 5408 |
| 972 | Ga0157372_10039040 | 3300013307 | Bacteria | 5240 |
| 973 | Ga0157372_10055903 | 3300013307 | Bacteria | 4409 |
| 974 | Ga0157372_10169547 | 3300013307 | Unclassified | 2525 |
| 975 | Ga0157372_10229821 | 3300013307 | Bacteria | 2150 |
| 976 | Ga0157372_10319171 | 3300013307 | Bacteria | 1809 |
| 977 | Ga0157372_11688095 | 3300013307 | Bacteria | 729 |
| 978 | Ga0157372_12697982 | 3300013307 | Bacteria | 570 |
| 979 | Ga0157375_10127392 | 3300013308 | Bacteria | 2663 |
| 980 | Ga0157375_10272178 | 3300013308 | Bacteria | 1856 |
| 981 | Ga0157375_10277031 | 3300013308 | Unclassified | 1840 |
| 982 | Ga0157375_10284816 | 3300013308 | Bacteria | 1816 |
| 983 | Ga0157375_10285563 | 3300013308 | Bacteria | 1813 |
| 984 | Ga0157375_10300603 | 3300013308 | Bacteria | 1768 |
| 985 | Ga0157375_10311951 | 3300013308 | Bacteria | 1737 |
| 986 | Ga0157375_10384164 | 3300013308 | Bacteria | 1571 |
| 987 | Ga0157375_10614849 | 3300013308 | Bacteria | 1245 |
| 988 | Ga0157375_10637978 | 3300013308 | Unclassified | 1222 |
| 989 | Ga0157375_10738830 | 3300013308 | Bacteria | 1136 |
| 990 | Ga0157375_10985126 | 3300013308 | Unclassified | 983 |
| 991 | Ga0157375_11016452 | 3300013308 | Bacteria | 968 |
| 992 | Ga0157375_11078015 | 3300013308 | Unclassified | 940 |
| 993 | Ga0157375_11857302 | 3300013308 | Bacteria | 715 |
| 994 | Ga0157375_12147679 | 3300013308 | Bacteria | 665 |
| 995 | Ga0157375_12897132 | 3300013308 | Bacteria | 573 |
| 996 | Ga0163163_10007877 | 3300014325 | Bacteria | 9416 |
| 997 | Ga0163163_10019382 | 3300014325 | Bacteria | 6388 |
| 998 | Ga0163163_10081920 | 3300014325 | Bacteria | 3230 |
| 999 | Ga0163163_10096450 | 3300014325 | Bacteria | 2977 |
| 1000 | Ga0163163_10233192 | 3300014325 | Bacteria | 1890 |
| 1001 | Ga0163163_10361475 | 3300014325 | Bacteria | 1508 |
| 1002 | Ga0163163_10370638 | 3300014325 | Unclassified | 1489 |
| 1003 | Ga0163163_10499909 | 3300014325 | Bacteria | 1278 |
| 1004 | Ga0163163_10676790 | 3300014325 | Bacteria | 1095 |
| 1005 | Ga0163163_11924207 | 3300014325 | Bacteria | 651 |
| 1006 | Ga0157380_10027153 | 3300014326 | Bacteria | 4352 |
| 1007 | Ga0157380_10030364 | 3300014326 | Bacteria | 4139 |
| 1008 | Ga0157380_10049595 | 3300014326 | Bacteria | 3312 |
| 1009 | Ga0157380_10054117 | 3300014326 | Unclassified | 3184 |
| 1010 | Ga0157380_10096378 | 3300014326 | Bacteria | 2452 |
| 1011 | Ga0157380_10137965 | 3300014326 | Bacteria | 2090 |
| 1012 | Ga0157380_10157528 | 3300014326 | Bacteria | 1970 |
| 1013 | Ga0157380_10166067 | 3300014326 | Bacteria | 1924 |
| 1014 | Ga0157380_10166629 | 3300014326 | Bacteria | 1921 |
| 1015 | Ga0157380_10334714 | 3300014326 | Bacteria | 1409 |
| 1016 | Ga0157380_10418631 | 3300014326 | Unclassified | 1277 |
| 1017 | Ga0157380_10525981 | 3300014326 | Unclassified | 1155 |
| 1018 | Ga0157380_10771304 | 3300014326 | Unclassified | 975 |
| 1019 | Ga0157380_10833193 | 3300014326 | Bacteria | 942 |
| 1020 | Ga0157380_12677001 | 3300014326 | Bacteria | 565 |
| 1021 | Ga0182008_10004666 | 3300014497 | Bacteria | 7964 |
| 1022 | Ga0182008_10161236 | 3300014497 | Unclassified | 1129 |
| 1023 | Ga0157377_10003339 | 3300014745 | Bacteria | 7256 |
| 1024 | Ga0157377_10018588 | 3300014745 | Bacteria | 3614 |
| 1025 | Ga0157377_10177623 | 3300014745 | Bacteria | 1336 |
| 1026 | Ga0157377_10264754 | 3300014745 | Bacteria | 1120 |
| 1027 | Ga0157377_10795675 | 3300014745 | Bacteria | 697 |
| 1028 | Ga0157379_10037344 | 3300014968 | Bacteria | 4331 |
| 1029 | Ga0157379_10677501 | 3300014968 | Bacteria | 967 |
| 1030 | Ga0157379_11204611 | 3300014968 | Bacteria | 728 |
| 1031 | Ga0157376_10001404 | 3300014969 | Bacteria | 15834 |
| 1032 | Ga0157376_10021103 | 3300014969 | Bacteria | 5055 |
| 1033 | Ga0157376_10276699 | 3300014969 | Unclassified | 1579 |
| 1034 | Ga0157376_10550490 | 3300014969 | Unclassified | 1142 |
| 1035 | Ga0157376_10784708 | 3300014969 | Unclassified | 964 |
| 1036 | Ga0157376_10801184 | 3300014969 | Bacteria | 955 |
| 1037 | Ga0157376_10900674 | 3300014969 | Bacteria | 903 |
| 1038 | Ga0157376_10926300 | 3300014969 | Unclassified | 891 |
| 1039 | Ga0157376_11240490 | 3300014969 | Bacteria | 774 |
| 1040 | Ga0157376_11272856 | 3300014969 | Bacteria | 765 |
| 1041 | Ga0157376_12285219 | 3300014969 | Bacteria | 580 |
| 1042 | Ga0163161_10184710 | 3300017792 | Bacteria | 1600 |
| 1043 | Ga0163161_10221280 | 3300017792 | Unclassified | 1466 |
| 1044 | Ga0163161_10576072 | 3300017792 | Bacteria | 925 |
| 1045 | Ga0163161_10851744 | 3300017792 | Unclassified | 769 |
| 1046 | Ga0163161_11802577 | 3300017792 | Bacteria | 544 |
| 1047 | Ga0197907_10337954 | 3300020069 | Unclassified | 1296 |
| 1048 | Ga0206356_11445921 | 3300020070 | Bacteria | 2023 |
| 1049 | Ga0206350_11074823 | 3300020080 | Bacteria | 653 |
| 1050 | Ga0206353_10037599 | 3300020082 | Bacteria | 1085 |
| 1051 | Ga0224712_10057516 | 3300022467 | Bacteria | 1537 |
| 1052 | Ga0224712_10209050 | 3300022467 | Bacteria | 889 |
| 1053 | Ga0207673_1017334 | 3300025290 | Bacteria | 961 |
| 1054 | Ga0207697_10000290 | 3300025315 | Bacteria | 27985 |
| 1055 | Ga0207697_10048608 | 3300025315 | Unclassified | 1750 |
| 1056 | Ga0207697_10063931 | 3300025315 | Unclassified | 1534 |
| 1057 | Ga0207697_10165079 | 3300025315 | Bacteria | 967 |
| 1058 | Ga0207656_10002379 | 3300025321 | Bacteria | 6321 |
| 1059 | Ga0207653_10006143 | 3300025885 | Bacteria | 3743 |
| 1060 | Ga0207653_10008062 | 3300025885 | Bacteria | 3283 |
| 1061 | Ga0207653_10068657 | 3300025885 | Unclassified | 1208 |
| 1062 | Ga0207653_10233010 | 3300025885 | Bacteria | 702 |
| 1063 | Ga0207653_10420276 | 3300025885 | Bacteria | 524 |
| 1064 | Ga0207682_10025221 | 3300025893 | Bacteria | 2357 |
| 1065 | Ga0207682_10048926 | 3300025893 | Bacteria | 1744 |
| 1066 | Ga0207682_10096728 | 3300025893 | Bacteria | 1287 |
| 1067 | Ga0207682_10097245 | 3300025893 | Bacteria | 1283 |
| 1068 | Ga0207682_10129240 | 3300025893 | Bacteria | 1127 |
| 1069 | Ga0207682_10307929 | 3300025893 | Unclassified | 743 |
| 1070 | Ga0207682_10534962 | 3300025893 | Unclassified | 554 |
| 1071 | Ga0207692_10614172 | 3300025898 | Bacteria | 700 |
| 1072 | Ga0207692_10785631 | 3300025898 | Bacteria | 622 |
| 1073 | Ga0207642_10006179 | 3300025899 | Bacteria | 3967 |
| 1074 | Ga0207642_10395982 | 3300025899 | Bacteria | 825 |
| 1075 | Ga0207642_10611221 | 3300025899 | Unclassified | 679 |
| 1076 | Ga0207642_11015684 | 3300025899 | Unclassified | 534 |
| 1077 | Ga0207642_11144946 | 3300025899 | Bacteria | 504 |
| 1078 | Ga0207710_10125341 | 3300025900 | Bacteria | 1230 |
| 1079 | Ga0207710_10267451 | 3300025900 | Bacteria | 858 |
| 1080 | Ga0207710_10600673 | 3300025900 | Bacteria | 575 |
| 1081 | Ga0207688_10007175 | 3300025901 | Bacteria | 6060 |
| 1082 | Ga0207688_10051452 | 3300025901 | Unclassified | 2307 |
| 1083 | Ga0207688_10361557 | 3300025901 | Bacteria | 896 |
| 1084 | Ga0207688_10491886 | 3300025901 | Unclassified | 768 |
| 1085 | Ga0207688_10619106 | 3300025901 | Bacteria | 683 |
| 1086 | Ga0207688_11091252 | 3300025901 | Bacteria | 504 |
| 1087 | Ga0207680_10009037 | 3300025903 | Bacteria | 4922 |
| 1088 | Ga0207680_10041513 | 3300025903 | Bacteria | 2684 |
| 1089 | Ga0207680_10102494 | 3300025903 | Bacteria | 1841 |
| 1090 | Ga0207680_10145503 | 3300025903 | Bacteria | 1575 |
| 1091 | Ga0207680_10321882 | 3300025903 | Bacteria | 1081 |
| 1092 | Ga0207680_10500953 | 3300025903 | Bacteria | 865 |
| 1093 | Ga0207680_10786866 | 3300025903 | Bacteria | 682 |
| 1094 | Ga0207647_10377182 | 3300025904 | Bacteria | 801 |
| 1095 | Ga0207685_10046306 | 3300025905 | Bacteria | 1655 |
| 1096 | Ga0207685_10408999 | 3300025905 | Unclassified | 697 |
| 1097 | Ga0207685_10449518 | 3300025905 | Bacteria | 670 |
| 1098 | Ga0207685_10473186 | 3300025905 | Bacteria | 655 |
| 1099 | Ga0207699_10002101 | 3300025906 | Bacteria | 9419 |
| 1100 | Ga0207699_10022339 | 3300025906 | Bacteria | 3426 |
| 1101 | Ga0207699_10505717 | 3300025906 | Unclassified | 873 |
| 1102 | Ga0207699_10629689 | 3300025906 | Bacteria | 782 |
| 1103 | Ga0207699_10772765 | 3300025906 | Bacteria | 705 |
| 1104 | Ga0207699_10782776 | 3300025906 | Bacteria | 701 |
| 1105 | Ga0207699_11182218 | 3300025906 | Bacteria | 566 |
| 1106 | Ga0207645_10000851 | 3300025907 | Bacteria | 25421 |
| 1107 | Ga0207645_10004993 | 3300025907 | Bacteria | 9719 |
| 1108 | Ga0207645_10058721 | 3300025907 | Unclassified | 2456 |
| 1109 | Ga0207645_10123659 | 3300025907 | Unclassified | 1681 |
| 1110 | Ga0207645_10423155 | 3300025907 | Unclassified | 897 |
| 1111 | Ga0207645_10469574 | 3300025907 | Unclassified | 850 |
| 1112 | Ga0207645_10555736 | 3300025907 | Bacteria | 779 |
| 1113 | Ga0207645_11047310 | 3300025907 | Unclassified | 551 |
| 1114 | Ga0207643_10004495 | 3300025908 | Bacteria | 7496 |
| 1115 | Ga0207643_10006402 | 3300025908 | Bacteria | 6305 |
| 1116 | Ga0207643_10026911 | 3300025908 | Bacteria | 3187 |
| 1117 | Ga0207643_10059100 | 3300025908 | Unclassified | 2187 |
| 1118 | Ga0207643_10069640 | 3300025908 | Bacteria | 2022 |
| 1119 | Ga0207643_10106967 | 3300025908 | Bacteria | 1645 |
| 1120 | Ga0207643_10190539 | 3300025908 | Bacteria | 1245 |
| 1121 | Ga0207643_10209165 | 3300025908 | Bacteria | 1190 |
| 1122 | Ga0207643_10224446 | 3300025908 | Bacteria | 1151 |
| 1123 | Ga0207705_10212200 | 3300025909 | Bacteria | 1469 |
| 1124 | Ga0207705_10474310 | 3300025909 | Bacteria | 971 |
| 1125 | Ga0207705_10577775 | 3300025909 | Unclassified | 874 |
| 1126 | Ga0207705_11004575 | 3300025909 | Bacteria | 644 |
| 1127 | Ga0207684_10004990 | 3300025910 | Bacteria | 12364 |
| 1128 | Ga0207684_10069427 | 3300025910 | Bacteria | 2994 |
| 1129 | Ga0207684_10216318 | 3300025910 | Bacteria | 1653 |
| 1130 | Ga0207684_10292983 | 3300025910 | Bacteria | 1403 |
| 1131 | Ga0207684_10495300 | 3300025910 | Bacteria | 1048 |
| 1132 | Ga0207684_11546278 | 3300025910 | Unclassified | 539 |
| 1133 | Ga0207654_10146592 | 3300025911 | Bacteria | 1511 |
| 1134 | Ga0207654_10576432 | 3300025911 | Bacteria | 801 |
| 1135 | Ga0207707_10004354 | 3300025912 | Bacteria | 12526 |
| 1136 | Ga0207707_10005219 | 3300025912 | Bacteria | 11383 |
| 1137 | Ga0207707_10013449 | 3300025912 | Bacteria | 7132 |
| 1138 | Ga0207707_10015352 | 3300025912 | Bacteria | 6669 |
| 1139 | Ga0207707_10175138 | 3300025912 | Bacteria | 1874 |
| 1140 | Ga0207707_10177616 | 3300025912 | Bacteria | 1859 |
| 1141 | Ga0207707_10365189 | 3300025912 | Bacteria | 1242 |
| 1142 | Ga0207707_11015186 | 3300025912 | Bacteria | 680 |
| 1143 | Ga0207707_11350272 | 3300025912 | Bacteria | 571 |
| 1144 | Ga0207695_10002961 | 3300025913 | Bacteria | 24497 |
| 1145 | Ga0207695_10005696 | 3300025913 | Bacteria | 16429 |
| 1146 | Ga0207695_10010835 | 3300025913 | Bacteria | 11108 |
| 1147 | Ga0207695_10018997 | 3300025913 | Bacteria | 7926 |
| 1148 | Ga0207695_10021287 | 3300025913 | Bacteria | 7404 |
| 1149 | Ga0207695_10060208 | 3300025913 | Bacteria | 3932 |
| 1150 | Ga0207695_10083033 | 3300025913 | Bacteria | 3237 |
| 1151 | Ga0207695_10251114 | 3300025913 | Bacteria | 1668 |
| 1152 | Ga0207695_10464662 | 3300025913 | Bacteria | 1148 |
| 1153 | Ga0207695_10698361 | 3300025913 | Bacteria | 895 |
| 1154 | Ga0207693_10158962 | 3300025915 | Unclassified | 1778 |
| 1155 | Ga0207693_10430119 | 3300025915 | Bacteria | 1032 |
| 1156 | Ga0207663_10000013 | 3300025916 | Bacteria | 167304 |
| 1157 | Ga0207663_10119472 | 3300025916 | Bacteria | 1802 |
| 1158 | Ga0207660_10003505 | 3300025917 | Bacteria | 10221 |
| 1159 | Ga0207660_10012077 | 3300025917 | Bacteria | 5644 |
| 1160 | Ga0207660_10022201 | 3300025917 | Bacteria | 4275 |
| 1161 | Ga0207660_10041754 | 3300025917 | Bacteria | 3216 |
| 1162 | Ga0207660_10044390 | 3300025917 | Bacteria | 3127 |
| 1163 | Ga0207660_10046121 | 3300025917 | Bacteria | 3074 |
| 1164 | Ga0207660_10070072 | 3300025917 | Bacteria | 2548 |
| 1165 | Ga0207660_10087241 | 3300025917 | Unclassified | 2305 |
| 1166 | Ga0207660_10421199 | 3300025917 | Bacteria | 1077 |
| 1167 | Ga0207660_10657008 | 3300025917 | Bacteria | 855 |
| 1168 | Ga0207660_10748746 | 3300025917 | Bacteria | 797 |
| 1169 | Ga0207660_10944524 | 3300025917 | Bacteria | 703 |
| 1170 | Ga0207662_10001075 | 3300025918 | Bacteria | 12844 |
| 1171 | Ga0207662_10026933 | 3300025918 | Bacteria | 3318 |
| 1172 | Ga0207662_10081538 | 3300025918 | Bacteria | 1975 |
| 1173 | Ga0207662_10120288 | 3300025918 | Bacteria | 1646 |
| 1174 | Ga0207662_10263484 | 3300025918 | Bacteria | 1135 |
| 1175 | Ga0207662_10394169 | 3300025918 | Bacteria | 937 |
| 1176 | Ga0207662_10491930 | 3300025918 | Unclassified | 844 |
| 1177 | Ga0207662_10616872 | 3300025918 | Bacteria | 756 |
| 1178 | Ga0207657_10083333 | 3300025919 | Unclassified | 2683 |
| 1179 | Ga0207657_10393414 | 3300025919 | Bacteria | 1090 |
| 1180 | Ga0207657_10589591 | 3300025919 | Bacteria | 868 |
| 1181 | Ga0207657_10850712 | 3300025919 | Unclassified | 704 |
| 1182 | Ga0207649_10029688 | 3300025920 | Bacteria | 3231 |
| 1183 | Ga0207649_10037416 | 3300025920 | Bacteria | 2931 |
| 1184 | Ga0207649_10053767 | 3300025920 | Bacteria | 2503 |
| 1185 | Ga0207649_10129782 | 3300025920 | Unclassified | 1710 |
| 1186 | Ga0207652_10015543 | 3300025921 | Bacteria | 6191 |
| 1187 | Ga0207652_10015852 | 3300025921 | Bacteria | 6142 |
| 1188 | Ga0207652_10027630 | 3300025921 | Bacteria | 4729 |
| 1189 | Ga0207652_10035883 | 3300025921 | Bacteria | 4188 |
| 1190 | Ga0207652_10078569 | 3300025921 | Bacteria | 2881 |
| 1191 | Ga0207652_10112310 | 3300025921 | Bacteria | 2418 |
| 1192 | Ga0207652_10113362 | 3300025921 | Bacteria | 2407 |
| 1193 | Ga0207652_10189204 | 3300025921 | Bacteria | 1851 |
| 1194 | Ga0207652_10353554 | 3300025921 | Bacteria | 1326 |
| 1195 | Ga0207652_10527211 | 3300025921 | Bacteria | 1062 |
| 1196 | Ga0207652_10586836 | 3300025921 | Bacteria | 1000 |
| 1197 | Ga0207652_10754636 | 3300025921 | Bacteria | 866 |
| 1198 | Ga0207652_11907823 | 3300025921 | Bacteria | 500 |
| 1199 | Ga0207646_10012007 | 3300025922 | Bacteria | 8348 |
| 1200 | Ga0207646_10038236 | 3300025922 | Bacteria | 4324 |
| 1201 | Ga0207646_10049626 | 3300025922 | Bacteria | 3758 |
| 1202 | Ga0207646_10056781 | 3300025922 | Bacteria | 3499 |
| 1203 | Ga0207646_10120836 | 3300025922 | Unclassified | 2353 |
| 1204 | Ga0207646_10181257 | 3300025922 | Bacteria | 1902 |
| 1205 | Ga0207646_10263446 | 3300025922 | Bacteria | 1558 |
| 1206 | Ga0207646_10542085 | 3300025922 | Bacteria | 1047 |
| 1207 | Ga0207646_10692585 | 3300025922 | Bacteria | 911 |
| 1208 | Ga0207646_11454576 | 3300025922 | Bacteria | 595 |
| 1209 | Ga0207681_10003409 | 3300025923 | Bacteria | 9946 |
| 1210 | Ga0207681_10005701 | 3300025923 | Bacteria | 7644 |
| 1211 | Ga0207681_10025838 | 3300025923 | Bacteria | 3782 |
| 1212 | Ga0207681_10032616 | 3300025923 | Bacteria | 3411 |
| 1213 | Ga0207681_10069907 | 3300025923 | Bacteria | 2443 |
| 1214 | Ga0207681_10086563 | 3300025923 | Bacteria | 2227 |
| 1215 | Ga0207681_10088630 | 3300025923 | Bacteria | 2204 |
| 1216 | Ga0207681_10149451 | 3300025923 | Bacteria | 1749 |
| 1217 | Ga0207681_10257517 | 3300025923 | Bacteria | 1365 |
| 1218 | Ga0207681_10388683 | 3300025923 | Unclassified | 1124 |
| 1219 | Ga0207681_10704819 | 3300025923 | Unclassified | 839 |
| 1220 | Ga0207681_11540315 | 3300025923 | Bacteria | 557 |
| 1221 | Ga0207694_10002177 | 3300025924 | Bacteria | 16104 |
| 1222 | Ga0207694_10025502 | 3300025924 | Bacteria | 4494 |
| 1223 | Ga0207694_10097846 | 3300025924 | Bacteria | 2322 |
| 1224 | Ga0207694_10378453 | 3300025924 | Unclassified | 1175 |
| 1225 | Ga0207650_10032311 | 3300025925 | Unclassified | 3785 |
| 1226 | Ga0207650_10047751 | 3300025925 | Bacteria | 3155 |
| 1227 | Ga0207650_10105626 | 3300025925 | Bacteria | 2174 |
| 1228 | Ga0207650_10256613 | 3300025925 | Bacteria | 1417 |
| 1229 | Ga0207650_10306627 | 3300025925 | Bacteria | 1298 |
| 1230 | Ga0207650_10584363 | 3300025925 | Unclassified | 938 |
| 1231 | Ga0207650_11696566 | 3300025925 | Bacteria | 535 |
| 1232 | Ga0207650_11774620 | 3300025925 | Bacteria | 522 |
| 1233 | Ga0207659_10002837 | 3300025926 | Bacteria | 10341 |
| 1234 | Ga0207659_10013483 | 3300025926 | Bacteria | 5237 |
| 1235 | Ga0207659_10044943 | 3300025926 | Bacteria | 3110 |
| 1236 | Ga0207659_10046234 | 3300025926 | Bacteria | 3072 |
| 1237 | Ga0207659_10065431 | 3300025926 | Unclassified | 2634 |
| 1238 | Ga0207659_10091714 | 3300025926 | Bacteria | 2270 |
| 1239 | Ga0207659_10103140 | 3300025926 | Unclassified | 2155 |
| 1240 | Ga0207659_10114348 | 3300025926 | Bacteria | 2057 |
| 1241 | Ga0207659_10116492 | 3300025926 | Bacteria | 2040 |
| 1242 | Ga0207659_10294533 | 3300025926 | Bacteria | 1331 |
| 1243 | Ga0207659_10326061 | 3300025926 | Bacteria | 1268 |
| 1244 | Ga0207659_10328900 | 3300025926 | Bacteria | 1263 |
| 1245 | Ga0207659_10378935 | 3300025926 | Unclassified | 1179 |
| 1246 | Ga0207659_10436669 | 3300025926 | Bacteria | 1100 |
| 1247 | Ga0207659_10504110 | 3300025926 | Bacteria | 1025 |
| 1248 | Ga0207659_10602587 | 3300025926 | Bacteria | 937 |
| 1249 | Ga0207659_10632785 | 3300025926 | Bacteria | 913 |
| 1250 | Ga0207659_10671578 | 3300025926 | Bacteria | 886 |
| 1251 | Ga0207659_11814622 | 3300025926 | Unclassified | 518 |
| 1252 | Ga0207687_10202947 | 3300025927 | Bacteria | 1551 |
| 1253 | Ga0207687_10226143 | 3300025927 | Bacteria | 1476 |
| 1254 | Ga0207687_11004914 | 3300025927 | Unclassified | 715 |
| 1255 | Ga0207687_11932830 | 3300025927 | Bacteria | 504 |
| 1256 | Ga0207700_10003894 | 3300025928 | Bacteria | 8713 |
| 1257 | Ga0207700_10053732 | 3300025928 | Bacteria | 3020 |
| 1258 | Ga0207700_10063270 | 3300025928 | Bacteria | 2813 |
| 1259 | Ga0207700_11381634 | 3300025928 | Bacteria | 626 |
| 1260 | Ga0207664_10005254 | 3300025929 | Bacteria | 8839 |
| 1261 | Ga0207664_10092694 | 3300025929 | Bacteria | 2480 |
| 1262 | Ga0207664_10266543 | 3300025929 | Bacteria | 1499 |
| 1263 | Ga0207644_10056290 | 3300025931 | Bacteria | 2837 |
| 1264 | Ga0207644_10192621 | 3300025931 | Bacteria | 1604 |
| 1265 | Ga0207644_10233948 | 3300025931 | Bacteria | 1461 |
| 1266 | Ga0207644_10245580 | 3300025931 | Bacteria | 1427 |
| 1267 | Ga0207644_10569969 | 3300025931 | Bacteria | 938 |
| 1268 | Ga0207644_10601592 | 3300025931 | Bacteria | 913 |
| 1269 | Ga0207644_10679931 | 3300025931 | Bacteria | 858 |
| 1270 | Ga0207644_10935434 | 3300025931 | Unclassified | 727 |
| 1271 | Ga0207690_10263750 | 3300025932 | Unclassified | 1335 |
| 1272 | Ga0207690_10334074 | 3300025932 | Unclassified | 1194 |
| 1273 | Ga0207690_10807451 | 3300025932 | Unclassified | 775 |
| 1274 | Ga0207690_11404399 | 3300025932 | Unclassified | 584 |
| 1275 | Ga0207706_10013724 | 3300025933 | Bacteria | 7352 |
| 1276 | Ga0207706_10026001 | 3300025933 | Bacteria | 5242 |
| 1277 | Ga0207706_10061499 | 3300025933 | Bacteria | 3307 |
| 1278 | Ga0207706_10152038 | 3300025933 | Bacteria | 2035 |
| 1279 | Ga0207706_10160169 | 3300025933 | Bacteria | 1978 |
| 1280 | Ga0207706_10317720 | 3300025933 | Unclassified | 1355 |
| 1281 | Ga0207706_10460301 | 3300025933 | Unclassified | 1100 |
| 1282 | Ga0207706_10580996 | 3300025933 | Bacteria | 963 |
| 1283 | Ga0207706_10660981 | 3300025933 | Bacteria | 894 |
| 1284 | Ga0207706_10936592 | 3300025933 | Bacteria | 730 |
| 1285 | Ga0207706_11276041 | 3300025933 | Bacteria | 608 |
| 1286 | Ga0207686_10037703 | 3300025934 | Bacteria | 2919 |
| 1287 | Ga0207686_10056018 | 3300025934 | Bacteria | 2476 |
| 1288 | Ga0207686_10172315 | 3300025934 | Bacteria | 1527 |
| 1289 | Ga0207686_10302983 | 3300025934 | Bacteria | 1187 |
| 1290 | Ga0207686_10680487 | 3300025934 | Bacteria | 816 |
| 1291 | Ga0207709_10007381 | 3300025935 | Bacteria | 6125 |
| 1292 | Ga0207709_10420513 | 3300025935 | Bacteria | 1026 |
| 1293 | Ga0207709_10440127 | 3300025935 | Bacteria | 1005 |
| 1294 | Ga0207709_10628963 | 3300025935 | Unclassified | 853 |
| 1295 | Ga0207670_10038868 | 3300025936 | Unclassified | 3111 |
| 1296 | Ga0207670_10078935 | 3300025936 | Unclassified | 2297 |
| 1297 | Ga0207670_10311895 | 3300025936 | Bacteria | 1235 |
| 1298 | Ga0207670_10563273 | 3300025936 | Bacteria | 932 |
| 1299 | Ga0207670_10893376 | 3300025936 | Bacteria | 744 |
| 1300 | Ga0207670_10942173 | 3300025936 | Bacteria | 725 |
| 1301 | Ga0207670_10988527 | 3300025936 | Bacteria | 708 |
| 1302 | Ga0207669_10002012 | 3300025937 | Bacteria | 8623 |
| 1303 | Ga0207669_10096997 | 3300025937 | Bacteria | 1937 |
| 1304 | Ga0207669_10100248 | 3300025937 | Unclassified | 1912 |
| 1305 | Ga0207669_10223731 | 3300025937 | Bacteria | 1383 |
| 1306 | Ga0207669_10258731 | 3300025937 | Bacteria | 1300 |
| 1307 | Ga0207669_10328713 | 3300025937 | Bacteria | 1173 |
| 1308 | Ga0207669_10946961 | 3300025937 | Unclassified | 721 |
| 1309 | Ga0207669_11239813 | 3300025937 | Unclassified | 632 |
| 1310 | Ga0207704_10124377 | 3300025938 | Bacteria | 1772 |
| 1311 | Ga0207704_10167909 | 3300025938 | Bacteria | 1570 |
| 1312 | Ga0207704_10256762 | 3300025938 | Bacteria | 1315 |
| 1313 | Ga0207704_10329796 | 3300025938 | Unclassified | 1180 |
| 1314 | Ga0207704_10362494 | 3300025938 | Bacteria | 1132 |
| 1315 | Ga0207704_10801063 | 3300025938 | Unclassified | 787 |
| 1316 | Ga0207704_11030139 | 3300025938 | Bacteria | 697 |
| 1317 | Ga0207665_10002991 | 3300025939 | Bacteria | 11345 |
| 1318 | Ga0207665_10010374 | 3300025939 | Bacteria | 6119 |
| 1319 | Ga0207665_10143891 | 3300025939 | Bacteria | 1703 |
| 1320 | Ga0207665_10451797 | 3300025939 | Bacteria | 986 |
| 1321 | Ga0207665_10955907 | 3300025939 | Bacteria | 681 |
| 1322 | Ga0207691_10001071 | 3300025940 | Bacteria | 27217 |
| 1323 | Ga0207691_10005950 | 3300025940 | Bacteria | 11784 |
| 1324 | Ga0207691_10018752 | 3300025940 | Bacteria | 6554 |
| 1325 | Ga0207691_10024050 | 3300025940 | Bacteria | 5730 |
| 1326 | Ga0207691_10035046 | 3300025940 | Bacteria | 4663 |
| 1327 | Ga0207691_10052019 | 3300025940 | Bacteria | 3742 |
| 1328 | Ga0207691_10123900 | 3300025940 | Bacteria | 2288 |
| 1329 | Ga0207691_10143494 | 3300025940 | Unclassified | 2103 |
| 1330 | Ga0207691_10156448 | 3300025940 | Unclassified | 2002 |
| 1331 | Ga0207691_10207177 | 3300025940 | Bacteria | 1705 |
| 1332 | Ga0207691_10223531 | 3300025940 | Bacteria | 1632 |
| 1333 | Ga0207691_10834803 | 3300025940 | Bacteria | 773 |
| 1334 | Ga0207691_11001379 | 3300025940 | Unclassified | 697 |
| 1335 | Ga0207711_10058614 | 3300025941 | Bacteria | 3314 |
| 1336 | Ga0207711_10112995 | 3300025941 | Bacteria | 2418 |
| 1337 | Ga0207711_10231482 | 3300025941 | Unclassified | 1692 |
| 1338 | Ga0207711_10843093 | 3300025941 | Bacteria | 853 |
| 1339 | Ga0207711_10971700 | 3300025941 | Unclassified | 788 |
| 1340 | Ga0207711_11268065 | 3300025941 | Bacteria | 679 |
| 1341 | Ga0207689_10000987 | 3300025942 | Bacteria | 27254 |
| 1342 | Ga0207689_10012190 | 3300025942 | Bacteria | 7354 |
| 1343 | Ga0207689_10044715 | 3300025942 | Bacteria | 3661 |
| 1344 | Ga0207689_10105201 | 3300025942 | Unclassified | 2319 |
| 1345 | Ga0207689_10267004 | 3300025942 | Bacteria | 1416 |
| 1346 | Ga0207689_10347280 | 3300025942 | Bacteria | 1233 |
| 1347 | Ga0207689_10415824 | 3300025942 | Bacteria | 1122 |
| 1348 | Ga0207689_10566481 | 3300025942 | Bacteria | 954 |
| 1349 | Ga0207689_10575985 | 3300025942 | Bacteria | 946 |
| 1350 | Ga0207689_11781535 | 3300025942 | Bacteria | 509 |
| 1351 | Ga0207661_10005427 | 3300025944 | Bacteria | 8981 |
| 1352 | Ga0207661_10040416 | 3300025944 | Bacteria | 3666 |
| 1353 | Ga0207661_10245415 | 3300025944 | Bacteria | 1590 |
| 1354 | Ga0207661_10606906 | 3300025944 | Bacteria | 1004 |
| 1355 | Ga0207661_11977224 | 3300025944 | Bacteria | 529 |
| 1356 | Ga0207679_10012887 | 3300025945 | Bacteria | 5469 |
| 1357 | Ga0207679_10185398 | 3300025945 | Unclassified | 1725 |
| 1358 | Ga0207679_10231981 | 3300025945 | Bacteria | 1559 |
| 1359 | Ga0207679_10244143 | 3300025945 | Bacteria | 1523 |
| 1360 | Ga0207679_10271323 | 3300025945 | Bacteria | 1451 |
| 1361 | Ga0207679_10331842 | 3300025945 | Bacteria | 1320 |
| 1362 | Ga0207679_10477170 | 3300025945 | Bacteria | 1110 |
| 1363 | Ga0207679_11247691 | 3300025945 | Unclassified | 682 |
| 1364 | Ga0207679_11439474 | 3300025945 | Unclassified | 632 |
| 1365 | Ga0207679_11916802 | 3300025945 | Unclassified | 540 |
| 1366 | Ga0207667_10054172 | 3300025949 | Bacteria | 4219 |
| 1367 | Ga0207667_10232265 | 3300025949 | Bacteria | 1888 |
| 1368 | Ga0207667_10258617 | 3300025949 | Bacteria | 1780 |
| 1369 | Ga0207667_10452992 | 3300025949 | Bacteria | 1304 |
| 1370 | Ga0207667_10477485 | 3300025949 | Unclassified | 1266 |
| 1371 | Ga0207651_10012653 | 3300025960 | Bacteria | 4786 |
| 1372 | Ga0207651_10035322 | 3300025960 | Bacteria | 3248 |
| 1373 | Ga0207651_10039932 | 3300025960 | Bacteria | 3099 |
| 1374 | Ga0207651_10079139 | 3300025960 | Unclassified | 2360 |
| 1375 | Ga0207651_10095871 | 3300025960 | Bacteria | 2186 |
| 1376 | Ga0207651_10328799 | 3300025960 | Bacteria | 1280 |
| 1377 | Ga0207651_10436948 | 3300025960 | Unclassified | 1120 |
| 1378 | Ga0207651_10521152 | 3300025960 | Bacteria | 1030 |
| 1379 | Ga0207651_10797188 | 3300025960 | Bacteria | 837 |
| 1380 | Ga0207651_10979349 | 3300025960 | Bacteria | 755 |
| 1381 | Ga0207651_11202695 | 3300025960 | Bacteria | 680 |
| 1382 | Ga0207651_11263093 | 3300025960 | Bacteria | 664 |
| 1383 | Ga0207651_11487955 | 3300025960 | Bacteria | 610 |
| 1384 | Ga0207712_10000080 | 3300025961 | Bacteria | 114486 |
| 1385 | Ga0207712_10017935 | 3300025961 | Bacteria | 4607 |
| 1386 | Ga0207712_10068054 | 3300025961 | Bacteria | 2550 |
| 1387 | Ga0207712_10083673 | 3300025961 | Bacteria | 2329 |
| 1388 | Ga0207712_10409416 | 3300025961 | Unclassified | 1142 |
| 1389 | Ga0207712_10593883 | 3300025961 | Unclassified | 957 |
| 1390 | Ga0207712_11525986 | 3300025961 | Bacteria | 598 |
| 1391 | Ga0207712_11667823 | 3300025961 | Bacteria | 571 |
| 1392 | Ga0207712_11751927 | 3300025961 | Bacteria | 557 |
| 1393 | Ga0207712_11852496 | 3300025961 | Unclassified | 540 |
| 1394 | Ga0207668_10022416 | 3300025972 | Bacteria | 4043 |
| 1395 | Ga0207668_10045674 | 3300025972 | Bacteria | 2989 |
| 1396 | Ga0207668_10148738 | 3300025972 | Unclassified | 1810 |
| 1397 | Ga0207668_10152015 | 3300025972 | Unclassified | 1793 |
| 1398 | Ga0207668_10159119 | 3300025972 | Bacteria | 1758 |
| 1399 | Ga0207668_10186501 | 3300025972 | Bacteria | 1640 |
| 1400 | Ga0207668_10389634 | 3300025972 | Unclassified | 1175 |
| 1401 | Ga0207668_10579569 | 3300025972 | Unclassified | 975 |
| 1402 | Ga0207640_10004506 | 3300025981 | Bacteria | 7558 |
| 1403 | Ga0207640_10028150 | 3300025981 | Bacteria | 3432 |
| 1404 | Ga0207640_10029667 | 3300025981 | Bacteria | 3360 |
| 1405 | Ga0207640_10071495 | 3300025981 | Bacteria | 2337 |
| 1406 | Ga0207640_10147498 | 3300025981 | Unclassified | 1724 |
| 1407 | Ga0207640_10579061 | 3300025981 | Bacteria | 947 |
| 1408 | Ga0207640_10659765 | 3300025981 | Bacteria | 892 |
| 1409 | Ga0207658_10042379 | 3300025986 | Bacteria | 3302 |
| 1410 | Ga0207658_10160825 | 3300025986 | Bacteria | 1840 |
| 1411 | Ga0207658_10388742 | 3300025986 | Unclassified | 1224 |
| 1412 | Ga0207658_10503109 | 3300025986 | Unclassified | 1079 |
| 1413 | Ga0207658_10917671 | 3300025986 | Unclassified | 798 |
| 1414 | Ga0207658_11515735 | 3300025986 | Bacteria | 613 |
| 1415 | Ga0207677_10056884 | 3300026023 | Bacteria | 2682 |
| 1416 | Ga0207677_10138148 | 3300026023 | Bacteria | 1861 |
| 1417 | Ga0207677_10156492 | 3300026023 | Unclassified | 1765 |
| 1418 | Ga0207677_11294686 | 3300026023 | Unclassified | 669 |
| 1419 | Ga0207703_10060686 | 3300026035 | Bacteria | 3093 |
| 1420 | Ga0207703_10160044 | 3300026035 | Bacteria | 1971 |
| 1421 | Ga0207703_10160050 | 3300026035 | Bacteria | 1971 |
| 1422 | Ga0207703_10160542 | 3300026035 | Unclassified | 1968 |
| 1423 | Ga0207703_10196440 | 3300026035 | Bacteria | 1790 |
| 1424 | Ga0207703_10208289 | 3300026035 | Bacteria | 1742 |
| 1425 | Ga0207703_10484474 | 3300026035 | Unclassified | 1159 |
| 1426 | Ga0207703_10631665 | 3300026035 | Bacteria | 1015 |
| 1427 | Ga0207703_11023321 | 3300026035 | Bacteria | 793 |
| 1428 | Ga0207703_11201673 | 3300026035 | Bacteria | 729 |
| 1429 | Ga0207703_11709885 | 3300026035 | Bacteria | 605 |
| 1430 | Ga0207639_10019272 | 3300026041 | Bacteria | 4864 |
| 1431 | Ga0207639_10091255 | 3300026041 | Bacteria | 2438 |
| 1432 | Ga0207639_10398118 | 3300026041 | Unclassified | 1240 |
| 1433 | Ga0207639_11507621 | 3300026041 | Unclassified | 631 |
| 1434 | Ga0207639_11644678 | 3300026041 | Bacteria | 602 |
| 1435 | Ga0207678_10010477 | 3300026067 | Bacteria | 8142 |
| 1436 | Ga0207678_10025357 | 3300026067 | Bacteria | 5175 |
| 1437 | Ga0207678_10038024 | 3300026067 | Bacteria | 4184 |
| 1438 | Ga0207678_10204380 | 3300026067 | Unclassified | 1689 |
| 1439 | Ga0207678_10255654 | 3300026067 | Bacteria | 1501 |
| 1440 | Ga0207678_10589722 | 3300026067 | Bacteria | 974 |
| 1441 | Ga0207708_10010914 | 3300026075 | Bacteria | 6757 |
| 1442 | Ga0207708_10041086 | 3300026075 | Bacteria | 3526 |
| 1443 | Ga0207708_10044635 | 3300026075 | Unclassified | 3377 |
| 1444 | Ga0207708_10051393 | 3300026075 | Bacteria | 3137 |
| 1445 | Ga0207708_10093078 | 3300026075 | Bacteria | 2326 |
| 1446 | Ga0207708_10108177 | 3300026075 | Bacteria | 2156 |
| 1447 | Ga0207708_10163144 | 3300026075 | Bacteria | 1761 |
| 1448 | Ga0207708_10220046 | 3300026075 | Bacteria | 1521 |
| 1449 | Ga0207708_10284588 | 3300026075 | Unclassified | 1340 |
| 1450 | Ga0207708_10461004 | 3300026075 | Bacteria | 1060 |
| 1451 | Ga0207708_10603882 | 3300026075 | Bacteria | 930 |
| 1452 | Ga0207708_10691181 | 3300026075 | Bacteria | 871 |
| 1453 | Ga0207708_11242086 | 3300026075 | Bacteria | 652 |
| 1454 | Ga0207708_11899230 | 3300026075 | Bacteria | 522 |
| 1455 | Ga0207702_10091630 | 3300026078 | Bacteria | 2662 |
| 1456 | Ga0207702_10092000 | 3300026078 | Bacteria | 2657 |
| 1457 | Ga0207702_10472988 | 3300026078 | Bacteria | 1219 |
| 1458 | Ga0207702_10521176 | 3300026078 | Bacteria | 1160 |
| 1459 | Ga0207641_10010866 | 3300026088 | Bacteria | 7457 |
| 1460 | Ga0207641_10016599 | 3300026088 | Bacteria | 6028 |
| 1461 | Ga0207641_10051447 | 3300026088 | Bacteria | 3489 |
| 1462 | Ga0207641_10060175 | 3300026088 | Bacteria | 3237 |
| 1463 | Ga0207641_10306101 | 3300026088 | Unclassified | 1503 |
| 1464 | Ga0207641_10419581 | 3300026088 | Unclassified | 1288 |
| 1465 | Ga0207641_10895642 | 3300026088 | Unclassified | 881 |
| 1466 | Ga0207648_10004141 | 3300026089 | Bacteria | 15006 |
| 1467 | Ga0207648_10044297 | 3300026089 | Unclassified | 3904 |
| 1468 | Ga0207648_10073453 | 3300026089 | Bacteria | 2980 |
| 1469 | Ga0207648_10077673 | 3300026089 | Unclassified | 2895 |
| 1470 | Ga0207648_10170083 | 3300026089 | Bacteria | 1926 |
| 1471 | Ga0207648_10291124 | 3300026089 | Bacteria | 1462 |
| 1472 | Ga0207648_10584911 | 3300026089 | Bacteria | 1028 |
| 1473 | Ga0207648_10699265 | 3300026089 | Unclassified | 939 |
| 1474 | Ga0207648_10994438 | 3300026089 | Unclassified | 785 |
| 1475 | Ga0207648_11115348 | 3300026089 | Bacteria | 740 |
| 1476 | Ga0207648_11138688 | 3300026089 | Bacteria | 732 |
| 1477 | Ga0207676_10080727 | 3300026095 | Unclassified | 2640 |
| 1478 | Ga0207676_10126880 | 3300026095 | Bacteria | 2162 |
| 1479 | Ga0207676_10155889 | 3300026095 | Bacteria | 1973 |
| 1480 | Ga0207676_10222315 | 3300026095 | Bacteria | 1682 |
| 1481 | Ga0207676_10380158 | 3300026095 | Unclassified | 1314 |
| 1482 | Ga0207676_10451412 | 3300026095 | Bacteria | 1212 |
| 1483 | Ga0207676_11729112 | 3300026095 | Unclassified | 624 |
| 1484 | Ga0207674_10011305 | 3300026116 | Bacteria | 10032 |
| 1485 | Ga0207674_10063694 | 3300026116 | Bacteria | 3721 |
| 1486 | Ga0207674_10126427 | 3300026116 | Unclassified | 2522 |
| 1487 | Ga0207674_10174928 | 3300026116 | Unclassified | 2099 |
| 1488 | Ga0207674_10290995 | 3300026116 | Bacteria | 1582 |
| 1489 | Ga0207674_10357158 | 3300026116 | Bacteria | 1412 |
| 1490 | Ga0207674_10616368 | 3300026116 | Unclassified | 1048 |
| 1491 | Ga0207674_10915189 | 3300026116 | Bacteria | 845 |
| 1492 | Ga0207674_11105617 | 3300026116 | Unclassified | 762 |
| 1493 | Ga0207674_11296713 | 3300026116 | Unclassified | 698 |
| 1494 | Ga0207675_100007458 | 3300026118 | Bacteria | 10336 |
| 1495 | Ga0207675_100027261 | 3300026118 | Bacteria | 5322 |
| 1496 | Ga0207675_100044713 | 3300026118 | Bacteria | 4139 |
| 1497 | Ga0207675_100047213 | 3300026118 | Bacteria | 4021 |
| 1498 | Ga0207675_100062218 | 3300026118 | Bacteria | 3485 |
| 1499 | Ga0207675_100168211 | 3300026118 | Bacteria | 2094 |
| 1500 | Ga0207675_100198545 | 3300026118 | Bacteria | 1926 |
| 1501 | Ga0207675_100264122 | 3300026118 | Bacteria | 1669 |
| 1502 | Ga0207675_100574034 | 3300026118 | Unclassified | 1129 |
| 1503 | Ga0207675_100800121 | 3300026118 | Bacteria | 956 |
| 1504 | Ga0207675_100823130 | 3300026118 | Bacteria | 943 |
| 1505 | Ga0207675_100884452 | 3300026118 | Unclassified | 909 |
| 1506 | Ga0207683_10027382 | 3300026121 | Bacteria | 4926 |
| 1507 | Ga0207683_10030281 | 3300026121 | Bacteria | 4689 |
| 1508 | Ga0207683_10060938 | 3300026121 | Bacteria | 3319 |
| 1509 | Ga0207683_10068018 | 3300026121 | Bacteria | 3143 |
| 1510 | Ga0207683_10072088 | 3300026121 | Bacteria | 3055 |
| 1511 | Ga0207683_10072297 | 3300026121 | Bacteria | 3050 |
| 1512 | Ga0207683_10304799 | 3300026121 | Bacteria | 1457 |
| 1513 | Ga0207683_10603825 | 3300026121 | Unclassified | 1016 |
| 1514 | Ga0207683_10632678 | 3300026121 | Bacteria | 991 |
| 1515 | Ga0207683_11464110 | 3300026121 | Bacteria | 631 |
| 1516 | Ga0207683_11794377 | 3300026121 | Bacteria | 563 |
| 1517 | Ga0207698_10100808 | 3300026142 | Bacteria | 2393 |
| 1518 | Ga0207698_10296234 | 3300026142 | Bacteria | 1504 |
| 1519 | Ga0207698_10340957 | 3300026142 | Bacteria | 1412 |
| 1520 | Ga0207698_10356775 | 3300026142 | Bacteria | 1383 |
| 1521 | Ga0207698_10440983 | 3300026142 | Bacteria | 1254 |
| 1522 | Ga0207698_10839256 | 3300026142 | Bacteria | 923 |
| 1523 | Ga0207698_11610148 | 3300026142 | Bacteria | 665 |
| 1524 | Ga0207698_12756877 | 3300026142 | Bacteria | 500 |
| 1525 | Ga0209973_1074617 | 3300027252 | Unclassified | 534 |
| 1526 | Ga0210000_1012023 | 3300027462 | Unclassified | 1285 |
| 1527 | Ga0210000_1072770 | 3300027462 | Bacteria | 561 |
| 1528 | Ga0209995_1025265 | 3300027471 | Unclassified | 990 |
| 1529 | Ga0209999_1037865 | 3300027543 | Unclassified | 902 |
| 1530 | Ga0209999_1096232 | 3300027543 | Unclassified | 575 |
| 1531 | Ga0210002_1025992 | 3300027617 | Bacteria | 959 |
| 1532 | Ga0210002_1057760 | 3300027617 | Unclassified | 675 |
| 1533 | Ga0209983_1037231 | 3300027665 | Bacteria | 1047 |
| 1534 | Ga0209588_1000056 | 3300027671 | Bacteria | 41939 |
| 1535 | Ga0209588_1054351 | 3300027671 | Bacteria | 1295 |
| 1536 | Ga0209971_1030092 | 3300027682 | Bacteria | 1300 |
| 1537 | Ga0209966_1052456 | 3300027695 | Bacteria | 869 |
| 1538 | Ga0209998_10023574 | 3300027717 | Bacteria | 1331 |
| 1539 | Ga0209998_10144345 | 3300027717 | Bacteria | 609 |
| 1540 | Ga0209974_10019791 | 3300027876 | Bacteria | 2231 |
| 1541 | Ga0209974_10023433 | 3300027876 | Bacteria | 2043 |
| 1542 | Ga0209974_10055621 | 3300027876 | Bacteria | 1335 |
| 1543 | Ga0209974_10096236 | 3300027876 | Bacteria | 1031 |
| 1544 | Ga0207428_10000145 | 3300027907 | Bacteria | 96603 |
| 1545 | Ga0207428_10001182 | 3300027907 | Bacteria | 28099 |
| 1546 | Ga0207428_10004699 | 3300027907 | Bacteria | 12930 |
| 1547 | Ga0207428_10115336 | 3300027907 | Bacteria | 2064 |
| 1548 | Ga0207428_10216097 | 3300027907 | Bacteria | 1439 |
| 1549 | Ga0207428_10247539 | 3300027907 | Bacteria | 1330 |
| 1550 | Ga0207428_10262440 | 3300027907 | Bacteria | 1286 |
| 1551 | Ga0207428_10296341 | 3300027907 | Bacteria | 1197 |
| 1552 | Ga0207428_10462231 | 3300027907 | Unclassified | 924 |
| 1553 | Ga0207428_10537799 | 3300027907 | Unclassified | 846 |
| 1554 | Ga0268266_10070586 | 3300028379 | Bacteria | 3027 |
| 1555 | Ga0268266_10104469 | 3300028379 | Bacteria | 2501 |
| 1556 | Ga0268266_10389395 | 3300028379 | Bacteria | 1316 |
| 1557 | Ga0268266_10720992 | 3300028379 | Bacteria | 962 |
| 1558 | Ga0268265_10025059 | 3300028380 | Bacteria | 4228 |
| 1559 | Ga0268265_10132618 | 3300028380 | Bacteria | 2073 |
| 1560 | Ga0268265_10168709 | 3300028380 | Unclassified | 1868 |
| 1561 | Ga0268265_10183110 | 3300028380 | Unclassified | 1802 |
| 1562 | Ga0268265_10228677 | 3300028380 | Unclassified | 1633 |
| 1563 | Ga0268265_10236050 | 3300028380 | Unclassified | 1610 |
| 1564 | Ga0268265_10267179 | 3300028380 | Bacteria | 1524 |
| 1565 | Ga0268265_10682809 | 3300028380 | Bacteria | 990 |
| 1566 | Ga0268265_10766813 | 3300028380 | Bacteria | 937 |
| 1567 | Ga0268265_10766927 | 3300028380 | Bacteria | 937 |
| 1568 | Ga0268265_10824037 | 3300028380 | Bacteria | 906 |
| 1569 | Ga0268265_11476895 | 3300028380 | Bacteria | 683 |
| 1570 | Ga0268265_11543202 | 3300028380 | Unclassified | 668 |
| 1571 | Ga0268265_11627981 | 3300028380 | Bacteria | 651 |
| 1572 | Ga0268264_10033632 | 3300028381 | Bacteria | 4214 |
| 1573 | Ga0268264_10069308 | 3300028381 | Bacteria | 2983 |
| 1574 | Ga0268264_10105770 | 3300028381 | Bacteria | 2455 |
| 1575 | Ga0268264_10155487 | 3300028381 | Bacteria | 2055 |
| 1576 | Ga0268264_10301829 | 3300028381 | Bacteria | 1508 |
| 1577 | Ga0268264_10390593 | 3300028381 | Bacteria | 1335 |
| 1578 | Ga0268264_10730107 | 3300028381 | Unclassified | 985 |
| 1579 | Ga0268264_10756336 | 3300028381 | Unclassified | 968 |
| 1580 | Ga0268264_11012984 | 3300028381 | Unclassified | 837 |
| 1581 | Ga0265760_10099524 | 3300031090 | Bacteria | 918 |
| 1582 | Ga0307408_100018434 | 3300031548 | Bacteria | 4686 |
| 1583 | Ga0307408_100022422 | 3300031548 | Bacteria | 4290 |
| 1584 | Ga0307408_100040916 | 3300031548 | Bacteria | 3284 |
| 1585 | Ga0307408_100060654 | 3300031548 | Bacteria | 2758 |
| 1586 | Ga0307408_100128001 | 3300031548 | Bacteria | 1977 |
| 1587 | Ga0307408_100155651 | 3300031548 | Unclassified | 1809 |
| 1588 | Ga0307408_100271349 | 3300031548 | Bacteria | 1408 |
| 1589 | Ga0307408_100533532 | 3300031548 | Bacteria | 1033 |
| 1590 | Ga0307408_100604161 | 3300031548 | Unclassified | 975 |
| 1591 | Ga0307408_100692153 | 3300031548 | Bacteria | 915 |
| 1592 | Ga0307408_100938590 | 3300031548 | Bacteria | 794 |
| 1593 | Ga0307408_101485769 | 3300031548 | Bacteria | 640 |
| 1594 | Ga0316579_10068235 | 3300031691 | Bacteria | 1681 |
| 1595 | Ga0316576_10020354 | 3300031727 | Unclassified | 4565 |
| 1596 | Ga0316576_10321802 | 3300031727 | Bacteria | 1153 |
| 1597 | Ga0316578_10009002 | 3300031728 | Bacteria | 5110 |
| 1598 | Ga0316578_10098604 | 3300031728 | Unclassified | 1750 |
| 1599 | Ga0307405_10004541 | 3300031731 | Bacteria | 6573 |
| 1600 | Ga0307405_10005212 | 3300031731 | Bacteria | 6243 |
| 1601 | Ga0307405_10025371 | 3300031731 | Bacteria | 3402 |
| 1602 | Ga0307405_10026646 | 3300031731 | Bacteria | 3338 |
| 1603 | Ga0307405_10037389 | 3300031731 | Unclassified | 2917 |
| 1604 | Ga0307405_10066098 | 3300031731 | Bacteria | 2304 |
| 1605 | Ga0307405_10113704 | 3300031731 | Unclassified | 1838 |
| 1606 | Ga0307405_10148239 | 3300031731 | Bacteria | 1646 |
| 1607 | Ga0307405_10168485 | 3300031731 | Bacteria | 1560 |
| 1608 | Ga0307405_10244599 | 3300031731 | Bacteria | 1331 |
| 1609 | Ga0307405_10399696 | 3300031731 | Bacteria | 1075 |
| 1610 | Ga0307405_11097520 | 3300031731 | Bacteria | 684 |
| 1611 | Ga0307405_11209323 | 3300031731 | Bacteria | 654 |
| 1612 | Ga0307405_11267971 | 3300031731 | Bacteria | 640 |
| 1613 | Ga0307405_11420203 | 3300031731 | Bacteria | 607 |
| 1614 | Ga0307405_11566132 | 3300031731 | Bacteria | 581 |
| 1615 | Ga0316577_10020084 | 3300031733 | Unclassified | 3702 |
| 1616 | Ga0316577_10130274 | 3300031733 | Bacteria | 1415 |
| 1617 | Ga0307413_10023575 | 3300031824 | Bacteria | 3337 |
| 1618 | Ga0307413_10062289 | 3300031824 | Bacteria | 2306 |
| 1619 | Ga0307413_10081365 | 3300031824 | Unclassified | 2076 |
| 1620 | Ga0307413_10147528 | 3300031824 | Bacteria | 1635 |
| 1621 | Ga0307413_10216100 | 3300031824 | Bacteria | 1396 |
| 1622 | Ga0307413_10447390 | 3300031824 | Bacteria | 1024 |
| 1623 | Ga0307413_10647620 | 3300031824 | Bacteria | 871 |
| 1624 | Ga0307413_11132004 | 3300031824 | Bacteria | 677 |
| 1625 | Ga0307413_11565089 | 3300031824 | Bacteria | 584 |
| 1626 | Ga0307413_11858290 | 3300031824 | Unclassified | 540 |
| 1627 | Ga0307410_10000307 | 3300031852 | Bacteria | 19138 |
| 1628 | Ga0307410_10000496 | 3300031852 | Bacteria | 16004 |
| 1629 | Ga0307410_10008471 | 3300031852 | Bacteria | 5703 |
| 1630 | Ga0307410_10008609 | 3300031852 | Bacteria | 5670 |
| 1631 | Ga0307410_10040853 | 3300031852 | Unclassified | 3055 |
| 1632 | Ga0307410_10041843 | 3300031852 | Bacteria | 3024 |
| 1633 | Ga0307410_10059115 | 3300031852 | Unclassified | 2616 |
| 1634 | Ga0307410_10071183 | 3300031852 | Bacteria | 2411 |
| 1635 | Ga0307410_10073086 | 3300031852 | Bacteria | 2383 |
| 1636 | Ga0307410_10131435 | 3300031852 | Unclassified | 1839 |
| 1637 | Ga0307410_10166674 | 3300031852 | Unclassified | 1656 |
| 1638 | Ga0307410_10176352 | 3300031852 | Unclassified | 1615 |
| 1639 | Ga0307410_10230645 | 3300031852 | Bacteria | 1429 |
| 1640 | Ga0307410_10317613 | 3300031852 | Bacteria | 1234 |
| 1641 | Ga0307410_10405950 | 3300031852 | Bacteria | 1102 |
| 1642 | Ga0307410_10467285 | 3300031852 | Bacteria | 1032 |
| 1643 | Ga0307410_10630759 | 3300031852 | Bacteria | 897 |
| 1644 | Ga0307406_10004596 | 3300031901 | Bacteria | 7513 |
| 1645 | Ga0307406_10015426 | 3300031901 | Bacteria | 4421 |
| 1646 | Ga0307406_10019042 | 3300031901 | Bacteria | 4024 |
| 1647 | Ga0307406_10026228 | 3300031901 | Bacteria | 3497 |
| 1648 | Ga0307406_10026663 | 3300031901 | Bacteria | 3473 |
| 1649 | Ga0307406_10046155 | 3300031901 | Unclassified | 2740 |
| 1650 | Ga0307406_10084331 | 3300031901 | Bacteria | 2121 |
| 1651 | Ga0307406_10173551 | 3300031901 | Bacteria | 1563 |
| 1652 | Ga0307406_10178237 | 3300031901 | Bacteria | 1545 |
| 1653 | Ga0307406_10262378 | 3300031901 | Unclassified | 1307 |
| 1654 | Ga0307406_10457333 | 3300031901 | Bacteria | 1025 |
| 1655 | Ga0307406_10589796 | 3300031901 | Bacteria | 915 |
| 1656 | Ga0307406_10601396 | 3300031901 | Bacteria | 907 |
| 1657 | Ga0307407_10001077 | 3300031903 | Bacteria | 9485 |
| 1658 | Ga0307407_10004826 | 3300031903 | Bacteria | 5778 |
| 1659 | Ga0307407_10012768 | 3300031903 | Bacteria | 4052 |
| 1660 | Ga0307407_10014268 | 3300031903 | Bacteria | 3885 |
| 1661 | Ga0307407_10015136 | 3300031903 | Bacteria | 3801 |
| 1662 | Ga0307407_10061360 | 3300031903 | Bacteria | 2197 |
| 1663 | Ga0307407_10085926 | 3300031903 | Unclassified | 1915 |
| 1664 | Ga0307407_10185836 | 3300031903 | Bacteria | 1381 |
| 1665 | Ga0307407_10206144 | 3300031903 | Bacteria | 1321 |
| 1666 | Ga0307407_10346251 | 3300031903 | Bacteria | 1051 |
| 1667 | Ga0307407_10388036 | 3300031903 | Bacteria | 999 |
| 1668 | Ga0307407_10881278 | 3300031903 | Unclassified | 686 |
| 1669 | Ga0307412_10013099 | 3300031911 | Bacteria | 4852 |
| 1670 | Ga0307412_10023664 | 3300031911 | Bacteria | 3782 |
| 1671 | Ga0307412_10040994 | 3300031911 | Bacteria | 2998 |
| 1672 | Ga0307412_10043777 | 3300031911 | Bacteria | 2918 |
| 1673 | Ga0307412_10057923 | 3300031911 | Bacteria | 2589 |
| 1674 | Ga0307412_10087097 | 3300031911 | Bacteria | 2175 |
| 1675 | Ga0307412_10595858 | 3300031911 | Bacteria | 935 |
| 1676 | Ga0307412_11046686 | 3300031911 | Bacteria | 723 |
| 1677 | Ga0307412_11372912 | 3300031911 | Unclassified | 638 |
| 1678 | Ga0307409_100001975 | 3300031995 | Bacteria | 10509 |
| 1679 | Ga0307409_100004653 | 3300031995 | Bacteria | 7754 |
| 1680 | Ga0307409_100006880 | 3300031995 | Bacteria | 6740 |
| 1681 | Ga0307409_100008181 | 3300031995 | Bacteria | 6325 |
| 1682 | Ga0307409_100010352 | 3300031995 | Bacteria | 5793 |
| 1683 | Ga0307409_100012553 | 3300031995 | Bacteria | 5405 |
| 1684 | Ga0307409_100022195 | 3300031995 | Bacteria | 4369 |
| 1685 | Ga0307409_100026827 | 3300031995 | Bacteria | 4071 |
| 1686 | Ga0307409_100031536 | 3300031995 | Bacteria | 3827 |
| 1687 | Ga0307409_100060369 | 3300031995 | Bacteria | 2957 |
| 1688 | Ga0307409_100071029 | 3300031995 | Bacteria | 2766 |
| 1689 | Ga0307409_100237118 | 3300031995 | Unclassified | 1658 |
| 1690 | Ga0307409_100309992 | 3300031995 | Bacteria | 1472 |
| 1691 | Ga0307409_100422600 | 3300031995 | Bacteria | 1279 |
| 1692 | Ga0307409_100444613 | 3300031995 | Bacteria | 1250 |
| 1693 | Ga0307409_100453485 | 3300031995 | Unclassified | 1238 |
| 1694 | Ga0307409_100465044 | 3300031995 | Unclassified | 1224 |
| 1695 | Ga0307409_100591174 | 3300031995 | Unclassified | 1096 |
| 1696 | Ga0307409_100733291 | 3300031995 | Bacteria | 990 |
| 1697 | Ga0307409_100868054 | 3300031995 | Unclassified | 914 |
| 1698 | Ga0307416_100000301 | 3300032002 | Bacteria | 25445 |
| 1699 | Ga0307416_100000547 | 3300032002 | Bacteria | 19149 |
| 1700 | Ga0307416_100004673 | 3300032002 | Bacteria | 8287 |
| 1701 | Ga0307416_100008092 | 3300032002 | Bacteria | 6745 |
| 1702 | Ga0307416_100009818 | 3300032002 | Bacteria | 6292 |
| 1703 | Ga0307416_100027663 | 3300032002 | Bacteria | 4203 |
| 1704 | Ga0307416_100038126 | 3300032002 | Bacteria | 3705 |
| 1705 | Ga0307416_100047123 | 3300032002 | Unclassified | 3408 |
| 1706 | Ga0307416_100108198 | 3300032002 | Bacteria | 2442 |
| 1707 | Ga0307416_100183783 | 3300032002 | Bacteria | 1962 |
| 1708 | Ga0307416_100190125 | 3300032002 | Unclassified | 1935 |
| 1709 | Ga0307416_100210276 | 3300032002 | Bacteria | 1855 |
| 1710 | Ga0307416_100215876 | 3300032002 | Bacteria | 1835 |
| 1711 | Ga0307416_100406598 | 3300032002 | Unclassified | 1401 |
| 1712 | Ga0307416_100483270 | 3300032002 | Bacteria | 1299 |
| 1713 | Ga0307416_100568648 | 3300032002 | Bacteria | 1209 |
| 1714 | Ga0307416_100570571 | 3300032002 | Bacteria | 1207 |
| 1715 | Ga0307416_101023857 | 3300032002 | Unclassified | 929 |
| 1716 | Ga0307416_101225321 | 3300032002 | Bacteria | 856 |
| 1717 | Ga0307416_101566843 | 3300032002 | Bacteria | 764 |
| 1718 | Ga0307416_101732448 | 3300032002 | Bacteria | 729 |
| 1719 | Ga0307416_103137529 | 3300032002 | Bacteria | 553 |
| 1720 | Ga0307414_10002345 | 3300032004 | Bacteria | 9895 |
| 1721 | Ga0307414_10031627 | 3300032004 | Bacteria | 3474 |
| 1722 | Ga0307414_10039801 | 3300032004 | Bacteria | 3169 |
| 1723 | Ga0307414_10061464 | 3300032004 | Unclassified | 2661 |
| 1724 | Ga0307414_10082711 | 3300032004 | Bacteria | 2355 |
| 1725 | Ga0307414_10086510 | 3300032004 | Bacteria | 2313 |
| 1726 | Ga0307414_10113187 | 3300032004 | Bacteria | 2071 |
| 1727 | Ga0307414_10190151 | 3300032004 | Bacteria | 1660 |
| 1728 | Ga0307414_10298256 | 3300032004 | Unclassified | 1362 |
| 1729 | Ga0307414_10372958 | 3300032004 | Bacteria | 1231 |
| 1730 | Ga0307414_10950300 | 3300032004 | Unclassified | 790 |
| 1731 | Ga0307414_11918610 | 3300032004 | Unclassified | 553 |
| 1732 | Ga0307411_10000678 | 3300032005 | Bacteria | 12484 |
| 1733 | Ga0307411_10004614 | 3300032005 | Bacteria | 6631 |
| 1734 | Ga0307411_10006364 | 3300032005 | Bacteria | 5904 |
| 1735 | Ga0307411_10023903 | 3300032005 | Bacteria | 3632 |
| 1736 | Ga0307411_10042142 | 3300032005 | Unclassified | 2910 |
| 1737 | Ga0307411_10079019 | 3300032005 | Bacteria | 2257 |
| 1738 | Ga0307411_10122529 | 3300032005 | Bacteria | 1884 |
| 1739 | Ga0307411_10123940 | 3300032005 | Bacteria | 1875 |
| 1740 | Ga0307411_10142965 | 3300032005 | Bacteria | 1766 |
| 1741 | Ga0307411_10182459 | 3300032005 | Bacteria | 1594 |
| 1742 | Ga0307411_10443945 | 3300032005 | Unclassified | 1083 |
| 1743 | Ga0307411_10449795 | 3300032005 | Bacteria | 1077 |
| 1744 | Ga0307411_10649336 | 3300032005 | Bacteria | 913 |
| 1745 | Ga0307411_11832403 | 3300032005 | Bacteria | 564 |
| 1746 | Ga0307411_12243655 | 3300032005 | Unclassified | 512 |
| 1747 | Ga0307415_100002962 | 3300032126 | Bacteria | 8531 |
| 1748 | Ga0307415_100004118 | 3300032126 | Bacteria | 7498 |
| 1749 | Ga0307415_100010642 | 3300032126 | Bacteria | 5218 |
| 1750 | Ga0307415_100028989 | 3300032126 | Bacteria | 3531 |
| 1751 | Ga0307415_100036961 | 3300032126 | Bacteria | 3206 |
| 1752 | Ga0307415_100097657 | 3300032126 | Unclassified | 2145 |
| 1753 | Ga0307415_100129104 | 3300032126 | Bacteria | 1910 |
| 1754 | Ga0307415_100130485 | 3300032126 | Bacteria | 1901 |
| 1755 | Ga0307415_100215353 | 3300032126 | Bacteria | 1535 |
| 1756 | Ga0307415_100233706 | 3300032126 | Unclassified | 1482 |
| 1757 | Ga0307415_100337486 | 3300032126 | Unclassified | 1263 |
| 1758 | Ga0307415_100480261 | 3300032126 | Bacteria | 1082 |
| 1759 | Ga0307415_100482765 | 3300032126 | Bacteria | 1079 |
| 1760 | Ga0307415_100500788 | 3300032126 | Bacteria | 1062 |
| 1761 | Ga0307415_102507753 | 3300032126 | Unclassified | 508 |
| 1762 | Ga0316583_10043713 | 3300032133 | Bacteria | 1583 |
| 1763 | Ga0316585_10072636 | 3300032137 | Bacteria | 1117 |
| 1764 | Ga0316580_10050237 | 3300032139 | Unclassified | 1285 |
| 1765 | Ga0316580_10050511 | 3300032139 | Bacteria | 1281 |
| 1766 | Ga0316592_1020238 | 3300033524 | Bacteria | 1412 |
| 1767 | Ga0316592_1121437 | 3300033524 | Unclassified | 607 |
| 1768 | Ga0316586_1011327 | 3300033527 | Bacteria | 1365 |
| 1769 | Ga0316588_1025317 | 3300033528 | Bacteria | 1370 |
| 1770 | Ga0316588_1071865 | 3300033528 | Bacteria | 851 |
| 1771 | Ga0316596_1000579 | 3300033541 | Bacteria | 6414 |
| 1772 | Ga0373930_0000502 | 3300034816 | Bacteria | 5354 |
| 1773 | Ga0373948_0028349 | 3300034817 | Bacteria | 1114 |
| 1774 | Ga0373948_0057710 | 3300034817 | Bacteria | 847 |
| 1775 | Ga0373950_0000257 | 3300034818 | Bacteria | 6746 |
| 1776 | Ga0373958_0021368 | 3300034819 | Bacteria | 1200 |
| 1777 | Ga0373958_0076427 | 3300034819 | Bacteria | 752 |
| 1778 | Ga0373959_0001619 | 3300034820 | Bacteria | 3579 |
| 1779 | Ga0373959_0139092 | 3300034820 | Bacteria | 606 |
| 1780 | Ga0373959_0170995 | 3300034820 | Unclassified | 560 |
| 1781 | Ga0373928_0012159 | 3300035084 | Bacteria | 1713 |
| 1782 | Ga0373928_0032887 | 3300035084 | Bacteria | 1158 |
| 1783 | Ga0373928_0145627 | 3300035084 | Bacteria | 652 |
| 1784 | Ga0373929_0002346 | 3300035085 | Bacteria | 3479 |
| 1785 | Ga0373940_0014920 | 3300035088 | Bacteria | 1903 |
| 1786 | Ga0373940_0019643 | 3300035088 | Bacteria | 1709 |
| 1787 | Ga0373940_0033061 | 3300035088 | Bacteria | 1390 |
| 1788 | Ga0373940_0073925 | 3300035088 | Bacteria | 997 |
| 1789 | Ga0373949_0001484 | 3300035090 | Bacteria | 6689 |
| 1790 | Ga0373949_0032741 | 3300035090 | Bacteria | 1246 |
| 1791 | Ga0373951_0000863 | 3300035091 | Bacteria | 8198 |
| 1792 | Ga0373951_0172954 | 3300035091 | Bacteria | 617 |
| 1793 | Ga0373951_0195226 | 3300035091 | Bacteria | 587 |
| 1794 | Ga0373951_0291502 | 3300035091 | Bacteria | 501 |
| 1795 | Ga0373952_0000941 | 3300035092 | Bacteria | 5284 |
| 1796 | Ga0373952_0143647 | 3300035092 | Bacteria | 665 |
| 1797 | Ga0373923_0070100 | 3300035111 | Bacteria | 1504 |
| 1798 | Ga0373932_0002685 | 3300035112 | Bacteria | 4425 |
| 1799 | Ga0373936_0156589 | 3300035113 | Bacteria | 990 |
| 1800 | Ga0373936_0631444 | 3300035113 | Bacteria | 504 |
| 1801 | Ga0373939_0000955 | 3300035114 | Bacteria | 7206 |
| 1802 | Ga0373939_0289672 | 3300035114 | Bacteria | 649 |
| 1803 | Ga0373941_0000416 | 3300035115 | Bacteria | 8459 |
| 1804 | Ga0373941_0046536 | 3300035115 | Bacteria | 1363 |
| 1805 | Ga0373941_0409202 | 3300035115 | Bacteria | 562 |
| 1806 | Ga0373953_0280197 | 3300035117 | Bacteria | 726 |
| 1807 | Ga0373953_0525159 | 3300035117 | Bacteria | 525 |
| 1808 | Ga0373954_0194852 | 3300035118 | Bacteria | 995 |
| 1809 | Ga0373956_0052915 | 3300035119 | Unclassified | 1827 |
| 1810 | Ga0373956_0216868 | 3300035119 | Bacteria | 908 |
| 1811 | Ga0373960_0001972 | 3300035121 | Bacteria | 4600 |
| 1812 | Ga0373960_0111265 | 3300035121 | Bacteria | 899 |
| 1813 | Ga0373960_0132087 | 3300035121 | Bacteria | 838 |
| 1814 | Ga0373960_0379874 | 3300035121 | Bacteria | 541 |
| 1815 | Ga0373943_0027049 | 3300035170 | Unclassified | 2692 |
| 1816 | Ga0373943_0111231 | 3300035170 | Bacteria | 1445 |
| 1817 | Ga0373955_0033008 | 3300035172 | Bacteria | 2723 |
| 1818 | Ga0373955_0258639 | 3300035172 | Bacteria | 1045 |
| 1819 | Ga0373955_0346012 | 3300035172 | Unclassified | 900 |
| 1820 | Ga0373955_0389046 | 3300035172 | Bacteria | 847 |
| 1821 | Ga0373942_0000646 | 3300035207 | Bacteria | 9758 |
| 1822 | Ga0373961_0001109 | 3300035241 | Bacteria | 8499 |
| 1823 | Ga0373961_0013630 | 3300035241 | Bacteria | 2053 |
| 1824 | Ga0373961_0020541 | 3300035241 | Bacteria | 1748 |
| 1825 | Ga0373961_0057864 | 3300035241 | Bacteria | 1168 |
| 1826 | Ga0373961_0090345 | 3300035241 | Bacteria | 977 |
| 1827 | Ga0373961_0164621 | 3300035241 | Bacteria | 764 |
| 1828 | Ga0373962_0008999 | 3300035242 | Bacteria | 2465 |
| 1829 | Ga0373962_0032408 | 3300035242 | Bacteria | 1437 |
| 1830 | Ga0316574_0069547 | 3300035398 | Unclassified | 2222 |
| 1831 | Ga0316574_0227298 | 3300035398 | Bacteria | 1194 |
| 1832 | Ga0373924_0007968 | 3300035410 | Bacteria | 3835 |
| 1833 | Ga0373924_0060596 | 3300035410 | Bacteria | 1582 |
| 1834 | Ga0373931_0003553 | 3300035691 | Bacteria | 7029 |
| 1835 | Ga0373931_0007754 | 3300035691 | Bacteria | 5069 |
| 1836 | Ga0373931_0532287 | 3300035691 | Bacteria | 761 |
| 1837 | Ga0373931_0975739 | 3300035691 | Bacteria | 572 |
| 1838 | Ga0373931_1223573 | 3300035691 | Unclassified | 515 |
| 1839 | Ga0373935_0016403 | 3300035692 | Bacteria | 4481 |
| 1840 | Ga0373933_0499490 | 3300035724 | Bacteria | 797 |
| 1841 | Ga0373947_0032817 | 3300035725 | Bacteria | 3062 |
| 1842 | Ga0373947_1233867 | 3300035725 | Bacteria | 509 |
| 1843 | Ga0373937_0501500 | 3300036401 | Bacteria | 1153 |
| 1844 | Ga0373937_1347734 | 3300036401 | Bacteria | 661 |
| 1845 | Ga0373937_1579293 | 3300036401 | Bacteria | 603 |
| 1846 | Ga0316582_0111879 | 3300036647 | Bacteria | 1818 |
| 1847 | Ga0316584_0018602 | 3300036712 | Bacteria | 5013 |
| 1848 | Ga0316584_0029321 | 3300036712 | Unclassified | 4061 |
| 1849 | Ga0373925_0007543 | 3300037068 | Bacteria | 7927 |
| 1850 | Ga0373925_0380924 | 3300037068 | Bacteria | 1149 |
| 1851 | Ga0373925_1418243 | 3300037068 | Unclassified | 569 |
| 1852 | Ga0395900_0911398 | 3300037418 | Bacteria | 802 |
| 1853 | Ga0395905_0022010 | 3300037471 | Bacteria | 6031 |
| 1854 | Ga0395905_0124711 | 3300037471 | Bacteria | 2422 |
| 1855 | Ga0395905_0607717 | 3300037471 | Unclassified | 995 |
| 1856 | Ga0316581_0011219 | 3300037588 | Bacteria | 2501 |
| 1857 | Ga0242420_000338 | 3300038996 | Bacteria | 5215 |
| 1858 | Ga0242420_010894 | 3300038996 | Bacteria | 1517 |
| 1859 | Ga0242420_022802 | 3300038996 | Bacteria | 1127 |
| 1860 | Ga0242420_059230 | 3300038996 | Bacteria | 761 |
| 1861 | Ga0439453_0123914 | 3300041408 | Bacteria | 595 |
| 1862 | Ga0439453_0126300 | 3300041408 | Bacteria | 590 |
| 1863 | Ga0439461_0035822 | 3300041410 | Bacteria | 1054 |
| 1864 | Ga0439461_0141873 | 3300041410 | Bacteria | 615 |
| 1865 | Ga0451800_1156250 | 3300041459 | Bacteria | 686 |
| 1866 | Ga0451853_2096646 | 3300041512 | Bacteria | 1002 |
| 1867 | Ga0451853_3590826 | 3300041512 | Bacteria | 908 |
| 1868 | Ga0439433_0108600 | 3300041999 | Bacteria | 693 |
| 1869 | Ga0439437_054421 | 3300042000 | Bacteria | 536 |
| 1870 | Ga0439443_061431 | 3300042003 | Bacteria | 673 |
| 1871 | Ga0439445_0058744 | 3300042004 | Bacteria | 1049 |
| 1872 | Ga0439448_0031978 | 3300042005 | Unclassified | 1673 |
| 1873 | Ga0439449_0320252 | 3300042007 | Bacteria | 586 |
| 1874 | Ga0450890_017760 | 3300042127 | Bacteria | 948 |
| 1875 | Ga0450892_003125 | 3300042130 | Bacteria | 1375 |
| 1876 | Ga0450894_042307 | 3300042131 | Bacteria | 656 |
| 1877 | Ga0439446_0120578 | 3300042156 | Bacteria | 844 |
| 1878 | Ga0439446_0161527 | 3300042156 | Bacteria | 741 |
| 1879 | Ga0439446_0227446 | 3300042156 | Bacteria | 637 |
| 1880 | Ga0439434_0273475 | 3300042435 | Bacteria | 581 |
| 1881 | Ga0439435_0062660 | 3300042436 | Bacteria | 1086 |
| 1882 | Ga0439435_0096037 | 3300042436 | Unclassified | 906 |
| 1883 | Ga0439435_0185635 | 3300042436 | Bacteria | 681 |
| 1884 | Ga0439444_0052429 | 3300042437 | Unclassified | 833 |
| 1885 | Ga0439444_0161545 | 3300042437 | Unclassified | 547 |
| 1886 | Ga0439460_0125294 | 3300042461 | Unclassified | 843 |
| 1887 | Ga0439460_0230773 | 3300042461 | Bacteria | 636 |
| 1888 | Ga0450916_090056 | 3300042530 | Bacteria | 533 |
| 1889 | Ga0451577_0272475 | 3300042876 | Bacteria | 1533 |
| 1890 | Ga0453683_0012827 | 3300044673 | Bacteria | 5484 |
| 1891 | Ga0466963_0758982 | 3300044694 | Bacteria | 684 |
| 1892 | Ga0466964_0780489 | 3300044706 | Bacteria | 538 |
| 1893 | Ga0466971_0330826 | 3300044719 | Bacteria | 735 |
| 1894 | Ga0466957_0261605 | 3300044842 | Bacteria | 1153 |
| 1895 | Ga0466959_0912624 | 3300045049 | Bacteria | 586 |
| 1896 | Ga0451576_0014237 | 3300045051 | Bacteria | 8862 |
| 1897 | Ga0451576_0014722 | 3300045051 | Bacteria | 8696 |
| 1898 | Ga0451576_0042564 | 3300045051 | Unclassified | 4794 |
| 1899 | Ga0451576_0063120 | 3300045051 | Bacteria | 3861 |
| 1900 | Ga0451576_0167079 | 3300045051 | Bacteria | 2296 |
| 1901 | Ga0451576_0295536 | 3300045051 | Bacteria | 1693 |
| 1902 | Ga0451576_0753265 | 3300045051 | Bacteria | 1023 |
| 1903 | Ga0451576_0760017 | 3300045051 | Bacteria | 1018 |
| 1904 | Ga0451576_0959744 | 3300045051 | Bacteria | 896 |
| 1905 | Ga0451576_2482557 | 3300045051 | Bacteria | 529 |
| 1906 | Ga0466958_0125667 | 3300045836 | Bacteria | 1608 |
| 1907 | Ga0466967_1806805 | 3300045976 | Unclassified | 608 |
| 1908 | Ga0466967_2212105 | 3300045976 | Unclassified | 546 |
| 1909 | Ga0495592_0113233 | 3300046454 | Bacteria | 1917 |
| 1910 | Ga0495603_0217060 | 3300046455 | Bacteria | 1104 |
| 1911 | Ga0495629_0113019 | 3300046459 | Bacteria | 1893 |
| 1912 | Ga0495629_0448152 | 3300046459 | Bacteria | 874 |
| 1913 | Ga0495651_0210454 | 3300046462 | Bacteria | 1354 |
| 1914 | Ga0495653_0317956 | 3300046463 | Bacteria | 1010 |
| 1915 | Ga0495580_0028437 | 3300046472 | Bacteria | 4063 |
| 1916 | Ga0495582_0606491 | 3300046473 | Bacteria | 633 |
| 1917 | Ga0495639_0181686 | 3300046475 | Bacteria | 1024 |
| 1918 | Ga0495639_0619612 | 3300046475 | Bacteria | 557 |
| 1919 | Ga0495664_0208517 | 3300046477 | Bacteria | 1184 |
| 1920 | Ga0495584_0609398 | 3300046491 | Bacteria | 557 |
| 1921 | Ga0495585_0626184 | 3300046492 | Unclassified | 505 |
| 1922 | Ga0495594_0184204 | 3300046499 | Bacteria | 1189 |
| 1923 | Ga0495594_0494135 | 3300046499 | Bacteria | 695 |
| 1924 | Ga0495608_0001637 | 3300046511 | Bacteria | 16083 |
| 1925 | Ga0495618_0131565 | 3300046514 | Bacteria | 1601 |
| 1926 | Ga0495628_0014871 | 3300046516 | Bacteria | 6508 |
| 1927 | Ga0495630_0003056 | 3300046517 | Bacteria | 11600 |
| 1928 | Ga0495652_0060495 | 3300046529 | Bacteria | 3201 |
| 1929 | Ga0495640_0639495 | 3300046533 | Bacteria | 641 |
| 1930 | Ga0495640_0971444 | 3300046533 | Unclassified | 501 |
| 1931 | Ga0495586_0169829 | 3300046535 | Bacteria | 1232 |
| 1932 | Ga0495587_0022813 | 3300046536 | Bacteria | 3851 |
| 1933 | Ga0495598_0013933 | 3300046537 | Bacteria | 2003 |
| 1934 | Ga0495598_0110356 | 3300046537 | Bacteria | 921 |
| 1935 | Ga0495621_0435016 | 3300046539 | Unclassified | 560 |
| 1936 | Ga0495645_0049219 | 3300046543 | Bacteria | 3069 |
| 1937 | Ga0495633_0535138 | 3300046558 | Bacteria | 528 |
| 1938 | Ga0495667_0062506 | 3300046559 | Bacteria | 2440 |
| 1939 | Ga0495656_0078774 | 3300046615 | Bacteria | 1482 |
| 1940 | Ga0495656_0132195 | 3300046615 | Bacteria | 1189 |
| 1941 | Ga0495656_0476445 | 3300046615 | Bacteria | 660 |
| 1942 | Ga0495634_0054123 | 3300046642 | Bacteria | 2687 |
| 1943 | Ga0495634_0056489 | 3300046642 | Bacteria | 2622 |
| 1944 | Ga0495635_0255839 | 3300046663 | Bacteria | 1180 |
| 1945 | Ga0495635_1006766 | 3300046663 | Bacteria | 530 |
| 1946 | Ga0495659_0157520 | 3300046664 | Bacteria | 915 |
| 1947 | Ga0495659_0176411 | 3300046664 | Bacteria | 869 |
| 1948 | Ga0495588_0040517 | 3300046674 | Unclassified | 2376 |
| 1949 | Ga0495588_0182840 | 3300046674 | Bacteria | 1108 |
| 1950 | Ga0495647_0070998 | 3300046681 | Bacteria | 1394 |
| 1951 | Ga0495647_0116464 | 3300046681 | Bacteria | 1120 |
| 1952 | Ga0495647_0284728 | 3300046681 | Unclassified | 742 |
| 1953 | Ga0495647_0637581 | 3300046681 | Unclassified | 501 |
| 1954 | Ga0495658_0103609 | 3300046683 | Bacteria | 1702 |
| 1955 | Ga0495658_0148170 | 3300046683 | Unclassified | 1440 |
| 1956 | Ga0495658_0237058 | 3300046683 | Bacteria | 1145 |
| 1957 | Ga0495658_0804381 | 3300046683 | Unclassified | 602 |
| 1958 | Ga0495669_0004726 | 3300046684 | Bacteria | 5648 |
| 1959 | Ga0495613_0000660 | 3300046689 | Bacteria | 27311 |
| 1960 | Ga0495613_0652193 | 3300046689 | Bacteria | 696 |
| 1961 | Ga0495670_0263482 | 3300046691 | Bacteria | 920 |
| 1962 | Ga0495670_0421527 | 3300046691 | Bacteria | 722 |
| 1963 | Ga0495670_0742340 | 3300046691 | Bacteria | 535 |
| 1964 | Ga0495600_0072829 | 3300046809 | Bacteria | 2244 |
| 1965 | Ga0495581_0087255 | 3300047315 | Bacteria | 1809 |
| 1966 | Ga0495604_0016487 | 3300047317 | Bacteria | 5907 |
| 1967 | Ga0495604_0267245 | 3300047317 | Bacteria | 1160 |
| 1968 | Ga0495636_0320035 | 3300047318 | Bacteria | 728 |
| 1969 | Ga0495674_0016565 | 3300047319 | Bacteria | 6879 |
| 1970 | Ga0495674_0820829 | 3300047319 | Unclassified | 722 |
| 1971 | Ga0495674_1458071 | 3300047319 | Bacteria | 508 |
| 1972 | Ga0495684_0000093 | 3300047471 | Bacteria | 63048 |
| 1973 | Ga0495684_0577360 | 3300047471 | Bacteria | 762 |
| 1974 | Ga0495684_0935546 | 3300047471 | Bacteria | 555 |
| 1975 | Ga0495615_0041022 | 3300048090 | Bacteria | 1155 |
| 1976 | Ga0496100_0011330 | 3300048903 | Bacteria | 5074 |
| 1977 | Ga0496100_0096766 | 3300048903 | Bacteria | 2026 |
| 1978 | Ga0496101_0000386 | 3300048904 | Bacteria | 29088 |
| 1979 | Ga0496101_0269432 | 3300048904 | Bacteria | 1329 |
| 1980 | Ga0496102_0039987 | 3300048905 | Bacteria | 4240 |
| 1981 | Ga0496102_0046742 | 3300048905 | Bacteria | 3932 |
| 1982 | Ga0496102_0088959 | 3300048905 | Unclassified | 2856 |
| 1983 | Ga0496102_0190034 | 3300048905 | Bacteria | 1935 |
| 1984 | Ga0496102_0193086 | 3300048905 | Bacteria | 1919 |
| 1985 | Ga0496102_0412738 | 3300048905 | Bacteria | 1268 |
| 1986 | Ga0496102_0415166 | 3300048905 | Bacteria | 1264 |
| 1987 | Ga0496102_0451226 | 3300048905 | Unclassified | 1206 |
| 1988 | Ga0496102_0544112 | 3300048905 | Bacteria | 1084 |
| 1989 | Ga0496102_1428731 | 3300048905 | Bacteria | 611 |
| 1990 | Ga0496102_1450889 | 3300048905 | Bacteria | 605 |
| 1991 | Ga0496102_1499049 | 3300048905 | Bacteria | 593 |
| 1992 | Ga0496103_0002555 | 3300048906 | Bacteria | 11405 |
| 1993 | Ga0496103_0023679 | 3300048906 | Bacteria | 3704 |
| 1994 | Ga0496103_0414870 | 3300048906 | Unclassified | 864 |
| 1995 | Ga0496103_0540433 | 3300048906 | Unclassified | 744 |
| 1996 | Ga0496104_0001703 | 3300048907 | Bacteria | 18985 |
| 1997 | Ga0496104_0014766 | 3300048907 | Bacteria | 7058 |
| 1998 | Ga0496104_0034749 | 3300048907 | Bacteria | 4702 |
| 1999 | Ga0496104_0059644 | 3300048907 | Bacteria | 3612 |
| 2000 | Ga0496104_0264350 | 3300048907 | Unclassified | 1633 |
| 2001 | Ga0496104_0709796 | 3300048907 | Unclassified | 913 |
| 2002 | Ga0496104_0715657 | 3300048907 | Bacteria | 909 |
| 2003 | Ga0496104_1090698 | 3300048907 | Bacteria | 702 |
| 2004 | Ga0496105_0046856 | 3300048908 | Bacteria | 3568 |
| 2005 | Ga0496105_0422029 | 3300048908 | Bacteria | 1056 |
| 2006 | Ga0496105_0494527 | 3300048908 | Bacteria | 961 |
| 2007 | Ga0496106_0030890 | 3300048909 | Bacteria | 3994 |
| 2008 | Ga0496106_0033151 | 3300048909 | Bacteria | 3853 |
| 2009 | Ga0496106_0043997 | 3300048909 | Bacteria | 3352 |
| 2010 | Ga0496106_0107087 | 3300048909 | Bacteria | 2174 |
| 2011 | Ga0496106_0163995 | 3300048909 | Unclassified | 1758 |
| 2012 | Ga0496106_0181710 | 3300048909 | Bacteria | 1670 |
| 2013 | Ga0496106_0629225 | 3300048909 | Bacteria | 858 |
| 2014 | Ga0496106_0820648 | 3300048909 | Bacteria | 737 |
| 2015 | Ga0496106_0852035 | 3300048909 | Bacteria | 721 |
| 2016 | Ga0496106_0950143 | 3300048909 | Bacteria | 677 |
| 2017 | Ga0496107_0069624 | 3300048910 | Bacteria | 2554 |
| 2018 | Ga0496107_0860531 | 3300048910 | Bacteria | 662 |
| 2019 | Ga0496107_1326923 | 3300048910 | Bacteria | 514 |
| 2020 | Ga0496108_0000426 | 3300048911 | Bacteria | 34037 |
| 2021 | Ga0496108_0001436 | 3300048911 | Bacteria | 18814 |
| 2022 | Ga0496108_0010988 | 3300048911 | Bacteria | 7353 |
| 2023 | Ga0496108_0053819 | 3300048911 | Bacteria | 3376 |
| 2024 | Ga0496108_1253256 | 3300048911 | Bacteria | 625 |
| 2025 | Ga0496109_0000596 | 3300048912 | Bacteria | 30229 |
| 2026 | Ga0496109_0012088 | 3300048912 | Bacteria | 7440 |
| 2027 | Ga0496109_0012820 | 3300048912 | Bacteria | 7245 |
| 2028 | Ga0496109_0059262 | 3300048912 | Bacteria | 3497 |
| 2029 | Ga0496109_0211109 | 3300048912 | Bacteria | 1826 |
| 2030 | Ga0496109_0256512 | 3300048912 | Bacteria | 1647 |
| 2031 | Ga0496109_0539617 | 3300048912 | Bacteria | 1100 |
| 2032 | Ga0496109_0900039 | 3300048912 | Bacteria | 823 |
| 2033 | Ga0496109_1389878 | 3300048912 | Bacteria | 637 |
| 2034 | Ga0496109_2063575 | 3300048912 | Bacteria | 502 |
| 2035 | Ga0496110_0005269 | 3300048913 | Bacteria | 10120 |
| 2036 | Ga0496110_0007351 | 3300048913 | Bacteria | 8794 |
| 2037 | Ga0496110_0013891 | 3300048913 | Bacteria | 6671 |
| 2038 | Ga0496110_0905282 | 3300048913 | Unclassified | 788 |
| 2039 | Ga0496110_0962075 | 3300048913 | Bacteria | 761 |
| 2040 | Ga0496111_0008529 | 3300048914 | Bacteria | 6790 |
| 2041 | Ga0496111_0018021 | 3300048914 | Bacteria | 4885 |
| 2042 | Ga0496111_0038776 | 3300048914 | Bacteria | 3414 |
| 2043 | Ga0496111_0084476 | 3300048914 | Bacteria | 2320 |
| 2044 | Ga0496111_0375334 | 3300048914 | Bacteria | 1052 |
| 2045 | Ga0496111_0654838 | 3300048914 | Bacteria | 766 |
| 2046 | Ga0496112_0013329 | 3300048915 | Bacteria | 7587 |
| 2047 | Ga0496112_0015487 | 3300048915 | Bacteria | 7118 |
| 2048 | Ga0496112_0021767 | 3300048915 | Bacteria | 6100 |
| 2049 | Ga0496112_0024657 | 3300048915 | Bacteria | 5765 |
| 2050 | Ga0496112_0226530 | 3300048915 | Bacteria | 1825 |
| 2051 | Ga0496112_0319855 | 3300048915 | Bacteria | 1496 |
| 2052 | Ga0496112_0528176 | 3300048915 | Bacteria | 1114 |
| 2053 | Ga0496112_1131485 | 3300048915 | Unclassified | 701 |
| 2054 | Ga0496112_1747747 | 3300048915 | Viruses | 534 |
| 2055 | Ga0496113_0000965 | 3300048916 | Bacteria | 15293 |
| 2056 | Ga0496113_0027101 | 3300048916 | Bacteria | 4103 |
| 2057 | Ga0496113_0051169 | 3300048916 | Bacteria | 3082 |
| 2058 | Ga0496113_0380573 | 3300048916 | Bacteria | 1133 |
| 2059 | Ga0496113_0389651 | 3300048916 | Bacteria | 1118 |
| 2060 | Ga0496114_0006394 | 3300048917 | Bacteria | 9277 |
| 2061 | Ga0496114_0103281 | 3300048917 | Bacteria | 2436 |
| 2062 | Ga0496114_0267194 | 3300048917 | Bacteria | 1507 |
| 2063 | Ga0496114_0655983 | 3300048917 | Bacteria | 922 |
| 2064 | Ga0496114_0789103 | 3300048917 | Bacteria | 828 |
| 2065 | Ga0496114_1534038 | 3300048917 | Bacteria | 554 |
| 2066 | Ga0496115_0559201 | 3300048918 | Bacteria | 913 |
| 2067 | Ga0501290_017501 | 3300049513 | Bacteria | 960 |
| 2068 | Ga0501290_091781 | 3300049513 | Unclassified | 530 |
| 2069 | Ga0501291_109114 | 3300049514 | Bacteria | 587 |
| 2070 | Ga0501293_022033 | 3300049516 | Bacteria | 631 |
| 2071 | Ga0501297_008752 | 3300049520 | Unclassified | 1122 |
| 2072 | Ga0501031_0012344 | 3300049568 | Bacteria | 5572 |
| 2073 | Ga0501031_0073898 | 3300049568 | Bacteria | 2220 |
| 2074 | Ga0501031_0177978 | 3300049568 | Bacteria | 1390 |
| 2075 | Ga0501031_0278468 | 3300049568 | Bacteria | 1085 |
| 2076 | Ga0501032_0137790 | 3300049569 | Bacteria | 1608 |
| 2077 | Ga0501032_0303987 | 3300049569 | Bacteria | 1031 |
| 2078 | Ga0501033_0574694 | 3300049570 | Unclassified | 775 |
| 2079 | Ga0501036_0082097 | 3300049572 | Bacteria | 2724 |
| 2080 | Ga0501036_0226983 | 3300049572 | Bacteria | 1567 |
| 2081 | Ga0501036_0342398 | 3300049572 | Bacteria | 1249 |
| 2082 | Ga0501036_0461402 | 3300049572 | Bacteria | 1058 |
| 2083 | Ga0501036_0935434 | 3300049572 | Bacteria | 711 |
| 2084 | Ga0501037_0078470 | 3300049573 | Bacteria | 2396 |
| 2085 | Ga0501037_0154571 | 3300049573 | Bacteria | 1638 |
| 2086 | Ga0501037_0310704 | 3300049573 | Bacteria | 1093 |
| 2087 | Ga0501037_0411392 | 3300049573 | Bacteria | 927 |
| 2088 | Ga0501038_0075080 | 3300049574 | Bacteria | 2858 |
| 2089 | Ga0501038_0075401 | 3300049574 | Bacteria | 2851 |
| 2090 | Ga0501038_0381292 | 3300049574 | Bacteria | 1094 |
| 2091 | Ga0501039_0051039 | 3300049575 | Bacteria | 3201 |
| 2092 | Ga0501039_0054060 | 3300049575 | Bacteria | 3108 |
| 2093 | Ga0501039_0169904 | 3300049575 | Bacteria | 1714 |
| 2094 | Ga0501039_0779641 | 3300049575 | Bacteria | 746 |
| 2095 | Ga0501039_1367026 | 3300049575 | Bacteria | 545 |
| 2096 | Ga0501039_1597259 | 3300049575 | Bacteria | 501 |
| 2097 | Ga0501040_0023204 | 3300049576 | Bacteria | 4159 |
| 2098 | Ga0501040_0024445 | 3300049576 | Bacteria | 4055 |
| 2099 | Ga0501040_0029327 | 3300049576 | Bacteria | 3714 |
| 2100 | Ga0501040_0047825 | 3300049576 | Bacteria | 2922 |
| 2101 | Ga0501040_0053348 | 3300049576 | Bacteria | 2769 |
| 2102 | Ga0501040_0084734 | 3300049576 | Bacteria | 2199 |
| 2103 | Ga0501040_0306504 | 3300049576 | Bacteria | 1135 |
| 2104 | Ga0501040_0307849 | 3300049576 | Bacteria | 1133 |
| 2105 | Ga0501041_0007325 | 3300049577 | Bacteria | 6475 |
| 2106 | Ga0501041_0026916 | 3300049577 | Bacteria | 3463 |
| 2107 | Ga0501041_0164529 | 3300049577 | Bacteria | 1387 |
| 2108 | Ga0501041_0193742 | 3300049577 | Bacteria | 1273 |
| 2109 | Ga0501041_0860003 | 3300049577 | Archaea | 582 |
| 2110 | Ga0501041_1024032 | 3300049577 | Bacteria | 531 |
| 2111 | Ga0501041_1138406 | 3300049577 | Unclassified | 503 |
| 2112 | Ga0501042_0035476 | 3300049578 | Bacteria | 3538 |
| 2113 | Ga0501042_0049346 | 3300049578 | Bacteria | 3002 |
| 2114 | Ga0501042_0057869 | 3300049578 | Bacteria | 2766 |
| 2115 | Ga0501042_0311692 | 3300049578 | Bacteria | 1137 |
| 2116 | Ga0501042_0337990 | 3300049578 | Bacteria | 1089 |
| 2117 | Ga0501042_0896809 | 3300049578 | Unclassified | 646 |
| 2118 | Ga0501042_1157041 | 3300049578 | Bacteria | 564 |
| 2119 | Ga0501043_0113838 | 3300049579 | Bacteria | 2124 |
| 2120 | Ga0501046_0010812 | 3300049580 | Bacteria | 7824 |
| 2121 | Ga0501046_0042477 | 3300049580 | Bacteria | 3625 |
| 2122 | Ga0501046_0197977 | 3300049580 | Bacteria | 1496 |
| 2123 | Ga0501046_0652940 | 3300049580 | Bacteria | 743 |
| 2124 | Ga0501046_0812728 | 3300049580 | Bacteria | 655 |
| 2125 | Ga0501048_0008220 | 3300049582 | Bacteria | 7894 |
| 2126 | Ga0501048_0053669 | 3300049582 | Bacteria | 2865 |
| 2127 | Ga0501048_0144464 | 3300049582 | Bacteria | 1683 |
| 2128 | Ga0501048_0161835 | 3300049582 | Bacteria | 1584 |
| 2129 | Ga0501048_0448449 | 3300049582 | Bacteria | 924 |
| 2130 | Ga0501048_0945476 | 3300049582 | Bacteria | 620 |
| 2131 | Ga0501067_0017818 | 3300049583 | Bacteria | 3932 |
| 2132 | Ga0501067_0338734 | 3300049583 | Bacteria | 838 |
| 2133 | Ga0501067_0805730 | 3300049583 | Bacteria | 529 |
| 2134 | Ga0501068_0081033 | 3300049584 | Bacteria | 1992 |
| 2135 | Ga0501068_0132415 | 3300049584 | Bacteria | 1560 |
| 2136 | Ga0501068_0207578 | 3300049584 | Bacteria | 1243 |
| 2137 | Ga0501068_0732255 | 3300049584 | Bacteria | 647 |
| 2138 | Ga0501068_1136661 | 3300049584 | Bacteria | 517 |
| 2139 | Ga0501069_0006531 | 3300049585 | Bacteria | 6098 |
| 2140 | Ga0501069_0054383 | 3300049585 | Bacteria | 2230 |
| 2141 | Ga0501069_0135692 | 3300049585 | Bacteria | 1410 |
| 2142 | Ga0501069_0170293 | 3300049585 | Bacteria | 1256 |
| 2143 | Ga0501069_0481020 | 3300049585 | Bacteria | 740 |
| 2144 | Ga0501069_0840203 | 3300049585 | Bacteria | 557 |
| 2145 | Ga0501071_0030630 | 3300049587 | Bacteria | 3806 |
| 2146 | Ga0501071_0033222 | 3300049587 | Bacteria | 3666 |
| 2147 | Ga0501071_0073436 | 3300049587 | Bacteria | 2495 |
| 2148 | Ga0501071_0283479 | 3300049587 | Bacteria | 1254 |
| 2149 | Ga0501071_0477909 | 3300049587 | Bacteria | 955 |
| 2150 | Ga0501071_1056364 | 3300049587 | Bacteria | 627 |
| 2151 | Ga0501072_0002602 | 3300049588 | Bacteria | 13518 |
| 2152 | Ga0501072_0054708 | 3300049588 | Bacteria | 3145 |
| 2153 | Ga0501072_0092842 | 3300049588 | Bacteria | 2397 |
| 2154 | Ga0501072_0126612 | 3300049588 | Bacteria | 2035 |
| 2155 | Ga0501072_1373192 | 3300049588 | Unclassified | 547 |
| 2156 | Ga0501073_1266347 | 3300049589 | Unclassified | 506 |
| 2157 | Ga0501074_0107226 | 3300049590 | Bacteria | 2000 |
| 2158 | Ga0501074_0380492 | 3300049590 | Unclassified | 1001 |
| 2159 | Ga0501074_0623908 | 3300049590 | Bacteria | 762 |
| 2160 | Ga0501075_0029125 | 3300049591 | Bacteria | 4082 |
| 2161 | Ga0501075_0036043 | 3300049591 | Bacteria | 3691 |
| 2162 | Ga0501075_0042421 | 3300049591 | Bacteria | 3411 |
| 2163 | Ga0501075_0051199 | 3300049591 | Bacteria | 3105 |
| 2164 | Ga0501075_0111541 | 3300049591 | Bacteria | 2080 |
| 2165 | Ga0501075_0123059 | 3300049591 | Bacteria | 1974 |
| 2166 | Ga0501075_0154761 | 3300049591 | Bacteria | 1748 |
| 2167 | Ga0501075_0748970 | 3300049591 | Bacteria | 744 |
| 2168 | Ga0501075_1019110 | 3300049591 | Unclassified | 629 |
| 2169 | Ga0501076_0010522 | 3300049592 | Bacteria | 6865 |
| 2170 | Ga0501076_0065511 | 3300049592 | Bacteria | 2897 |
| 2171 | Ga0501076_0110293 | 3300049592 | Bacteria | 2224 |
| 2172 | Ga0501076_0839192 | 3300049592 | Bacteria | 758 |
| 2173 | Ga0501076_0957351 | 3300049592 | Bacteria | 705 |
| 2174 | Ga0501076_1202930 | 3300049592 | Unclassified | 624 |
| 2175 | Ga0501076_1712990 | 3300049592 | Bacteria | 515 |
| 2176 | Ga0501077_0000553 | 3300049593 | Bacteria | 22727 |
| 2177 | Ga0501077_0001357 | 3300049593 | Bacteria | 14723 |
| 2178 | Ga0501077_0014550 | 3300049593 | Bacteria | 4946 |
| 2179 | Ga0501077_0090853 | 3300049593 | Bacteria | 1935 |
| 2180 | Ga0501077_0466907 | 3300049593 | Unclassified | 808 |
| 2181 | Ga0501202_050481 | 3300049652 | Bacteria | 920 |
| 2182 | Ga0501208_145530 | 3300049655 | Bacteria | 535 |
| 2183 | Ga0501216_016571 | 3300049660 | Unclassified | 1252 |
| 2184 | Ga0501216_028197 | 3300049660 | Bacteria | 1023 |
| 2185 | Ga0501217_037625 | 3300049661 | Bacteria | 1219 |
| 2186 | Ga0501217_169187 | 3300049661 | Bacteria | 664 |
| 2187 | Ga0501217_331080 | 3300049661 | Bacteria | 509 |
| 2188 | Ga0501223_016395 | 3300049663 | Bacteria | 1464 |
| 2189 | Ga0501223_061929 | 3300049663 | Bacteria | 732 |
| 2190 | Ga0501224_030574 | 3300049664 | Bacteria | 806 |
| 2191 | Ga0501227_141529 | 3300049665 | Bacteria | 660 |
| 2192 | Ga0501230_044421 | 3300049667 | Bacteria | 868 |
| 2193 | Ga0501233_132108 | 3300049668 | Unclassified | 683 |
| 2194 | Ga0501235_013159 | 3300049669 | Unclassified | 1820 |
| 2195 | Ga0501235_078278 | 3300049669 | Unclassified | 788 |
| 2196 | Ga0501235_194971 | 3300049669 | Bacteria | 546 |
| 2197 | Ga0501236_015165 | 3300049670 | Unclassified | 1076 |
| 2198 | Ga0501239_001266 | 3300049672 | Unclassified | 2143 |
| 2199 | Ga0501249_006178 | 3300049679 | Bacteria | 2462 |
| 2200 | Ga0501250_039760 | 3300049680 | Bacteria | 686 |
| 2201 | Ga0501252_013775 | 3300049682 | Bacteria | 992 |
| 2202 | Ga0501256_024453 | 3300049685 | Unclassified | 651 |
| 2203 | Ga0501258_000477 | 3300049687 | Unclassified | 2730 |
| 2204 | Ga0501259_066458 | 3300049688 | Bacteria | 765 |
| 2205 | Ga0501225_0038264 | 3300049705 | Unclassified | 1322 |
| 2206 | Ga0501225_0110131 | 3300049705 | Bacteria | 811 |
| 2207 | Ga0501225_0357439 | 3300049705 | Unclassified | 507 |
| 2208 | Ga0501229_029780 | 3300049706 | Bacteria | 745 |
| 2209 | Ga0501245_019917 | 3300049708 | Bacteria | 1043 |
| 2210 | Ga0501079_0033321 | 3300049741 | Bacteria | 3963 |
| 2211 | Ga0501079_0033532 | 3300049741 | Bacteria | 3950 |
| 2212 | Ga0501079_0036945 | 3300049741 | Bacteria | 3763 |
| 2213 | Ga0501079_0051025 | 3300049741 | Bacteria | 3193 |
| 2214 | Ga0501079_0085799 | 3300049741 | Bacteria | 2437 |
| 2215 | Ga0501079_0401677 | 3300049741 | Bacteria | 1075 |
| 2216 | Ga0501080_0022592 | 3300049742 | Bacteria | 5827 |
| 2217 | Ga0501080_0682794 | 3300049742 | Unclassified | 907 |
| 2218 | Ga0501080_0733852 | 3300049742 | Bacteria | 870 |
| 2219 | Ga0501080_1315246 | 3300049742 | Bacteria | 619 |
| 2220 | Ga0501081_0004156 | 3300049743 | Bacteria | 9284 |
| 2221 | Ga0501081_0009862 | 3300049743 | Bacteria | 6221 |
| 2222 | Ga0501081_0064871 | 3300049743 | Bacteria | 2537 |
| 2223 | Ga0501081_0075416 | 3300049743 | Bacteria | 2354 |
| 2224 | Ga0501081_0080700 | 3300049743 | Bacteria | 2277 |
| 2225 | Ga0501081_0083158 | 3300049743 | Bacteria | 2243 |
| 2226 | Ga0501081_1507906 | 3300049743 | Unclassified | 511 |
| 2227 | Ga0501083_0496276 | 3300049744 | Bacteria | 795 |
| 2228 | Ga0501083_0539586 | 3300049744 | Unclassified | 759 |
| 2229 | Ga0501083_0673766 | 3300049744 | Bacteria | 673 |
| 2230 | Ga0501083_0960016 | 3300049744 | Bacteria | 556 |
| 2231 | Ga0501232_090615 | 3300049757 | Bacteria | 526 |
| 2232 | Ga0501263_011864 | 3300049760 | Unclassified | 1086 |
| 2233 | Ga0501266_032896 | 3300049763 | Unclassified | 747 |
| 2234 | Ga0501267_005248 | 3300049764 | Unclassified | 1223 |
| 2235 | Ga0501268_000075 | 3300049765 | Bacteria | 7791 |
| 2236 | Ga0501268_015308 | 3300049765 | Bacteria | 1259 |
| 2237 | Ga0501270_174433 | 3300049767 | Bacteria | 504 |
| 2238 | Ga0501271_004898 | 3300049768 | Bacteria | 1288 |
| 2239 | Ga0501272_011595 | 3300049769 | Unclassified | 994 |
| 2240 | Ga0501272_040611 | 3300049769 | Bacteria | 620 |
| 2241 | Ga0501273_000801 | 3300049770 | Unclassified | 2731 |
| 2242 | Ga0501273_098045 | 3300049770 | Bacteria | 505 |
| 2243 | Ga0501274_010219 | 3300049771 | Bacteria | 862 |
| 2244 | Ga0501283_066870 | 3300049779 | Unclassified | 657 |
| 2245 | Ga0501035_0066426 | 3300049822 | Bacteria | 3201 |
| 2246 | Ga0501035_0113556 | 3300049822 | Bacteria | 2373 |
| 2247 | Ga0501035_0595786 | 3300049822 | Unclassified | 901 |
| 2248 | Ga0501035_0881571 | 3300049822 | Bacteria | 710 |
| 2249 | Ga0501045_0020496 | 3300049824 | Bacteria | 4724 |
| 2250 | Ga0501045_0107044 | 3300049824 | Bacteria | 2072 |
| 2251 | Ga0501045_0199632 | 3300049824 | Bacteria | 1490 |
| 2252 | Ga0501045_0210794 | 3300049824 | Bacteria | 1447 |
| 2253 | Ga0501045_0225974 | 3300049824 | Bacteria | 1393 |
| 2254 | Ga0501045_0233057 | 3300049824 | Bacteria | 1371 |
| 2255 | Ga0501045_0310563 | 3300049824 | Bacteria | 1173 |
| 2256 | nmdc:mga05p37_11456_c1 | 3300050507 | Bacteria | 10561 |
| 2257 | nmdc:mga05p37_1181696_c1 | 3300050507 | Bacteria | 792 |
| 2258 | nmdc:mga05p37_131131_c1 | 3300050507 | Bacteria | 3075 |
| 2259 | nmdc:mga05p37_139794_c1 | 3300050507 | Bacteria | 2967 |
| 2260 | nmdc:mga05p37_1507797_c1 | 3300050507 | Bacteria | 669 |
| 2261 | nmdc:mga05p37_1531952_c1 | 3300050507 | Unclassified | 662 |
| 2262 | nmdc:mga05p37_156240_c1 | 3300050507 | Bacteria | 2787 |
| 2263 | nmdc:mga05p37_209560_c1 | 3300050507 | Bacteria | 2357 |
| 2264 | nmdc:mga05p37_270046_c1 | 3300050507 | Unclassified | 2033 |
| 2265 | nmdc:mga05p37_29782_c1 | 3300050507 | Bacteria | 6661 |
| 2266 | nmdc:mga05p37_330855_c1 | 3300050507 | Unclassified | 1800 |
| 2267 | nmdc:mga05p37_34220_c1 | 3300050507 | Bacteria | 6223 |
| 2268 | nmdc:mga05p37_377921_c1 | 3300050507 | Bacteria | 1661 |
| 2269 | nmdc:mga05p37_399786_c1 | 3300050507 | Bacteria | 1604 |
| 2270 | nmdc:mga05p37_450555_c1 | 3300050507 | Bacteria | 1490 |
| 2271 | nmdc:mga05p37_4525_c1 | 3300050507 | Bacteria | 16250 |
| 2272 | nmdc:mga05p37_544378_c1 | 3300050507 | Bacteria | 1323 |
| 2273 | nmdc:mga05p37_89624_c1 | 3300050507 | Bacteria | 3790 |
| 2274 | nmdc:mga05p37_93457_c1 | 3300050507 | Bacteria | 3706 |
| 2275 | nmdc:mga05p37_960740_c1 | 3300050507 | Bacteria | 913 |
| 2276 | nmdc:mga09592_108596_c1 | 3300050508 | Bacteria | 2380 |
| 2277 | nmdc:mga09592_152535_c1 | 3300050508 | Unclassified | 1994 |
| 2278 | nmdc:mga09592_1667285_c1 | 3300050508 | Unclassified | 515 |
| 2279 | nmdc:mga09592_35857_c1 | 3300050508 | Bacteria | 4153 |
| 2280 | nmdc:mga09592_4164_c1 | 3300050508 | Bacteria | 11680 |
| 2281 | nmdc:mga09592_568416_c1 | 3300050508 | Unclassified | 973 |
| 2282 | nmdc:mga09592_639981_c1 | 3300050508 | Bacteria | 909 |
| 2283 | nmdc:mga09592_724890_c1 | 3300050508 | Bacteria | 845 |
| 2284 | nmdc:mga09592_80668_c1 | 3300050508 | Bacteria | 2771 |
| 2285 | nmdc:mga09592_8477_c1 | 3300050508 | Bacteria | 8359 |
| 2286 | nmdc:mga09592_85922_c1 | 3300050508 | Bacteria | 2684 |
| 2287 | nmdc:mga09592_869304_c1 | 3300050508 | Bacteria | 759 |
| 2288 | nmdc:mga0qj67_1133837_c1 | 3300050509 | Bacteria | 610 |
| 2289 | nmdc:mga0qj67_1154588_c1 | 3300050509 | Unclassified | 604 |
| 2290 | nmdc:mga0qj67_136576_c1 | 3300050509 | Bacteria | 1987 |
| 2291 | nmdc:mga0qj67_163476_c1 | 3300050509 | Bacteria | 1807 |
| 2292 | nmdc:mga0qj67_17070_c1 | 3300050509 | Bacteria | 5515 |
| 2293 | nmdc:mga0qj67_191061_c1 | 3300050509 | Bacteria | 1664 |
| 2294 | nmdc:mga0qj67_207428_c1 | 3300050509 | Bacteria | 1592 |
| 2295 | nmdc:mga0qj67_34235_c2 | 3300050509 | Bacteria | 1616 |
| 2296 | nmdc:mga0qj67_467505_c1 | 3300050509 | Bacteria | 1015 |
| 2297 | nmdc:mga0qj67_6585_c1 | 3300050509 | Bacteria | 8533 |
| 2298 | nmdc:mga0qj67_684210_c1 | 3300050509 | Bacteria | 817 |
| 2299 | nmdc:mga0qj67_78673_c1 | 3300050509 | Bacteria | 2640 |
| 2300 | nmdc:mga0qj67_868_c1 | 3300050509 | Bacteria | 20736 |
| 2301 | nmdc:mga06r32_1042442_c1 | 3300050510 | Unclassified | 769 |
| 2302 | nmdc:mga06r32_1156967_c1 | 3300050510 | Bacteria | 721 |
| 2303 | nmdc:mga06r32_131415_c1 | 3300050510 | Unclassified | 2476 |
| 2304 | nmdc:mga06r32_149677_c1 | 3300050510 | Bacteria | 2312 |
| 2305 | nmdc:mga06r32_168350_c1 | 3300050510 | Bacteria | 2175 |
| 2306 | nmdc:mga06r32_202052_c1 | 3300050510 | Bacteria | 1975 |
| 2307 | nmdc:mga06r32_28504_c1 | 3300050510 | Bacteria | 5226 |
| 2308 | nmdc:mga06r32_37015_c1 | 3300050510 | Bacteria | 4616 |
| 2309 | nmdc:mga06r32_51466_c1 | 3300050510 | Bacteria | 3942 |
| 2310 | nmdc:mga06r32_6540_c1 | 3300050510 | Bacteria | 10470 |
| 2311 | nmdc:mga06r32_6937_c1 | 3300050510 | Bacteria | 10188 |
| 2312 | nmdc:mga06r32_90791_c1 | 3300050510 | Bacteria | 2985 |
| 2313 | nmdc:mga08y16_105924_c1 | 3300050511 | Bacteria | 2927 |
| 2314 | nmdc:mga08y16_1116961_c1 | 3300050511 | Unclassified | 763 |
| 2315 | nmdc:mga08y16_1183282_c1 | 3300050511 | Unclassified | 736 |
| 2316 | nmdc:mga08y16_139831_c1 | 3300050511 | Bacteria | 2517 |
| 2317 | nmdc:mga08y16_1517009_c1 | 3300050511 | Bacteria | 630 |
| 2318 | nmdc:mga08y16_1786835_c1 | 3300050511 | Bacteria | 568 |
| 2319 | nmdc:mga08y16_1851255_c1 | 3300050511 | Bacteria | 555 |
| 2320 | nmdc:mga08y16_21264_c1 | 3300050511 | Bacteria | 6851 |
| 2321 | nmdc:mga08y16_298867_c1 | 3300050511 | Bacteria | 1660 |
| 2322 | nmdc:mga08y16_31545_c1 | 3300050511 | Bacteria | 5573 |
| 2323 | nmdc:mga08y16_3223_c1 | 3300050511 | Bacteria | 16894 |
| 2324 | nmdc:mga08y16_339638_c1 | 3300050511 | Bacteria | 1544 |
| 2325 | nmdc:mga08y16_3813_c1 | 3300050511 | Bacteria | 15682 |
| 2326 | nmdc:mga08y16_419401_c1 | 3300050511 | Unclassified | 1368 |
| 2327 | nmdc:mga08y16_447777_c1 | 3300050511 | Bacteria | 1317 |
| 2328 | nmdc:mga08y16_54764_c1 | 3300050511 | Bacteria | 4168 |
| 2329 | nmdc:mga08y16_571748_c1 | 3300050511 | Bacteria | 1142 |
| 2330 | nmdc:mga08y16_742741_c1 | 3300050511 | Unclassified | 978 |
| 2331 | nmdc:mga08y16_833392_c1 | 3300050511 | Bacteria | 913 |
| 2332 | nmdc:mga0n895_10112_c1 | 3300050512 | Bacteria | 8305 |
| 2333 | nmdc:mga0n895_1068993_c1 | 3300050512 | Unclassified | 785 |
| 2334 | nmdc:mga0n895_1092008_c1 | 3300050512 | Bacteria | 776 |
| 2335 | nmdc:mga0n895_12894_c1 | 3300050512 | Bacteria | 7512 |
| 2336 | nmdc:mga0n895_1349481_c1 | 3300050512 | Bacteria | 683 |
| 2337 | nmdc:mga0n895_1497197_c1 | 3300050512 | Unclassified | 641 |
| 2338 | nmdc:mga0n895_195045_c1 | 3300050512 | Bacteria | 2056 |
| 2339 | nmdc:mga0n895_198827_c1 | 3300050512 | Bacteria | 2036 |
| 2340 | nmdc:mga0n895_2002_c1 | 3300050512 | Bacteria | 15647 |
| 2341 | nmdc:mga0n895_20269_c1 | 3300050512 | Bacteria | 6197 |
| 2342 | nmdc:mga0n895_25460_c1 | 3300050512 | Bacteria | 5590 |
| 2343 | nmdc:mga0n895_267977_c1 | 3300050512 | Bacteria | 1733 |
| 2344 | nmdc:mga0n895_312179_c1 | 3300050512 | Bacteria | 1593 |
| 2345 | nmdc:mga0n895_34298_c1 | 3300050512 | Bacteria | 4884 |
| 2346 | nmdc:mga0n895_444357_c1 | 3300050512 | Bacteria | 1310 |
| 2347 | nmdc:mga0n895_47704_c1 | 3300050512 | Bacteria | 4189 |
| 2348 | nmdc:mga0n895_5310_c1 | 3300050512 | Bacteria | 10734 |
| 2349 | nmdc:mga0n895_576869_c1 | 3300050512 | Bacteria | 1129 |
| 2350 | nmdc:mga0n895_593220_c1 | 3300050512 | Unclassified | 1111 |
| 2351 | nmdc:mga0n895_593537_c1 | 3300050512 | Bacteria | 1110 |
| 2352 | nmdc:mga0n895_699929_c1 | 3300050512 | Bacteria | 1009 |
| 2353 | nmdc:mga0n895_93_c1 | 3300050512 | Bacteria | 52210 |
| 2354 | nmdc:mga0n895_98770_c1 | 3300050512 | Bacteria | 2927 |
| 2355 | nmdc:mga0rr50_10_c1 | 3300050513 | Bacteria | 218067 |
| 2356 | nmdc:mga0rr50_130956_c1 | 3300050513 | Bacteria | 2008 |
| 2357 | nmdc:mga0rr50_1333261_c1 | 3300050513 | Unclassified | 608 |
| 2358 | nmdc:mga0rr50_138603_c1 | 3300050513 | Bacteria | 1955 |
| 2359 | nmdc:mga0rr50_157632_c1 | 3300050513 | Bacteria | 1840 |
| 2360 | nmdc:mga0rr50_181852_c1 | 3300050513 | Bacteria | 1719 |
| 2361 | nmdc:mga0rr50_219311_c1 | 3300050513 | Bacteria | 1570 |
| 2362 | nmdc:mga0rr50_262572_c1 | 3300050513 | Bacteria | 1437 |
| 2363 | nmdc:mga0rr50_294639_c1 | 3300050513 | Unclassified | 1356 |
| 2364 | nmdc:mga0rr50_30735_c1 | 3300050513 | Bacteria | 3807 |
| 2365 | nmdc:mga0rr50_31817_c1 | 3300050513 | Bacteria | 3752 |
| 2366 | nmdc:mga0rr50_376608_c1 | 3300050513 | Bacteria | 1196 |
| 2367 | nmdc:mga0rr50_532095_c1 | 3300050513 | Bacteria | 1000 |
| 2368 | nmdc:mga0rr50_561327_c1 | 3300050513 | Unclassified | 972 |
| 2369 | nmdc:mga0rr50_7671_c1 | 3300050513 | Bacteria | 6678 |
| 2370 | nmdc:mga0rr50_86929_c1 | 3300050513 | Bacteria | 2426 |
| 2371 | nmdc:mga0rr50_87633_c1 | 3300050513 | Bacteria | 2417 |
| 2372 | nmdc:mga0rr50_88000_c1 | 3300050513 | Bacteria | 2412 |
| 2373 | nmdc:mga08x19_1152161_c1 | 3300050514 | Bacteria | 550 |
| 2374 | nmdc:mga08x19_12270_c1 | 3300050514 | Bacteria | 5158 |
| 2375 | nmdc:mga08x19_135010_c1 | 3300050514 | Bacteria | 1663 |
| 2376 | nmdc:mga08x19_209_c1 | 3300050514 | Bacteria | 44732 |
| 2377 | nmdc:mga08x19_23693_c1 | 3300050514 | Bacteria | 3809 |
| 2378 | nmdc:mga08x19_240788_c1 | 3300050514 | Bacteria | 1247 |
| 2379 | nmdc:mga08x19_33721_c1 | 3300050514 | Bacteria | 3232 |
| 2380 | nmdc:mga08x19_34866_c1 | 3300050514 | Bacteria | 3183 |
| 2381 | nmdc:mga08x19_459935_c1 | 3300050514 | Bacteria | 896 |
| 2382 | nmdc:mga08x19_4666_c1 | 3300050514 | Bacteria | 8124 |
| 2383 | nmdc:mga08x19_825_c1 | 3300050514 | Bacteria | 19672 |
| 2384 | nmdc:mga08x19_9990_c1 | 3300050514 | Bacteria | 5691 |
| 2385 | nmdc:mga0a205_111930_c1 | 3300050515 | Bacteria | 2629 |
| 2386 | nmdc:mga0a205_1242_c1 | 3300050515 | Bacteria | 21367 |
| 2387 | nmdc:mga0a205_140316_c3 | 3300050515 | Bacteria | 1132 |
| 2388 | nmdc:mga0a205_140435_c1 | 3300050515 | Bacteria | 2316 |
| 2389 | nmdc:mga0a205_1426_c1 | 3300050515 | Bacteria | 20333 |
| 2390 | nmdc:mga0a205_1582987_c1 | 3300050515 | Bacteria | 504 |
| 2391 | nmdc:mga0a205_164538_c1 | 3300050515 | Bacteria | 2114 |
| 2392 | nmdc:mga0a205_18731_c1 | 3300050515 | Bacteria | 6516 |
| 2393 | nmdc:mga0a205_210957_c1 | 3300050515 | Bacteria | 1830 |
| 2394 | nmdc:mga0a205_26440_c1 | 3300050515 | Bacteria | 5534 |
| 2395 | nmdc:mga0a205_272365_c1 | 3300050515 | Bacteria | 1570 |
| 2396 | nmdc:mga0a205_321281_c1 | 3300050515 | Bacteria | 1419 |
| 2397 | nmdc:mga0a205_356067_c1 | 3300050515 | Bacteria | 1331 |
| 2398 | nmdc:mga0a205_40568_c1 | 3300050515 | Bacteria | 4481 |
| 2399 | nmdc:mga0a205_50347_c1 | 3300050515 | Bacteria | 4021 |
| 2400 | nmdc:mga0a205_636_c1 | 3300050515 | Bacteria | 27881 |
| 2401 | nmdc:mga0a205_656387_c1 | 3300050515 | Bacteria | 900 |
| 2402 | nmdc:mga0a205_69433_c1 | 3300050515 | Bacteria | 3402 |
| 2403 | nmdc:mga0a205_89226_c1 | 3300050515 | Unclassified | 2980 |
| 2404 | Ga0495601_0018679 | 3300053077 | Bacteria | 4220 |
| 2405 | Ga0495601_0051585 | 3300053077 | Bacteria | 2596 |
| 2406 | Ga0495655_0054532 | 3300053083 | Bacteria | 1070 |
| 2407 | Ga0495619_0001650 | 3300053085 | Bacteria | 14726 |
| 2408 | Ga0495619_0298902 | 3300053085 | Bacteria | 1115 |
| 2409 | Ga0501084_0010001 | 3300054114 | Bacteria | 7837 |
| 2410 | Ga0501084_0022445 | 3300054114 | Bacteria | 5266 |
| 2411 | Ga0501084_0035787 | 3300054114 | Bacteria | 4150 |
| 2412 | Ga0501084_0111570 | 3300054114 | Bacteria | 2298 |
| 2413 | Ga0501084_0167063 | 3300054114 | Bacteria | 1857 |
| 2414 | Ga0501084_0212370 | 3300054114 | Bacteria | 1632 |
| 2415 | Ga0501084_0415284 | 3300054114 | Bacteria | 1137 |
| 2416 | Ga0501084_0737512 | 3300054114 | Bacteria | 830 |
| 2417 | Ga0501084_0990023 | 3300054114 | Bacteria | 707 |
| 2418 | Ga0501084_1697492 | 3300054114 | Unclassified | 528 |
| 2419 | Ga0590071_010375 | 3300059421 | Bacteria | 2182 |
| 2420 | Ga0590071_026680 | 3300059421 | Bacteria | 1371 |
| 2421 | Ga0590075_024884 | 3300059424 | Bacteria | 1504 |
| 2422 | Ga0590077_010280 | 3300059426 | Bacteria | 1925 |
| 2423 | Ga0587073_0161859 | 3300059492 | Bacteria | 642 |
| 2424 | Ga0587082_184194 | 3300059504 | Bacteria | 513 |
| 2425 | Ga0587128_048671 | 3300059630 | Bacteria | 767 |
| 2426 | Ga0587075_011331 | 3300059644 | Unclassified | 1194 |
| 2427 | Ga0587075_141515 | 3300059644 | Bacteria | 514 |
| 2428 | Ga0587107_077142 | 3300059652 | Bacteria | 620 |
| 2429 | Ga0587111_0240831 | 3300060346 | Bacteria | 531 |
| 2430 | Ga0501082_0020795 | 3300060353 | Bacteria | 5660 |
| 2431 | Ga0501082_0022918 | 3300060353 | Bacteria | 5381 |
| 2432 | Ga0501082_0030982 | 3300060353 | Bacteria | 4610 |
| 2433 | Ga0501082_0056157 | 3300060353 | Bacteria | 3391 |
| 2434 | Ga0501082_0608670 | 3300060353 | Bacteria | 956 |
| 2435 | Ga0501082_0962859 | 3300060353 | Bacteria | 746 |
| 2436 | Ga0501082_1995625 | 3300060353 | Unclassified | 506 |
| 2437 | Ga0530510_0002558 | 3300061734 | Bacteria | 12502 |
| 2438 | Ga0530510_0080393 | 3300061734 | Bacteria | 2372 |
| 2439 | Ga0530510_0135946 | 3300061734 | Bacteria | 1810 |
| 2440 | Ga0530510_0140991 | 3300061734 | Bacteria | 1776 |
| 2441 | Ga0530510_0172280 | 3300061734 | Unclassified | 1603 |
| 2442 | Ga0530510_0219905 | 3300061734 | Bacteria | 1412 |
| 2443 | Ga0530510_0326031 | 3300061734 | Bacteria | 1151 |
| 2444 | Ga0530510_0441750 | 3300061734 | Bacteria | 983 |
| 2445 | Ga0530510_0820683 | 3300061734 | Bacteria | 710 |
| 2446 | Ga0157377_10754962 | |||
| 2447 | MBSR1b_contig_8089602 | |||
| 2448 | JGI24746J21847_1020812 | |||
| 2449 | JGI24740J21852_10169113 | |||
| 2450 | JGI24750J21931_1056453 | |||
| 2451 | JGI24749J21850_1033407 | |||
| 2452 | JGI24749J21850_1065638 | |||
| 2453 | JGI24035J26624_1017358 | |||
| 2454 | JGI24033J26618_1075630 | |||
| 2455 | JGI24742J22300_10088205 | |||
| 2456 | JGI24751J29686_10085517 | |||
| 2457 | Ga0058863_11447660 | |||
| 2458 | Ga0058863_11891130 | |||
| 2459 | Ga0058861_11592764 | |||
| 2460 | Ga0058861_12052165 | |||
| 2461 | Ga0058862_12409730 | |||
| 2462 | Ga0058862_12850276 | |||
| 2463 | Ga0058862_12877243 | |||
| 2464 | Ga0058862_12892988 | |||
| 2465 | Ga0065714_10244450 | |||
| 2466 | Ga0065704_10296262 | |||
| 2467 | Ga0065712_10031789 | |||
| 2468 | Ga0065712_10080735 | |||
| 2469 | Ga0065712_10087940 | |||
| 2470 | Ga0065712_10237856 | |||
| 2471 | Ga0065712_10300471 | |||
| 2472 | Ga0065715_10000777 | |||
| 2473 | Ga0065715_10056506 | |||
| 2474 | Ga0065715_10079224 | |||
| 2475 | Ga0065715_10102254 | |||
| 2476 | Ga0065715_10121937 | |||
| 2477 | Ga0065715_10141340 | |||
| 2478 | Ga0065715_10349685 | |||
| 2479 | Ga0065715_10428489 | |||
| 2480 | Ga0065715_10511348 | |||
| 2481 | Ga0065715_10551838 | |||
| 2482 | Ga0065715_10690883 | |||
| 2483 | Ga0065715_10896262 | |||
| 2484 | Ga0065707_10038352 | |||
| 2485 | Ga0065707_10172378 | |||
| 2486 | Ga0065707_10179609 | |||
| 2487 | Ga0065707_10276962 | |||
| 2488 | Ga0065707_10350949 | |||
| 2489 | Ga0065707_10765100 | |||
| 2490 | Ga0070658_10081445 | |||
| 2491 | Ga0070658_10170881 | |||
| 2492 | Ga0070676_10005080 | |||
| 2493 | Ga0070676_10037621 | |||
| 2494 | Ga0070676_10125979 | |||
| 2495 | Ga0070676_10329454 | |||
| 2496 | Ga0070676_10752239 | |||
| 2497 | Ga0070676_10859594 | |||
| 2498 | Ga0070676_11302573 | |||
| 2499 | Ga0070683_100000764 | |||
| 2500 | Ga0070683_100032682 | |||
| 2501 | Ga0070690_100002022 | |||
| 2502 | Ga0070690_100044091 | |||
| 2503 | Ga0070690_100075357 | |||
| 2504 | Ga0070690_100306852 | |||
| 2505 | Ga0070690_100732091 | |||
| 2506 | Ga0070690_101139153 | |||
| 2507 | Ga0070670_100000634 | |||
| 2508 | Ga0070670_100011366 | |||
| 2509 | Ga0070670_100034413 | |||
| 2510 | Ga0070670_100198760 | |||
| 2511 | Ga0070670_100327493 | |||
| 2512 | Ga0070670_100366380 | |||
| 2513 | Ga0070670_100412540 | |||
| 2514 | Ga0070670_100685656 | |||
| 2515 | Ga0070670_101081755 | |||
| 2516 | Ga0070670_101720982 | |||
| 2517 | Ga0070677_10006929 | |||
| 2518 | Ga0070677_10020381 | |||
| 2519 | Ga0070677_10028081 | |||
| 2520 | Ga0070677_10028671 | |||
| 2521 | Ga0070677_10161810 | |||
| 2522 | Ga0070677_10347427 | |||
| 2523 | Ga0070677_10436101 | |||
| 2524 | Ga0070677_10561485 | |||
| 2525 | Ga0070677_10790508 | |||
| 2526 | Ga0068869_100002979 | |||
| 2527 | Ga0068869_100038960 | |||
| 2528 | Ga0068869_100090850 | |||
| 2529 | Ga0068869_100381562 | |||
| 2530 | Ga0068869_100581720 | |||
| 2531 | Ga0068869_101520335 | |||
| 2532 | Ga0070666_10003132 | |||
| 2533 | Ga0070666_10013743 | |||
| 2534 | Ga0070666_10042121 | |||
| 2535 | Ga0070666_10069734 | |||
| 2536 | Ga0070666_10313469 | |||
| 2537 | Ga0070666_10346076 | |||
| 2538 | Ga0070666_11077970 | |||
| 2539 | Ga0070666_11382548 | |||
| 2540 | Ga0070680_100008842 | |||
| 2541 | Ga0070680_100028405 | |||
| 2542 | Ga0070680_100059036 | |||
| 2543 | Ga0070680_100115826 | |||
| 2544 | Ga0070680_100116997 | |||
| 2545 | Ga0070680_100187075 | |||
| 2546 | Ga0070680_100365685 | |||
| 2547 | Ga0070680_100710408 | |||
| 2548 | Ga0070680_100961014 | |||
| 2549 | Ga0070680_101130063 | |||
| 2550 | Ga0070680_101437756 | |||
| 2551 | Ga0070680_101677450 | |||
| 2552 | Ga0070682_100999980 | |||
| 2553 | Ga0068868_100010945 | |||
| 2554 | Ga0068868_100080980 | |||
| 2555 | Ga0068868_101580011 | |||
| 2556 | Ga0070660_100244837 | |||
| 2557 | Ga0070660_100387024 | |||
| 2558 | Ga0070660_100388544 | |||
| 2559 | Ga0070660_100812240 | |||
| 2560 | Ga0070660_100910207 | |||
| 2561 | Ga0070660_101077502 | |||
| 2562 | Ga0070660_101559171 | |||
| 2563 | Ga0070689_100062271 | |||
| 2564 | Ga0070689_100093808 | |||
| 2565 | Ga0070689_100115240 | |||
| 2566 | Ga0070689_100685176 | |||
| 2567 | Ga0070689_100802989 | |||
| 2568 | Ga0070689_101025110 | |||
| 2569 | Ga0070689_101877614 | |||
| 2570 | Ga0070691_11056250 | |||
| 2571 | Ga0070687_100007944 | |||
| 2572 | Ga0070687_100011225 | |||
| 2573 | Ga0070687_100031504 | |||
| 2574 | Ga0070687_100477210 | |||
| 2575 | Ga0070687_100510172 | |||
| 2576 | Ga0070687_100568685 | |||
| 2577 | Ga0070687_100612432 | |||
| 2578 | Ga0070687_100633461 | |||
| 2579 | Ga0070661_100035888 | |||
| 2580 | Ga0070661_100038013 | |||
| 2581 | Ga0070661_100075035 | |||
| 2582 | Ga0070661_100166732 | |||
| 2583 | Ga0070661_100310354 | |||
| 2584 | Ga0070661_100671615 | |||
| 2585 | Ga0070692_10033401 | |||
| 2586 | Ga0070692_10149929 | |||
| 2587 | Ga0070692_10208889 | |||
| 2588 | Ga0070692_10220142 | |||
| 2589 | Ga0070692_10641295 | |||
| 2590 | Ga0070692_11122823 | |||
| 2591 | Ga0070668_100023211 | |||
| 2592 | Ga0070668_100031330 | |||
| 2593 | Ga0070668_100032702 | |||
| 2594 | Ga0070668_100034586 | |||
| 2595 | Ga0070668_100095066 | |||
| 2596 | Ga0070668_100108357 | |||
| 2597 | Ga0070668_100190401 | |||
| 2598 | Ga0070668_100574498 | |||
| 2599 | Ga0070669_100002739 | |||
| 2600 | Ga0070669_100007115 | |||
| 2601 | Ga0070669_100009768 | |||
| 2602 | Ga0070669_100016837 | |||
| 2603 | Ga0070669_100143228 | |||
| 2604 | Ga0070669_100153005 | |||
| 2605 | Ga0070669_100188024 | |||
| 2606 | Ga0070669_100192898 | |||
| 2607 | Ga0070669_100366298 | |||
| 2608 | Ga0070669_100533755 | |||
| 2609 | Ga0070669_100591866 | |||
| 2610 | Ga0070669_100759579 | |||
| 2611 | Ga0070669_100915038 | |||
| 2612 | Ga0070669_101807035 | |||
| 2613 | Ga0070675_100000592 | |||
| 2614 | Ga0070675_100005419 | |||
| 2615 | Ga0070675_100009716 | |||
| 2616 | Ga0070675_100011526 | |||
| 2617 | Ga0070675_100014415 | |||
| 2618 | Ga0070675_100017993 | |||
| 2619 | Ga0070675_100023257 | |||
| 2620 | Ga0070675_100037925 | |||
| 2621 | Ga0070675_100038174 | |||
| 2622 | Ga0070675_100051924 | |||
| 2623 | Ga0070675_100069979 | |||
| 2624 | Ga0070675_100139369 | |||
| 2625 | Ga0070675_100140026 | |||
| 2626 | Ga0070675_100170187 | |||
| 2627 | Ga0070675_100247593 | |||
| 2628 | Ga0070675_100286076 | |||
| 2629 | Ga0070675_100370775 | |||
| 2630 | Ga0070675_100842998 | |||
| 2631 | Ga0070675_101078682 | |||
| 2632 | Ga0070675_101508999 | |||
| 2633 | Ga0070675_101742744 | |||
| 2634 | Ga0070671_100007962 | |||
| 2635 | Ga0070671_100042508 | |||
| 2636 | Ga0070671_100057254 | |||
| 2637 | Ga0070674_100001731 | |||
| 2638 | Ga0070674_100033533 | |||
| 2639 | Ga0070674_100061397 | |||
| 2640 | Ga0070674_100089912 | |||
| 2641 | Ga0070674_100120160 | |||
| 2642 | Ga0070674_100175645 | |||
| 2643 | Ga0070674_100178676 | |||
| 2644 | Ga0070674_100502945 | |||
| 2645 | Ga0070674_100524425 | |||
| 2646 | Ga0070674_100559246 | |||
| 2647 | Ga0070674_101210384 | |||
| 2648 | Ga0070674_101844917 | |||
| 2649 | Ga0070673_100000603 | |||
| 2650 | Ga0070673_100005191 | |||
| 2651 | Ga0070673_100028468 | |||
| 2652 | Ga0070673_100030517 | |||
| 2653 | Ga0070673_100051997 | |||
| 2654 | Ga0070673_100091456 | |||
| 2655 | Ga0070673_100152864 | |||
| 2656 | Ga0070673_100168060 | |||
| 2657 | Ga0070673_100172100 | |||
| 2658 | Ga0070673_100190913 | |||
| 2659 | Ga0070673_100270474 | |||
| 2660 | Ga0070673_100520933 | |||
| 2661 | Ga0070688_100053260 | |||
| 2662 | Ga0070688_100062021 | |||
| 2663 | Ga0070688_100208530 | |||
| 2664 | Ga0070688_100209788 | |||
| 2665 | Ga0070688_100275840 | |||
| 2666 | Ga0070688_100509761 | |||
| 2667 | Ga0070688_101356888 | |||
| 2668 | Ga0070688_101407706 | |||
| 2669 | Ga0070659_100075532 | |||
| 2670 | Ga0070659_100081231 | |||
| 2671 | Ga0070659_100122366 | |||
| 2672 | Ga0070659_100168275 | |||
| 2673 | Ga0070659_100797998 | |||
| 2674 | Ga0070667_100025795 | |||
| 2675 | Ga0070667_100101067 | |||
| 2676 | Ga0070667_100189904 | |||
| 2677 | Ga0070667_101022953 | |||
| 2678 | Ga0070703_10072014 | |||
| 2679 | Ga0070703_10400086 | |||
| 2680 | Ga0070709_10024824 | |||
| 2681 | Ga0070709_10031608 | |||
| 2682 | Ga0070709_10570167 | |||
| 2683 | Ga0070714_100006289 | |||
| 2684 | Ga0070714_100647581 | |||
| 2685 | Ga0070713_100035971 | |||
| 2686 | Ga0070713_100143527 | |||
| 2687 | Ga0070713_101373429 | |||
| 2688 | Ga0070710_10169835 | |||
| 2689 | Ga0070710_10842079 | |||
| 2690 | Ga0070710_10951460 | |||
| 2691 | Ga0070701_10011016 | |||
| 2692 | Ga0070701_10104009 | |||
| 2693 | Ga0070701_10279870 | |||
| 2694 | Ga0070701_10421199 | |||
| 2695 | Ga0070701_10854080 | |||
| 2696 | Ga0070701_11321836 | |||
| 2697 | Ga0070711_100000009 | |||
| 2698 | Ga0070711_100164024 | |||
| 2699 | Ga0070711_100284123 | |||
| 2700 | Ga0070705_100007880 | |||
| 2701 | Ga0070705_100015346 | |||
| 2702 | Ga0070705_100030981 | |||
| 2703 | Ga0070705_100038162 | |||
| 2704 | Ga0070705_100110291 | |||
| 2705 | Ga0070705_100357444 | |||
| 2706 | Ga0070705_100466508 | |||
| 2707 | Ga0070705_100531497 | |||
| 2708 | Ga0070705_100650081 | |||
| 2709 | Ga0070705_100690419 | |||
| 2710 | Ga0070705_100785768 | |||
| 2711 | Ga0070700_100057525 | |||
| 2712 | Ga0070700_100127887 | |||
| 2713 | Ga0070700_100130838 | |||
| 2714 | Ga0070700_100176094 | |||
| 2715 | Ga0070700_100380134 | |||
| 2716 | Ga0070700_100545678 | |||
| 2717 | Ga0070700_100757772 | |||
| 2718 | Ga0070700_100910284 | |||
| 2719 | Ga0070700_101073027 | |||
| 2720 | Ga0070700_101233229 | |||
| 2721 | Ga0070700_101355347 | |||
| 2722 | Ga0070694_100003241 | |||
| 2723 | Ga0070694_100026629 | |||
| 2724 | Ga0070694_100070308 | |||
| 2725 | Ga0070694_100089455 | |||
| 2726 | Ga0070694_100440224 | |||
| 2727 | Ga0070708_100004458 | |||
| 2728 | Ga0070708_100005480 | |||
| 2729 | Ga0070708_100024315 | |||
| 2730 | Ga0070708_100025392 | |||
| 2731 | Ga0070708_100058470 | |||
| 2732 | Ga0070708_100161097 | |||
| 2733 | Ga0070708_100192871 | |||
| 2734 | Ga0070708_100193562 | |||
| 2735 | Ga0070708_100256968 | |||
| 2736 | Ga0070708_100444044 | |||
| 2737 | Ga0070708_100504136 | |||
| 2738 | Ga0070708_100621017 | |||
| 2739 | Ga0070708_100941134 | |||
| 2740 | Ga0070708_100969105 | |||
| 2741 | Ga0070708_101395228 | |||
| 2742 | Ga0070708_101454249 | |||
| 2743 | Ga0070663_100023756 | |||
| 2744 | Ga0070663_100029666 | |||
| 2745 | Ga0070663_100143020 | |||
| 2746 | Ga0070663_100435421 | |||
| 2747 | Ga0070663_100563207 | |||
| 2748 | Ga0070663_100815170 | |||
| 2749 | Ga0070663_102147927 | |||
| 2750 | Ga0070678_100041914 | |||
| 2751 | Ga0070678_100225645 | |||
| 2752 | Ga0070678_100245458 | |||
| 2753 | Ga0070678_100388165 | |||
| 2754 | Ga0070678_100463109 | |||
| 2755 | Ga0070678_100512756 | |||
| 2756 | Ga0070678_100683884 | |||
| 2757 | Ga0070678_100684327 | |||
| 2758 | Ga0070678_101083477 | |||
| 2759 | Ga0070678_102252427 | |||
| 2760 | Ga0070662_100007121 | |||
| 2761 | Ga0070662_100132760 | |||
| 2762 | Ga0070662_100135371 | |||
| 2763 | Ga0070662_100136299 | |||
| 2764 | Ga0070662_100243567 | |||
| 2765 | Ga0070662_100291122 | |||
| 2766 | Ga0070662_100404256 | |||
| 2767 | Ga0070662_100516135 | |||
| 2768 | Ga0070662_100590436 | |||
| 2769 | Ga0070662_100615578 | |||
| 2770 | Ga0070662_100808860 | |||
| 2771 | Ga0070662_101454180 | |||
| 2772 | Ga0070681_10032018 | |||
| 2773 | Ga0070681_10039527 | |||
| 2774 | Ga0070681_10083546 | |||
| 2775 | Ga0070681_10158976 | |||
| 2776 | Ga0070681_10243224 | |||
| 2777 | Ga0070681_10379858 | |||
| 2778 | Ga0070681_10928973 | |||
| 2779 | Ga0070681_11586591 | |||
| 2780 | Ga0070681_11745436 | |||
| 2781 | Ga0068867_100012221 | |||
| 2782 | Ga0068867_100015663 | |||
| 2783 | Ga0068867_100138694 | |||
| 2784 | Ga0068867_100151483 | |||
| 2785 | Ga0068867_100238892 | |||
| 2786 | Ga0068867_100393890 | |||
| 2787 | Ga0068867_100494035 | |||
| 2788 | Ga0068867_100507573 | |||
| 2789 | Ga0068867_101059777 | |||
| 2790 | Ga0068867_101327265 | |||
| 2791 | Ga0068867_101577395 | |||
| 2792 | Ga0070685_10058735 | |||
| 2793 | Ga0070685_11171030 | |||
| 2794 | Ga0070685_11472612 | |||
| 2795 | Ga0070685_11541351 | |||
| 2796 | Ga0070706_100007472 | |||
| 2797 | Ga0070706_100024789 | |||
| 2798 | Ga0070706_100196691 | |||
| 2799 | Ga0070706_100254096 | |||
| 2800 | Ga0070706_100333133 | |||
| 2801 | Ga0070706_100527137 | |||
| 2802 | Ga0070706_100705672 | |||
| 2803 | Ga0070707_100002824 | |||
| 2804 | Ga0070707_100018730 | |||
| 2805 | Ga0070707_100030365 | |||
| 2806 | Ga0070707_100051564 | |||
| 2807 | Ga0070707_100138128 | |||
| 2808 | Ga0070707_100151094 | |||
| 2809 | Ga0070707_100162154 | |||
| 2810 | Ga0070707_100241333 | |||
| 2811 | Ga0070707_100491666 | |||
| 2812 | Ga0070707_100677633 | |||
| 2813 | Ga0070707_100947536 | |||
| 2814 | Ga0070707_101475092 | |||
| 2815 | Ga0070707_101783699 | |||
| 2816 | Ga0070698_100000520 | |||
| 2817 | Ga0070698_100040967 | |||
| 2818 | Ga0070698_100059590 | |||
| 2819 | Ga0070698_100173809 | |||
| 2820 | Ga0070698_100223385 | |||
| 2821 | Ga0070698_100375501 | |||
| 2822 | Ga0070698_100397396 | |||
| 2823 | Ga0070698_100492937 | |||
| 2824 | Ga0070698_100944074 | |||
| 2825 | Ga0070698_100967834 | |||
| 2826 | Ga0070698_102141723 | |||
| 2827 | Ga0070698_102194428 | |||
| 2828 | Ga0070699_100012245 | |||
| 2829 | Ga0070699_100024357 | |||
| 2830 | Ga0070699_100032538 | |||
| 2831 | Ga0070699_100032879 | |||
| 2832 | Ga0070699_100038201 | |||
| 2833 | Ga0070699_100043802 | |||
| 2834 | Ga0070699_100053558 | |||
| 2835 | Ga0070699_100158199 | |||
| 2836 | Ga0070699_100163219 | |||
| 2837 | Ga0070699_100344609 | |||
| 2838 | Ga0070699_100541574 | |||
| 2839 | Ga0070699_100684370 | |||
| 2840 | Ga0070699_100763223 | |||
| 2841 | Ga0070699_100860784 | |||
| 2842 | Ga0070699_100887684 | |||
| 2843 | Ga0070699_101768861 | |||
| 2844 | Ga0070679_100003010 | |||
| 2845 | Ga0070679_100010452 | |||
| 2846 | Ga0070679_100010649 | |||
| 2847 | Ga0070679_100068413 | |||
| 2848 | Ga0070679_100103935 | |||
| 2849 | Ga0070679_100105325 | |||
| 2850 | Ga0070679_100177781 | |||
| 2851 | Ga0070679_100249172 | |||
| 2852 | Ga0070679_100443796 | |||
| 2853 | Ga0070679_100538362 | |||
| 2854 | Ga0070679_100694481 | |||
| 2855 | Ga0070679_100774356 | |||
| 2856 | Ga0070679_100919285 | |||
| 2857 | Ga0070679_100923975 | |||
| 2858 | Ga0070679_101216364 | |||
| 2859 | Ga0070684_100103746 | |||
| 2860 | Ga0070684_100824233 | |||
| 2861 | Ga0070684_100842885 | |||
| 2862 | Ga0070684_102206656 | |||
| 2863 | Ga0070697_100008704 | |||
| 2864 | Ga0070697_100019301 | |||
| 2865 | Ga0070697_100033507 | |||
| 2866 | Ga0070697_100070472 | |||
| 2867 | Ga0070697_100080732 | |||
| 2868 | Ga0070697_100132661 | |||
| 2869 | Ga0070697_100235333 | |||
| 2870 | Ga0070697_100289179 | |||
| 2871 | Ga0070697_100325076 | |||
| 2872 | Ga0070697_100357713 | |||
| 2873 | Ga0070697_100389854 | |||
| 2874 | Ga0070697_100392116 | |||
| 2875 | Ga0070697_100398876 | |||
| 2876 | Ga0070697_100417678 | |||
| 2877 | Ga0070697_101161141 | |||
| 2878 | Ga0070697_101577108 | |||
| 2879 | Ga0070697_102107904 | |||
| 2880 | Ga0068853_100019614 | |||
| 2881 | Ga0068853_100277845 | |||
| 2882 | Ga0068853_100459431 | |||
| 2883 | Ga0068853_100491273 | |||
| 2884 | Ga0068853_100680998 | |||
| 2885 | Ga0068853_101540998 | |||
| 2886 | Ga0068853_102024316 | |||
| 2887 | Ga0070672_100013626 | |||
| 2888 | Ga0070672_100016159 | |||
| 2889 | Ga0070672_100021951 | |||
| 2890 | Ga0070672_100074044 | |||
| 2891 | Ga0070672_100085953 | |||
| 2892 | Ga0070672_100092375 | |||
| 2893 | Ga0070672_100188935 | |||
| 2894 | Ga0070672_100191240 | |||
| 2895 | Ga0070672_100194743 | |||
| 2896 | Ga0070672_100206958 | |||
| 2897 | Ga0070672_100491146 | |||
| 2898 | Ga0070672_100915807 | |||
| 2899 | Ga0070672_100949792 | |||
| 2900 | Ga0070672_101008290 | |||
| 2901 | Ga0070672_101515421 | |||
| 2902 | Ga0070672_101546777 | |||
| 2903 | Ga0070672_101761556 | |||
| 2904 | Ga0070686_100002279 | |||
| 2905 | Ga0070686_100007091 | |||
| 2906 | Ga0070686_100084126 | |||
| 2907 | Ga0070686_100220758 | |||
| 2908 | Ga0070686_100564737 | |||
| 2909 | Ga0070686_100601702 | |||
| 2910 | Ga0070686_100671900 | |||
| 2911 | Ga0070686_101415057 | |||
| 2912 | Ga0070686_101725424 | |||
| 2913 | Ga0070695_100014472 | |||
| 2914 | Ga0070695_100089522 | |||
| 2915 | Ga0070695_100120396 | |||
| 2916 | Ga0070695_100128703 | |||
| 2917 | Ga0070695_100153550 | |||
| 2918 | Ga0070695_100156911 | |||
| 2919 | Ga0070695_100295961 | |||
| 2920 | Ga0070695_100506108 | |||
| 2921 | Ga0070695_100574410 | |||
| 2922 | Ga0070696_100003268 | |||
| 2923 | Ga0070696_100089645 | |||
| 2924 | Ga0070696_100092155 | |||
| 2925 | Ga0070696_100113559 | |||
| 2926 | Ga0070696_100119710 | |||
| 2927 | Ga0070696_100162043 | |||
| 2928 | Ga0070696_100180514 | |||
| 2929 | Ga0070696_100258889 | |||
| 2930 | Ga0070696_100312695 | |||
| 2931 | Ga0070696_100521954 | |||
| 2932 | Ga0070696_100772087 | |||
| 2933 | Ga0070696_101096299 | |||
| 2934 | Ga0070693_100168653 | |||
| 2935 | Ga0070693_100828907 | |||
| 2936 | Ga0070693_101416434 | |||
| 2937 | Ga0070665_100048682 | |||
| 2938 | Ga0070665_100315756 | |||
| 2939 | Ga0070665_100355107 | |||
| 2940 | Ga0070665_100714843 | |||
| 2941 | Ga0070665_101293301 | |||
| 2942 | Ga0070665_102536340 | |||
| 2943 | Ga0070704_100026654 | |||
| 2944 | Ga0070704_100033958 | |||
| 2945 | Ga0070704_100035692 | |||
| 2946 | Ga0070704_100228384 | |||
| 2947 | Ga0070704_100273086 | |||
| 2948 | Ga0070704_100572866 | |||
| 2949 | Ga0068855_100065198 | |||
| 2950 | Ga0068855_100070564 | |||
| 2951 | Ga0068855_100100245 | |||
| 2952 | Ga0068855_100635005 | |||
| 2953 | Ga0068855_100822658 | |||
| 2954 | Ga0068855_101197144 | |||
| 2955 | Ga0068855_101366830 | |||
| 2956 | Ga0068855_101424111 | |||
| 2957 | Ga0070664_100002135 | |||
| 2958 | Ga0070664_100033775 | |||
| 2959 | Ga0070664_100194633 | |||
| 2960 | Ga0070664_100206069 | |||
| 2961 | Ga0070664_100240325 | |||
| 2962 | Ga0070664_100411241 | |||
| 2963 | Ga0070664_100466183 | |||
| 2964 | Ga0070664_100558833 | |||
| 2965 | Ga0070664_101122345 | |||
| 2966 | Ga0070664_101421993 | |||
| 2967 | Ga0070664_101580372 | |||
| 2968 | Ga0068857_100011112 | |||
| 2969 | Ga0068857_100151852 | |||
| 2970 | Ga0068857_100239801 | |||
| 2971 | Ga0068857_100323433 | |||
| 2972 | Ga0068857_101113734 | |||
| 2973 | Ga0068857_102081853 | |||
| 2974 | Ga0068854_100026682 | |||
| 2975 | Ga0068854_100040433 | |||
| 2976 | Ga0068854_100082085 | |||
| 2977 | Ga0068854_100115138 | |||
| 2978 | Ga0068854_100147625 | |||
| 2979 | Ga0068854_100793305 | |||
| 2980 | Ga0068854_101514808 | |||
| 2981 | Ga0068854_101670611 | |||
| 2982 | Ga0068856_100068962 | |||
| 2983 | Ga0068856_100353143 | |||
| 2984 | Ga0068856_100677467 | |||
| 2985 | Ga0070702_100078203 | |||
| 2986 | Ga0070702_100802243 | |||
| 2987 | Ga0070702_100959789 | |||
| 2988 | Ga0070702_101262047 | |||
| 2989 | Ga0070702_101894167 | |||
| 2990 | Ga0068852_100010221 | |||
| 2991 | Ga0068852_100038875 | |||
| 2992 | Ga0068852_100099243 | |||
| 2993 | Ga0068852_100190203 | |||
| 2994 | Ga0068852_101203060 | |||
| 2995 | Ga0068859_100028923 | |||
| 2996 | Ga0068859_100193216 | |||
| 2997 | Ga0068859_100233515 | |||
| 2998 | Ga0068859_100260860 | |||
| 2999 | Ga0068859_100262069 | |||
| 3000 | Ga0068859_100270773 | |||
| 3001 | Ga0068859_100272505 | |||
| 3002 | Ga0068859_100292411 | |||
| 3003 | Ga0068859_102288692 | |||
| 3004 | Ga0068864_100044927 | |||
| 3005 | Ga0068864_100075307 | |||
| 3006 | Ga0068864_100298150 | |||
| 3007 | Ga0068864_100312904 | |||
| 3008 | Ga0068864_100443295 | |||
| 3009 | Ga0068864_100446734 | |||
| 3010 | Ga0068864_100502321 | |||
| 3011 | Ga0068864_100543757 | |||
| 3012 | Ga0068864_102131957 | |||
| 3013 | Ga0068866_10034973 | |||
| 3014 | Ga0068866_10067468 | |||
| 3015 | Ga0068866_10072666 | |||
| 3016 | Ga0068866_10158412 | |||
| 3017 | Ga0068866_10265208 | |||
| 3018 | Ga0068866_11184402 | |||
| 3019 | Ga0068866_11248870 | |||
| 3020 | Ga0068861_100029332 | |||
| 3021 | Ga0068861_100030899 | |||
| 3022 | Ga0068861_100044274 | |||
| 3023 | Ga0068861_100111723 | |||
| 3024 | Ga0068861_100258200 | |||
| 3025 | Ga0068861_100282654 | |||
| 3026 | Ga0068861_100331829 | |||
| 3027 | Ga0068861_100599255 | |||
| 3028 | Ga0068861_101095402 | |||
| 3029 | Ga0068861_101513212 | |||
| 3030 | Ga0068861_102292287 | |||
| 3031 | Ga0068851_10008330 | |||
| 3032 | Ga0068870_10001300 | |||
| 3033 | Ga0068870_10001633 | |||
| 3034 | Ga0068870_10070077 | |||
| 3035 | Ga0068870_10093138 | |||
| 3036 | Ga0068870_10175962 | |||
| 3037 | Ga0068870_10227024 | |||
| 3038 | Ga0068870_10286765 | |||
| 3039 | Ga0068870_10295454 | |||
| 3040 | Ga0068870_10546452 | |||
| 3041 | Ga0068863_100038250 | |||
| 3042 | Ga0068863_100048204 | |||
| 3043 | Ga0068863_100195048 | |||
| 3044 | Ga0068863_100257070 | |||
| 3045 | Ga0068863_100283463 | |||
| 3046 | Ga0068863_100424957 | |||
| 3047 | Ga0068863_100452050 | |||
| 3048 | Ga0068863_101498965 | |||
| 3049 | Ga0068858_100017073 | |||
| 3050 | Ga0068858_100030962 | |||
| 3051 | Ga0068858_100054231 | |||
| 3052 | Ga0068858_100097626 | |||
| 3053 | Ga0068858_100254281 | |||
| 3054 | Ga0068858_100392388 | |||
| 3055 | Ga0068858_100534810 | |||
| 3056 | Ga0068858_100683151 | |||
| 3057 | Ga0068858_100773927 | |||
| 3058 | Ga0068858_101379088 | |||
| 3059 | Ga0068860_100039378 | |||
| 3060 | Ga0068860_100082687 | |||
| 3061 | Ga0068860_100090769 | |||
| 3062 | Ga0068860_100099290 | |||
| 3063 | Ga0068860_100165563 | |||
| 3064 | Ga0068860_100333943 | |||
| 3065 | Ga0068860_100383341 | |||
| 3066 | Ga0068860_100545110 | |||
| 3067 | Ga0068860_100880500 | |||
| 3068 | Ga0068860_101031932 | |||
| 3069 | Ga0068860_101051118 | |||
| 3070 | Ga0068860_101087656 | |||
| 3071 | Ga0068860_101678394 | |||
| 3072 | Ga0068862_100013299 | |||
| 3073 | Ga0068862_100047732 | |||
| 3074 | Ga0068862_100111235 | |||
| 3075 | Ga0068862_100268664 | |||
| 3076 | Ga0068862_100286115 | |||
| 3077 | Ga0068862_100293778 | |||
| 3078 | Ga0068862_100306119 | |||
| 3079 | Ga0068862_100355664 | |||
| 3080 | Ga0068862_100413838 | |||
| 3081 | Ga0068862_100492625 | |||
| 3082 | Ga0068862_100691711 | |||
| 3083 | Ga0068862_100827062 | |||
| 3084 | Ga0068862_100956798 | |||
| 3085 | Ga0068862_101190983 | |||
| 3086 | Ga0081455_10057868 | |||
| 3087 | Ga0081538_10152633 | |||
| 3088 | Ga0081540_1137386 | |||
| 3089 | Ga0081539_10000108 | |||
| 3090 | Ga0081539_10007860 | |||
| 3091 | Ga0081539_10179236 | |||
| 3092 | Ga0070717_10728661 | |||
| 3093 | Ga0075432_10390965 | |||
| 3094 | Ga0070715_10047289 | |||
| 3095 | Ga0070715_10134085 | |||
| 3096 | Ga0070715_10423250 | |||
| 3097 | Ga0070716_100023189 | |||
| 3098 | Ga0070716_100032485 | |||
| 3099 | Ga0070716_100256523 | |||
| 3100 | Ga0070716_101333953 | |||
| 3101 | Ga0070712_100330337 | |||
| 3102 | Ga0070712_100391468 | |||
| 3103 | Ga0075427_10028816 | |||
| 3104 | Ga0097621_100025219 | |||
| 3105 | Ga0097621_100078017 | |||
| 3106 | Ga0097621_100218377 | |||
| 3107 | Ga0097621_100582596 | |||
| 3108 | Ga0097621_100832559 | |||
| 3109 | Ga0097621_101513991 | |||
| 3110 | Ga0097621_101554126 | |||
| 3111 | Ga0068871_100026774 | |||
| 3112 | Ga0068871_100041914 | |||
| 3113 | Ga0068871_100094937 | |||
| 3114 | Ga0068871_100097568 | |||
| 3115 | Ga0068871_100162369 | |||
| 3116 | Ga0068871_100217152 | |||
| 3117 | Ga0068871_100443768 | |||
| 3118 | Ga0068871_100456545 | |||
| 3119 | Ga0068871_100517313 | |||
| 3120 | Ga0068871_100595415 | |||
| 3121 | Ga0068871_100597052 | |||
| 3122 | Ga0068871_101269132 | |||
| 3123 | Ga0075428_100002503 | |||
| 3124 | Ga0075428_100006937 | |||
| 3125 | Ga0075428_100012836 | |||
| 3126 | Ga0075428_100020220 | |||
| 3127 | Ga0075428_100061510 | |||
| 3128 | Ga0075428_100090128 | |||
| 3129 | Ga0075428_100130458 | |||
| 3130 | Ga0075428_100327232 | |||
| 3131 | Ga0075428_100491466 | |||
| 3132 | Ga0075428_100738262 | |||
| 3133 | Ga0075428_100790527 | |||
| 3134 | Ga0075428_101000891 | |||
| 3135 | Ga0075428_101032446 | |||
| 3136 | Ga0075428_101623033 | |||
| 3137 | Ga0075428_102162335 | |||
| 3138 | Ga0075428_102601258 | |||
| 3139 | Ga0075430_100000873 | |||
| 3140 | Ga0075430_100015060 | |||
| 3141 | Ga0075430_100018191 | |||
| 3142 | Ga0075430_100026375 | |||
| 3143 | Ga0075430_100043483 | |||
| 3144 | Ga0075430_100049041 | |||
| 3145 | Ga0075430_100055897 | |||
| 3146 | Ga0075430_100064554 | |||
| 3147 | Ga0075430_100074105 | |||
| 3148 | Ga0075430_100085976 | |||
| 3149 | Ga0075430_100265303 | |||
| 3150 | Ga0075430_100289868 | |||
| 3151 | Ga0075430_100372556 | |||
| 3152 | Ga0075430_100591977 | |||
| 3153 | Ga0075430_100897384 | |||
| 3154 | Ga0075431_100003195 | |||
| 3155 | Ga0075431_100004132 | |||
| 3156 | Ga0075431_100007106 | |||
| 3157 | Ga0075431_100009445 | |||
| 3158 | Ga0075431_100010296 | |||
| 3159 | Ga0075431_100024633 | |||
| 3160 | Ga0075431_100034803 | |||
| 3161 | Ga0075431_100066052 | |||
| 3162 | Ga0075431_100177843 | |||
| 3163 | Ga0075431_100247943 | |||
| 3164 | Ga0075431_100385160 | |||
| 3165 | Ga0075431_100652861 | |||
| 3166 | Ga0075431_100867741 | |||
| 3167 | Ga0075431_101027438 | |||
| 3168 | Ga0075431_101731710 | |||
| 3169 | Ga0075433_10001964 | |||
| 3170 | Ga0075433_10002635 | |||
| 3171 | Ga0075433_10002785 | |||
| 3172 | Ga0075433_10012123 | |||
| 3173 | Ga0075433_10045690 | |||
| 3174 | Ga0075433_10099334 | |||
| 3175 | Ga0075433_10108052 | |||
| 3176 | Ga0075433_10148605 | |||
| 3177 | Ga0075433_10177930 | |||
| 3178 | Ga0075433_10198405 | |||
| 3179 | Ga0075433_10222377 | |||
| 3180 | Ga0075433_10223755 | |||
| 3181 | Ga0075433_10229109 | |||
| 3182 | Ga0075433_10268775 | |||
| 3183 | Ga0075433_10416266 | |||
| 3184 | Ga0075433_10550524 | |||
| 3185 | Ga0075433_10865046 | |||
| 3186 | Ga0075434_100001499 | |||
| 3187 | Ga0075434_100002432 | |||
| 3188 | Ga0075434_100007378 | |||
| 3189 | Ga0075434_100014134 | |||
| 3190 | Ga0075434_100014265 | |||
| 3191 | Ga0075434_100014411 | |||
| 3192 | Ga0075434_100024080 | |||
| 3193 | Ga0075434_100030949 | |||
| 3194 | Ga0075434_100031338 | |||
| 3195 | Ga0075434_100054964 | |||
| 3196 | Ga0075434_100071219 | |||
| 3197 | Ga0075434_100098646 | |||
| 3198 | Ga0075434_100105863 | |||
| 3199 | Ga0075434_100117136 | |||
| 3200 | Ga0075434_100399683 | |||
| 3201 | Ga0075434_100444826 | |||
| 3202 | Ga0075434_100477442 | |||
| 3203 | Ga0075434_100772640 | |||
| 3204 | Ga0075434_101183738 | |||
| 3205 | Ga0075434_101360941 | |||
| 3206 | Ga0075434_101537998 | |||
| 3207 | Ga0075429_100001904 | |||
| 3208 | Ga0075429_100008495 | |||
| 3209 | Ga0075429_100028175 | |||
| 3210 | Ga0075429_100067128 | |||
| 3211 | Ga0075429_100093453 | |||
| 3212 | Ga0075429_100101061 | |||
| 3213 | Ga0075429_100152221 | |||
| 3214 | Ga0075429_100238837 | |||
| 3215 | Ga0068865_100013773 | |||
| 3216 | Ga0068865_100016245 | |||
| 3217 | Ga0068865_100095830 | |||
| 3218 | Ga0068865_100170272 | |||
| 3219 | Ga0068865_100230435 | |||
| 3220 | Ga0068865_100232903 | |||
| 3221 | Ga0068865_100386714 | |||
| 3222 | Ga0068865_100389233 | |||
| 3223 | Ga0068865_100437653 | |||
| 3224 | Ga0068865_101687496 | |||
| 3225 | Ga0075436_100000356 | |||
| 3226 | Ga0075436_100002771 | |||
| 3227 | Ga0075436_100017107 | |||
| 3228 | Ga0075436_100023294 | |||
| 3229 | Ga0075436_100032806 | |||
| 3230 | Ga0075436_100039317 | |||
| 3231 | Ga0075436_100043036 | |||
| 3232 | Ga0075436_100050959 | |||
| 3233 | Ga0075436_100051726 | |||
| 3234 | Ga0075436_100250228 | |||
| 3235 | Ga0075436_100279350 | |||
| 3236 | Ga0075436_100375987 | |||
| 3237 | Ga0075436_100407963 | |||
| 3238 | Ga0075436_100524808 | |||
| 3239 | Ga0075436_100670170 | |||
| 3240 | Ga0075436_100716082 | |||
| 3241 | Ga0097620_100028926 | |||
| 3242 | Ga0097620_100193212 | |||
| 3243 | Ga0097620_100233500 | |||
| 3244 | Ga0097620_100260867 | |||
| 3245 | Ga0097620_100262034 | |||
| 3246 | Ga0097620_100270779 | |||
| 3247 | Ga0097620_100272534 | |||
| 3248 | Ga0097620_100292439 | |||
| 3249 | Ga0097620_102289330 | |||
| 3250 | Ga0075435_100000113 | |||
| 3251 | Ga0075435_100004401 | |||
| 3252 | Ga0075435_100013013 | |||
| 3253 | Ga0075435_100020007 | |||
| 3254 | Ga0075435_100026283 | |||
| 3255 | Ga0075435_100027142 | |||
| 3256 | Ga0075435_100178030 | |||
| 3257 | Ga0075435_100183672 | |||
| 3258 | Ga0075435_100313277 | |||
| 3259 | Ga0075435_100350279 | |||
| 3260 | Ga0075435_100662809 | |||
| 3261 | Ga0099794_10000007 | |||
| 3262 | Ga0099794_10024997 | |||
| 3263 | Ga0105240_10002683 | |||
| 3264 | Ga0105240_10003253 | |||
| 3265 | Ga0105240_10104835 | |||
| 3266 | Ga0105240_10126706 | |||
| 3267 | Ga0105240_10203280 | |||
| 3268 | Ga0105240_10327750 | |||
| 3269 | Ga0105240_10479287 | |||
| 3270 | Ga0105240_10516841 | |||
| 3271 | Ga0105240_10568342 | |||
| 3272 | Ga0105240_12669976 | |||
| 3273 | Ga0111539_10001040 | |||
| 3274 | Ga0111539_10001085 | |||
| 3275 | Ga0111539_10002183 | |||
| 3276 | Ga0111539_10006175 | |||
| 3277 | Ga0111539_10016472 | |||
| 3278 | Ga0111539_10047130 | |||
| 3279 | Ga0111539_10052961 | |||
| 3280 | Ga0111539_10066706 | |||
| 3281 | Ga0111539_10071582 | |||
| 3282 | Ga0111539_10078900 | |||
| 3283 | Ga0111539_10096368 | |||
| 3284 | Ga0111539_10131226 | |||
| 3285 | Ga0111539_10163847 | |||
| 3286 | Ga0111539_10293546 | |||
| 3287 | Ga0111539_10408753 | |||
| 3288 | Ga0111539_10567793 | |||
| 3289 | Ga0111539_11031329 | |||
| 3290 | Ga0111539_11184079 | |||
| 3291 | Ga0111539_11216711 | |||
| 3292 | Ga0111539_12973914 | |||
| 3293 | Ga0105245_10033892 | |||
| 3294 | Ga0105245_10124755 | |||
| 3295 | Ga0105245_10218985 | |||
| 3296 | Ga0105245_10719633 | |||
| 3297 | Ga0105245_11904214 | |||
| 3298 | Ga0105245_12114435 | |||
| 3299 | Ga0105245_12253917 | |||
| 3300 | Ga0105245_13243345 | |||
| 3301 | Ga0105247_10207655 | |||
| 3302 | Ga0105247_10682958 | |||
| 3303 | Ga0105247_11517464 | |||
| 3304 | Ga0114129_10001846 | |||
| 3305 | Ga0114129_10002364 | |||
| 3306 | Ga0114129_10007495 | |||
| 3307 | Ga0114129_10009760 | |||
| 3308 | Ga0114129_10017684 | |||
| 3309 | Ga0114129_10030411 | |||
| 3310 | Ga0114129_10049144 | |||
| 3311 | Ga0114129_10078971 | |||
| 3312 | Ga0114129_10110713 | |||
| 3313 | Ga0114129_10112552 | |||
| 3314 | Ga0114129_10186126 | |||
| 3315 | Ga0114129_10188429 | |||
| 3316 | Ga0114129_10238632 | |||
| 3317 | Ga0114129_10278451 | |||
| 3318 | Ga0114129_10311447 | |||
| 3319 | Ga0114129_10326076 | |||
| 3320 | Ga0114129_10394335 | |||
| 3321 | Ga0114129_10454294 | |||
| 3322 | Ga0114129_10575343 | |||
| 3323 | Ga0114129_10704166 | |||
| 3324 | Ga0114129_10731174 | |||
| 3325 | Ga0114129_10764679 | |||
| 3326 | Ga0114129_12096045 | |||
| 3327 | Ga0105243_10015027 | |||
| 3328 | Ga0105243_10152190 | |||
| 3329 | Ga0105243_10316841 | |||
| 3330 | Ga0105243_10402377 | |||
| 3331 | Ga0105243_10556551 | |||
| 3332 | Ga0105243_10575253 | |||
| 3333 | Ga0105243_11765444 | |||
| 3334 | Ga0105243_12378397 | |||
| 3335 | Ga0105241_10085831 | |||
| 3336 | Ga0105241_10354963 | |||
| 3337 | Ga0105241_11812499 | |||
| 3338 | Ga0105242_10015390 | |||
| 3339 | Ga0105242_10027708 | |||
| 3340 | Ga0105242_10118795 | |||
| 3341 | Ga0105242_10129402 | |||
| 3342 | Ga0105242_10179613 | |||
| 3343 | Ga0105242_10232274 | |||
| 3344 | Ga0105242_11178438 | |||
| 3345 | Ga0105242_12208377 | |||
| 3346 | Ga0105242_13038370 | |||
| 3347 | Ga0105248_10021241 | |||
| 3348 | Ga0105248_10075790 | |||
| 3349 | Ga0105248_10168406 | |||
| 3350 | Ga0105248_10172992 | |||
| 3351 | Ga0105248_10225357 | |||
| 3352 | Ga0105248_10255790 | |||
| 3353 | Ga0105248_10815054 | |||
| 3354 | Ga0105248_10920619 | |||
| 3355 | Ga0105248_10968478 | |||
| 3356 | Ga0105248_11452407 | |||
| 3357 | Ga0105248_12280263 | |||
| 3358 | Ga0105248_12489132 | |||
| 3359 | Ga0105237_10508580 | |||
| 3360 | Ga0105238_10002348 | |||
| 3361 | Ga0105238_10057028 | |||
| 3362 | Ga0105238_10124984 | |||
| 3363 | Ga0105238_10127262 | |||
| 3364 | Ga0105238_10169090 | |||
| 3365 | Ga0105238_11442205 | |||
| 3366 | Ga0105238_11638091 | |||
| 3367 | Ga0105249_10000825 | |||
| 3368 | Ga0105249_10044702 | |||
| 3369 | Ga0105249_10165860 | |||
| 3370 | Ga0105249_10474714 | |||
| 3371 | Ga0105249_10479170 | |||
| 3372 | Ga0105249_10869617 | |||
| 3373 | Ga0105249_10890373 | |||
| 3374 | Ga0105249_12707172 | |||
| 3375 | Ga0105249_13213033 | |||
| 3376 | Ga0099796_10105567 | |||
| 3377 | Ga0105239_10004786 | |||
| 3378 | Ga0105239_13408506 | |||
| 3379 | Ga0105246_10009743 | |||
| 3380 | Ga0105246_10209617 | |||
| 3381 | Ga0105246_10294862 | |||
| 3382 | Ga0105246_10661881 | |||
| 3383 | Ga0157373_10011946 | |||
| 3384 | Ga0157373_10016274 | |||
| 3385 | Ga0157373_10023468 | |||
| 3386 | Ga0157373_10044551 | |||
| 3387 | Ga0157371_10929898 | |||
| 3388 | Ga0157371_11367586 | |||
| 3389 | Ga0157370_10001452 | |||
| 3390 | Ga0157370_10005166 | |||
| 3391 | Ga0157370_10052762 | |||
| 3392 | Ga0157370_10053557 | |||
| 3393 | Ga0157370_10178566 | |||
| 3394 | Ga0157370_11142105 | |||
| 3395 | Ga0157369_10007789 | |||
| 3396 | Ga0157369_10040763 | |||
| 3397 | Ga0157369_10180770 | |||
| 3398 | Ga0157369_10490860 | |||
| 3399 | Ga0157369_10613123 | |||
| 3400 | Ga0157369_11490482 | |||
| 3401 | Ga0157374_10191057 | |||
| 3402 | Ga0157374_10338552 | |||
| 3403 | Ga0157378_10338601 | |||
| 3404 | Ga0157378_10758291 | |||
| 3405 | Ga0157378_11122575 | |||
| 3406 | Ga0157378_12556740 | |||
| 3407 | Ga0157378_13067751 | |||
| 3408 | Ga0157378_13291542 | |||
| 3409 | Ga0163162_10001847 | |||
| 3410 | Ga0163162_10507677 | |||
| 3411 | Ga0163162_11170273 | |||
| 3412 | Ga0163162_11958896 | |||
| 3413 | Ga0163162_12832122 | |||
| 3414 | Ga0163162_12920677 | |||
| 3415 | Ga0157372_10005429 | |||
| 3416 | Ga0157372_10036630 | |||
| 3417 | Ga0157372_10039040 | |||
| 3418 | Ga0157372_10055903 | |||
| 3419 | Ga0157372_10169547 | |||
| 3420 | Ga0157372_10229821 | |||
| 3421 | Ga0157372_10319171 | |||
| 3422 | Ga0157372_11688095 | |||
| 3423 | Ga0157372_12697982 | |||
| 3424 | Ga0157375_10127392 | |||
| 3425 | Ga0157375_10272178 | |||
| 3426 | Ga0157375_10277031 | |||
| 3427 | Ga0157375_10284816 | |||
| 3428 | Ga0157375_10285563 | |||
| 3429 | Ga0157375_10300603 | |||
| 3430 | Ga0157375_10311951 | |||
| 3431 | Ga0157375_10384164 | |||
| 3432 | Ga0157375_10614849 | |||
| 3433 | Ga0157375_10637978 | |||
| 3434 | Ga0157375_10738830 | |||
| 3435 | Ga0157375_10985126 | |||
| 3436 | Ga0157375_11016452 | |||
| 3437 | Ga0157375_11078015 | |||
| 3438 | Ga0157375_11857302 | |||
| 3439 | Ga0157375_12147679 | |||
| 3440 | Ga0157375_12897132 | |||
| 3441 | Ga0163163_10007877 | |||
| 3442 | Ga0163163_10019382 | |||
| 3443 | Ga0163163_10081920 | |||
| 3444 | Ga0163163_10096450 | |||
| 3445 | Ga0163163_10233192 | |||
| 3446 | Ga0163163_10361475 | |||
| 3447 | Ga0163163_10370638 | |||
| 3448 | Ga0163163_10499909 | |||
| 3449 | Ga0163163_10676790 | |||
| 3450 | Ga0163163_11924207 | |||
| 3451 | Ga0157380_10027153 | |||
| 3452 | Ga0157380_10030364 | |||
| 3453 | Ga0157380_10049595 | |||
| 3454 | Ga0157380_10054117 | |||
| 3455 | Ga0157380_10096378 | |||
| 3456 | Ga0157380_10137965 | |||
| 3457 | Ga0157380_10157528 | |||
| 3458 | Ga0157380_10166067 | |||
| 3459 | Ga0157380_10166629 | |||
| 3460 | Ga0157380_10334714 | |||
| 3461 | Ga0157380_10418631 | |||
| 3462 | Ga0157380_10525981 | |||
| 3463 | Ga0157380_10771304 | |||
| 3464 | Ga0157380_10833193 | |||
| 3465 | Ga0157380_12677001 | |||
| 3466 | Ga0182008_10004666 | |||
| 3467 | Ga0182008_10161236 | |||
| 3468 | Ga0157377_10003339 | |||
| 3469 | Ga0157377_10018588 | |||
| 3470 | Ga0157377_10177623 | |||
| 3471 | Ga0157377_10264754 | |||
| 3472 | Ga0157377_10795675 | |||
| 3473 | Ga0157379_10037344 | |||
| 3474 | Ga0157379_10677501 | |||
| 3475 | Ga0157379_11204611 | |||
| 3476 | Ga0157376_10001404 | |||
| 3477 | Ga0157376_10021103 | |||
| 3478 | Ga0157376_10276699 | |||
| 3479 | Ga0157376_10550490 | |||
| 3480 | Ga0157376_10784708 | |||
| 3481 | Ga0157376_10801184 | |||
| 3482 | Ga0157376_10900674 | |||
| 3483 | Ga0157376_10926300 | |||
| 3484 | Ga0157376_11240490 | |||
| 3485 | Ga0157376_11272856 | |||
| 3486 | Ga0157376_12285219 | |||
| 3487 | Ga0163161_10184710 | |||
| 3488 | Ga0163161_10221280 | |||
| 3489 | Ga0163161_10576072 | |||
| 3490 | Ga0163161_10851744 | |||
| 3491 | Ga0163161_11802577 | |||
| 3492 | Ga0197907_10337954 | |||
| 3493 | Ga0206356_11445921 | |||
| 3494 | Ga0206350_11074823 | |||
| 3495 | Ga0206353_10037599 | |||
| 3496 | Ga0224712_10057516 | |||
| 3497 | Ga0224712_10209050 | |||
| 3498 | Ga0207673_1017334 | |||
| 3499 | Ga0207697_10000290 | |||
| 3500 | Ga0207697_10048608 | |||
| 3501 | Ga0207697_10063931 | |||
| 3502 | Ga0207697_10165079 | |||
| 3503 | Ga0207656_10002379 | |||
| 3504 | Ga0207653_10006143 | |||
| 3505 | Ga0207653_10008062 | |||
| 3506 | Ga0207653_10068657 | |||
| 3507 | Ga0207653_10233010 | |||
| 3508 | Ga0207653_10420276 | |||
| 3509 | Ga0207682_10025221 | |||
| 3510 | Ga0207682_10048926 | |||
| 3511 | Ga0207682_10096728 | |||
| 3512 | Ga0207682_10097245 | |||
| 3513 | Ga0207682_10129240 | |||
| 3514 | Ga0207682_10307929 | |||
| 3515 | Ga0207682_10534962 | |||
| 3516 | Ga0207692_10614172 | |||
| 3517 | Ga0207692_10785631 | |||
| 3518 | Ga0207642_10006179 | |||
| 3519 | Ga0207642_10395982 | |||
| 3520 | Ga0207642_10611221 | |||
| 3521 | Ga0207642_11015684 | |||
| 3522 | Ga0207642_11144946 | |||
| 3523 | Ga0207710_10125341 | |||
| 3524 | Ga0207710_10267451 | |||
| 3525 | Ga0207710_10600673 | |||
| 3526 | Ga0207688_10007175 | |||
| 3527 | Ga0207688_10051452 | |||
| 3528 | Ga0207688_10361557 | |||
| 3529 | Ga0207688_10491886 | |||
| 3530 | Ga0207688_10619106 | |||
| 3531 | Ga0207688_11091252 | |||
| 3532 | Ga0207680_10009037 | |||
| 3533 | Ga0207680_10041513 | |||
| 3534 | Ga0207680_10102494 | |||
| 3535 | Ga0207680_10145503 | |||
| 3536 | Ga0207680_10321882 | |||
| 3537 | Ga0207680_10500953 | |||
| 3538 | Ga0207680_10786866 | |||
| 3539 | Ga0207647_10377182 | |||
| 3540 | Ga0207685_10046306 | |||
| 3541 | Ga0207685_10408999 | |||
| 3542 | Ga0207685_10449518 | |||
| 3543 | Ga0207685_10473186 | |||
| 3544 | Ga0207699_10002101 | |||
| 3545 | Ga0207699_10022339 | |||
| 3546 | Ga0207699_10505717 | |||
| 3547 | Ga0207699_10629689 | |||
| 3548 | Ga0207699_10772765 | |||
| 3549 | Ga0207699_10782776 | |||
| 3550 | Ga0207699_11182218 | |||
| 3551 | Ga0207645_10000851 | |||
| 3552 | Ga0207645_10004993 | |||
| 3553 | Ga0207645_10058721 | |||
| 3554 | Ga0207645_10123659 | |||
| 3555 | Ga0207645_10423155 | |||
| 3556 | Ga0207645_10469574 | |||
| 3557 | Ga0207645_10555736 | |||
| 3558 | Ga0207645_11047310 | |||
| 3559 | Ga0207643_10004495 | |||
| 3560 | Ga0207643_10006402 | |||
| 3561 | Ga0207643_10026911 | |||
| 3562 | Ga0207643_10059100 | |||
| 3563 | Ga0207643_10069640 | |||
| 3564 | Ga0207643_10106967 | |||
| 3565 | Ga0207643_10190539 | |||
| 3566 | Ga0207643_10209165 | |||
| 3567 | Ga0207643_10224446 | |||
| 3568 | Ga0207705_10212200 | |||
| 3569 | Ga0207705_10474310 | |||
| 3570 | Ga0207705_10577775 | |||
| 3571 | Ga0207705_11004575 | |||
| 3572 | Ga0207684_10004990 | |||
| 3573 | Ga0207684_10069427 | |||
| 3574 | Ga0207684_10216318 | |||
| 3575 | Ga0207684_10292983 | |||
| 3576 | Ga0207684_10495300 | |||
| 3577 | Ga0207684_11546278 | |||
| 3578 | Ga0207654_10146592 | |||
| 3579 | Ga0207654_10576432 | |||
| 3580 | Ga0207707_10004354 | |||
| 3581 | Ga0207707_10005219 | |||
| 3582 | Ga0207707_10013449 | |||
| 3583 | Ga0207707_10015352 | |||
| 3584 | Ga0207707_10175138 | |||
| 3585 | Ga0207707_10177616 | |||
| 3586 | Ga0207707_10365189 | |||
| 3587 | Ga0207707_11015186 | |||
| 3588 | Ga0207707_11350272 | |||
| 3589 | Ga0207695_10002961 | |||
| 3590 | Ga0207695_10005696 | |||
| 3591 | Ga0207695_10010835 | |||
| 3592 | Ga0207695_10018997 | |||
| 3593 | Ga0207695_10021287 | |||
| 3594 | Ga0207695_10060208 | |||
| 3595 | Ga0207695_10083033 | |||
| 3596 | Ga0207695_10251114 | |||
| 3597 | Ga0207695_10464662 | |||
| 3598 | Ga0207695_10698361 | |||
| 3599 | Ga0207693_10158962 | |||
| 3600 | Ga0207693_10430119 | |||
| 3601 | Ga0207663_10000013 | |||
| 3602 | Ga0207663_10119472 | |||
| 3603 | Ga0207660_10003505 | |||
| 3604 | Ga0207660_10012077 | |||
| 3605 | Ga0207660_10022201 | |||
| 3606 | Ga0207660_10041754 | |||
| 3607 | Ga0207660_10044390 | |||
| 3608 | Ga0207660_10046121 | |||
| 3609 | Ga0207660_10070072 | |||
| 3610 | Ga0207660_10087241 | |||
| 3611 | Ga0207660_10421199 | |||
| 3612 | Ga0207660_10657008 | |||
| 3613 | Ga0207660_10748746 | |||
| 3614 | Ga0207660_10944524 | |||
| 3615 | Ga0207662_10001075 | |||
| 3616 | Ga0207662_10026933 | |||
| 3617 | Ga0207662_10081538 | |||
| 3618 | Ga0207662_10120288 | |||
| 3619 | Ga0207662_10263484 | |||
| 3620 | Ga0207662_10394169 | |||
| 3621 | Ga0207662_10491930 | |||
| 3622 | Ga0207662_10616872 | |||
| 3623 | Ga0207657_10083333 | |||
| 3624 | Ga0207657_10393414 | |||
| 3625 | Ga0207657_10589591 | |||
| 3626 | Ga0207657_10850712 | |||
| 3627 | Ga0207649_10029688 | |||
| 3628 | Ga0207649_10037416 | |||
| 3629 | Ga0207649_10053767 | |||
| 3630 | Ga0207649_10129782 | |||
| 3631 | Ga0207652_10015543 | |||
| 3632 | Ga0207652_10015852 | |||
| 3633 | Ga0207652_10027630 | |||
| 3634 | Ga0207652_10035883 | |||
| 3635 | Ga0207652_10078569 | |||
| 3636 | Ga0207652_10112310 | |||
| 3637 | Ga0207652_10113362 | |||
| 3638 | Ga0207652_10189204 | |||
| 3639 | Ga0207652_10353554 | |||
| 3640 | Ga0207652_10527211 | |||
| 3641 | Ga0207652_10586836 | |||
| 3642 | Ga0207652_10754636 | |||
| 3643 | Ga0207652_11907823 | |||
| 3644 | Ga0207646_10012007 | |||
| 3645 | Ga0207646_10038236 | |||
| 3646 | Ga0207646_10049626 | |||
| 3647 | Ga0207646_10056781 | |||
| 3648 | Ga0207646_10120836 | |||
| 3649 | Ga0207646_10181257 | |||
| 3650 | Ga0207646_10263446 | |||
| 3651 | Ga0207646_10542085 | |||
| 3652 | Ga0207646_10692585 | |||
| 3653 | Ga0207646_11454576 | |||
| 3654 | Ga0207681_10003409 | |||
| 3655 | Ga0207681_10005701 | |||
| 3656 | Ga0207681_10025838 | |||
| 3657 | Ga0207681_10032616 | |||
| 3658 | Ga0207681_10069907 | |||
| 3659 | Ga0207681_10086563 | |||
| 3660 | Ga0207681_10088630 | |||
| 3661 | Ga0207681_10149451 | |||
| 3662 | Ga0207681_10257517 | |||
| 3663 | Ga0207681_10388683 | |||
| 3664 | Ga0207681_10704819 | |||
| 3665 | Ga0207681_11540315 | |||
| 3666 | Ga0207694_10002177 | |||
| 3667 | Ga0207694_10025502 | |||
| 3668 | Ga0207694_10097846 | |||
| 3669 | Ga0207694_10378453 | |||
| 3670 | Ga0207650_10032311 | |||
| 3671 | Ga0207650_10047751 | |||
| 3672 | Ga0207650_10105626 | |||
| 3673 | Ga0207650_10256613 | |||
| 3674 | Ga0207650_10306627 | |||
| 3675 | Ga0207650_10584363 | |||
| 3676 | Ga0207650_11696566 | |||
| 3677 | Ga0207650_11774620 | |||
| 3678 | Ga0207659_10002837 | |||
| 3679 | Ga0207659_10013483 | |||
| 3680 | Ga0207659_10044943 | |||
| 3681 | Ga0207659_10046234 | |||
| 3682 | Ga0207659_10065431 | |||
| 3683 | Ga0207659_10091714 | |||
| 3684 | Ga0207659_10103140 | |||
| 3685 | Ga0207659_10114348 | |||
| 3686 | Ga0207659_10116492 | |||
| 3687 | Ga0207659_10294533 | |||
| 3688 | Ga0207659_10326061 | |||
| 3689 | Ga0207659_10328900 | |||
| 3690 | Ga0207659_10378935 | |||
| 3691 | Ga0207659_10436669 | |||
| 3692 | Ga0207659_10504110 | |||
| 3693 | Ga0207659_10602587 | |||
| 3694 | Ga0207659_10632785 | |||
| 3695 | Ga0207659_10671578 | |||
| 3696 | Ga0207659_11814622 | |||
| 3697 | Ga0207687_10202947 | |||
| 3698 | Ga0207687_10226143 | |||
| 3699 | Ga0207687_11004914 | |||
| 3700 | Ga0207687_11932830 | |||
| 3701 | Ga0207700_10003894 | |||
| 3702 | Ga0207700_10053732 | |||
| 3703 | Ga0207700_10063270 | |||
| 3704 | Ga0207700_11381634 | |||
| 3705 | Ga0207664_10005254 | |||
| 3706 | Ga0207664_10092694 | |||
| 3707 | Ga0207664_10266543 | |||
| 3708 | Ga0207644_10056290 | |||
| 3709 | Ga0207644_10192621 | |||
| 3710 | Ga0207644_10233948 | |||
| 3711 | Ga0207644_10245580 | |||
| 3712 | Ga0207644_10569969 | |||
| 3713 | Ga0207644_10601592 | |||
| 3714 | Ga0207644_10679931 | |||
| 3715 | Ga0207644_10935434 | |||
| 3716 | Ga0207690_10263750 | |||
| 3717 | Ga0207690_10334074 | |||
| 3718 | Ga0207690_10807451 | |||
| 3719 | Ga0207690_11404399 | |||
| 3720 | Ga0207706_10013724 | |||
| 3721 | Ga0207706_10026001 | |||
| 3722 | Ga0207706_10061499 | |||
| 3723 | Ga0207706_10152038 | |||
| 3724 | Ga0207706_10160169 | |||
| 3725 | Ga0207706_10317720 | |||
| 3726 | Ga0207706_10460301 | |||
| 3727 | Ga0207706_10580996 | |||
| 3728 | Ga0207706_10660981 | |||
| 3729 | Ga0207706_10936592 | |||
| 3730 | Ga0207706_11276041 | |||
| 3731 | Ga0207686_10037703 | |||
| 3732 | Ga0207686_10056018 | |||
| 3733 | Ga0207686_10172315 | |||
| 3734 | Ga0207686_10302983 | |||
| 3735 | Ga0207686_10680487 | |||
| 3736 | Ga0207709_10007381 | |||
| 3737 | Ga0207709_10420513 | |||
| 3738 | Ga0207709_10440127 | |||
| 3739 | Ga0207709_10628963 | |||
| 3740 | Ga0207670_10038868 | |||
| 3741 | Ga0207670_10078935 | |||
| 3742 | Ga0207670_10311895 | |||
| 3743 | Ga0207670_10563273 | |||
| 3744 | Ga0207670_10893376 | |||
| 3745 | Ga0207670_10942173 | |||
| 3746 | Ga0207670_10988527 | |||
| 3747 | Ga0207669_10002012 | |||
| 3748 | Ga0207669_10096997 | |||
| 3749 | Ga0207669_10100248 | |||
| 3750 | Ga0207669_10223731 | |||
| 3751 | Ga0207669_10258731 | |||
| 3752 | Ga0207669_10328713 | |||
| 3753 | Ga0207669_10946961 | |||
| 3754 | Ga0207669_11239813 | |||
| 3755 | Ga0207704_10124377 | |||
| 3756 | Ga0207704_10167909 | |||
| 3757 | Ga0207704_10256762 | |||
| 3758 | Ga0207704_10329796 | |||
| 3759 | Ga0207704_10362494 | |||
| 3760 | Ga0207704_10801063 | |||
| 3761 | Ga0207704_11030139 | |||
| 3762 | Ga0207665_10002991 | |||
| 3763 | Ga0207665_10010374 | |||
| 3764 | Ga0207665_10143891 | |||
| 3765 | Ga0207665_10451797 | |||
| 3766 | Ga0207665_10955907 | |||
| 3767 | Ga0207691_10001071 | |||
| 3768 | Ga0207691_10005950 | |||
| 3769 | Ga0207691_10018752 | |||
| 3770 | Ga0207691_10024050 | |||
| 3771 | Ga0207691_10035046 | |||
| 3772 | Ga0207691_10052019 | |||
| 3773 | Ga0207691_10123900 | |||
| 3774 | Ga0207691_10143494 | |||
| 3775 | Ga0207691_10156448 | |||
| 3776 | Ga0207691_10207177 | |||
| 3777 | Ga0207691_10223531 | |||
| 3778 | Ga0207691_10834803 | |||
| 3779 | Ga0207691_11001379 | |||
| 3780 | Ga0207711_10058614 | |||
| 3781 | Ga0207711_10112995 | |||
| 3782 | Ga0207711_10231482 | |||
| 3783 | Ga0207711_10843093 | |||
| 3784 | Ga0207711_10971700 | |||
| 3785 | Ga0207711_11268065 | |||
| 3786 | Ga0207689_10000987 | |||
| 3787 | Ga0207689_10012190 | |||
| 3788 | Ga0207689_10044715 | |||
| 3789 | Ga0207689_10105201 | |||
| 3790 | Ga0207689_10267004 | |||
| 3791 | Ga0207689_10347280 | |||
| 3792 | Ga0207689_10415824 | |||
| 3793 | Ga0207689_10566481 | |||
| 3794 | Ga0207689_10575985 | |||
| 3795 | Ga0207689_11781535 | |||
| 3796 | Ga0207661_10005427 | |||
| 3797 | Ga0207661_10040416 | |||
| 3798 | Ga0207661_10245415 | |||
| 3799 | Ga0207661_10606906 | |||
| 3800 | Ga0207661_11977224 | |||
| 3801 | Ga0207679_10012887 | |||
| 3802 | Ga0207679_10185398 | |||
| 3803 | Ga0207679_10231981 | |||
| 3804 | Ga0207679_10244143 | |||
| 3805 | Ga0207679_10271323 | |||
| 3806 | Ga0207679_10331842 | |||
| 3807 | Ga0207679_10477170 | |||
| 3808 | Ga0207679_11247691 | |||
| 3809 | Ga0207679_11439474 | |||
| 3810 | Ga0207679_11916802 | |||
| 3811 | Ga0207667_10054172 | |||
| 3812 | Ga0207667_10232265 | |||
| 3813 | Ga0207667_10258617 | |||
| 3814 | Ga0207667_10452992 | |||
| 3815 | Ga0207667_10477485 | |||
| 3816 | Ga0207651_10012653 | |||
| 3817 | Ga0207651_10035322 | |||
| 3818 | Ga0207651_10039932 | |||
| 3819 | Ga0207651_10079139 | |||
| 3820 | Ga0207651_10095871 | |||
| 3821 | Ga0207651_10328799 | |||
| 3822 | Ga0207651_10436948 | |||
| 3823 | Ga0207651_10521152 | |||
| 3824 | Ga0207651_10797188 | |||
| 3825 | Ga0207651_10979349 | |||
| 3826 | Ga0207651_11202695 | |||
| 3827 | Ga0207651_11263093 | |||
| 3828 | Ga0207651_11487955 | |||
| 3829 | Ga0207712_10000080 | |||
| 3830 | Ga0207712_10017935 | |||
| 3831 | Ga0207712_10068054 | |||
| 3832 | Ga0207712_10083673 | |||
| 3833 | Ga0207712_10409416 | |||
| 3834 | Ga0207712_10593883 | |||
| 3835 | Ga0207712_11525986 | |||
| 3836 | Ga0207712_11667823 | |||
| 3837 | Ga0207712_11751927 | |||
| 3838 | Ga0207712_11852496 | |||
| 3839 | Ga0207668_10022416 | |||
| 3840 | Ga0207668_10045674 | |||
| 3841 | Ga0207668_10148738 | |||
| 3842 | Ga0207668_10152015 | |||
| 3843 | Ga0207668_10159119 | |||
| 3844 | Ga0207668_10186501 | |||
| 3845 | Ga0207668_10389634 | |||
| 3846 | Ga0207668_10579569 | |||
| 3847 | Ga0207640_10004506 | |||
| 3848 | Ga0207640_10028150 | |||
| 3849 | Ga0207640_10029667 | |||
| 3850 | Ga0207640_10071495 | |||
| 3851 | Ga0207640_10147498 | |||
| 3852 | Ga0207640_10579061 | |||
| 3853 | Ga0207640_10659765 | |||
| 3854 | Ga0207658_10042379 | |||
| 3855 | Ga0207658_10160825 | |||
| 3856 | Ga0207658_10388742 | |||
| 3857 | Ga0207658_10503109 | |||
| 3858 | Ga0207658_10917671 | |||
| 3859 | Ga0207658_11515735 | |||
| 3860 | Ga0207677_10056884 | |||
| 3861 | Ga0207677_10138148 | |||
| 3862 | Ga0207677_10156492 | |||
| 3863 | Ga0207677_11294686 | |||
| 3864 | Ga0207703_10060686 | |||
| 3865 | Ga0207703_10160044 | |||
| 3866 | Ga0207703_10160050 | |||
| 3867 | Ga0207703_10160542 | |||
| 3868 | Ga0207703_10196440 | |||
| 3869 | Ga0207703_10208289 | |||
| 3870 | Ga0207703_10484474 | |||
| 3871 | Ga0207703_10631665 | |||
| 3872 | Ga0207703_11023321 | |||
| 3873 | Ga0207703_11201673 | |||
| 3874 | Ga0207703_11709885 | |||
| 3875 | Ga0207639_10019272 | |||
| 3876 | Ga0207639_10091255 | |||
| 3877 | Ga0207639_10398118 | |||
| 3878 | Ga0207639_11507621 | |||
| 3879 | Ga0207639_11644678 | |||
| 3880 | Ga0207678_10010477 | |||
| 3881 | Ga0207678_10025357 | |||
| 3882 | Ga0207678_10038024 | |||
| 3883 | Ga0207678_10204380 | |||
| 3884 | Ga0207678_10255654 | |||
| 3885 | Ga0207678_10589722 | |||
| 3886 | Ga0207708_10010914 | |||
| 3887 | Ga0207708_10041086 | |||
| 3888 | Ga0207708_10044635 | |||
| 3889 | Ga0207708_10051393 | |||
| 3890 | Ga0207708_10093078 | |||
| 3891 | Ga0207708_10108177 | |||
| 3892 | Ga0207708_10163144 | |||
| 3893 | Ga0207708_10220046 | |||
| 3894 | Ga0207708_10284588 | |||
| 3895 | Ga0207708_10461004 | |||
| 3896 | Ga0207708_10603882 | |||
| 3897 | Ga0207708_10691181 | |||
| 3898 | Ga0207708_11242086 | |||
| 3899 | Ga0207708_11899230 | |||
| 3900 | Ga0207702_10091630 | |||
| 3901 | Ga0207702_10092000 | |||
| 3902 | Ga0207702_10472988 | |||
| 3903 | Ga0207702_10521176 | |||
| 3904 | Ga0207641_10010866 | |||
| 3905 | Ga0207641_10016599 | |||
| 3906 | Ga0207641_10051447 | |||
| 3907 | Ga0207641_10060175 | |||
| 3908 | Ga0207641_10306101 | |||
| 3909 | Ga0207641_10419581 | |||
| 3910 | Ga0207641_10895642 | |||
| 3911 | Ga0207648_10004141 | |||
| 3912 | Ga0207648_10044297 | |||
| 3913 | Ga0207648_10073453 | |||
| 3914 | Ga0207648_10077673 | |||
| 3915 | Ga0207648_10170083 | |||
| 3916 | Ga0207648_10291124 | |||
| 3917 | Ga0207648_10584911 | |||
| 3918 | Ga0207648_10699265 | |||
| 3919 | Ga0207648_10994438 | |||
| 3920 | Ga0207648_11115348 | |||
| 3921 | Ga0207648_11138688 | |||
| 3922 | Ga0207676_10080727 | |||
| 3923 | Ga0207676_10126880 | |||
| 3924 | Ga0207676_10155889 | |||
| 3925 | Ga0207676_10222315 | |||
| 3926 | Ga0207676_10380158 | |||
| 3927 | Ga0207676_10451412 | |||
| 3928 | Ga0207676_11729112 | |||
| 3929 | Ga0207674_10011305 | |||
| 3930 | Ga0207674_10063694 | |||
| 3931 | Ga0207674_10126427 | |||
| 3932 | Ga0207674_10174928 | |||
| 3933 | Ga0207674_10290995 | |||
| 3934 | Ga0207674_10357158 | |||
| 3935 | Ga0207674_10616368 | |||
| 3936 | Ga0207674_10915189 | |||
| 3937 | Ga0207674_11105617 | |||
| 3938 | Ga0207674_11296713 | |||
| 3939 | Ga0207675_100007458 | |||
| 3940 | Ga0207675_100027261 | |||
| 3941 | Ga0207675_100044713 | |||
| 3942 | Ga0207675_100047213 | |||
| 3943 | Ga0207675_100062218 | |||
| 3944 | Ga0207675_100168211 | |||
| 3945 | Ga0207675_100198545 | |||
| 3946 | Ga0207675_100264122 | |||
| 3947 | Ga0207675_100574034 | |||
| 3948 | Ga0207675_100800121 | |||
| 3949 | Ga0207675_100823130 | |||
| 3950 | Ga0207675_100884452 | |||
| 3951 | Ga0207683_10027382 | |||
| 3952 | Ga0207683_10030281 | |||
| 3953 | Ga0207683_10060938 | |||
| 3954 | Ga0207683_10068018 | |||
| 3955 | Ga0207683_10072088 | |||
| 3956 | Ga0207683_10072297 | |||
| 3957 | Ga0207683_10304799 | |||
| 3958 | Ga0207683_10603825 | |||
| 3959 | Ga0207683_10632678 | |||
| 3960 | Ga0207683_11464110 | |||
| 3961 | Ga0207683_11794377 | |||
| 3962 | Ga0207698_10100808 | |||
| 3963 | Ga0207698_10296234 | |||
| 3964 | Ga0207698_10340957 | |||
| 3965 | Ga0207698_10356775 | |||
| 3966 | Ga0207698_10440983 | |||
| 3967 | Ga0207698_10839256 | |||
| 3968 | Ga0207698_11610148 | |||
| 3969 | Ga0207698_12756877 | |||
| 3970 | Ga0209973_1074617 | |||
| 3971 | Ga0210000_1012023 | |||
| 3972 | Ga0210000_1072770 | |||
| 3973 | Ga0209995_1025265 | |||
| 3974 | Ga0209999_1037865 | |||
| 3975 | Ga0209999_1096232 | |||
| 3976 | Ga0210002_1025992 | |||
| 3977 | Ga0210002_1057760 | |||
| 3978 | Ga0209983_1037231 | |||
| 3979 | Ga0209588_1000056 | |||
| 3980 | Ga0209588_1054351 | |||
| 3981 | Ga0209971_1030092 | |||
| 3982 | Ga0209966_1052456 | |||
| 3983 | Ga0209998_10023574 | |||
| 3984 | Ga0209998_10144345 | |||
| 3985 | Ga0209974_10019791 | |||
| 3986 | Ga0209974_10023433 | |||
| 3987 | Ga0209974_10055621 | |||
| 3988 | Ga0209974_10096236 | |||
| 3989 | Ga0207428_10000145 | |||
| 3990 | Ga0207428_10001182 | |||
| 3991 | Ga0207428_10004699 | |||
| 3992 | Ga0207428_10115336 | |||
| 3993 | Ga0207428_10216097 | |||
| 3994 | Ga0207428_10247539 | |||
| 3995 | Ga0207428_10262440 | |||
| 3996 | Ga0207428_10296341 | |||
| 3997 | Ga0207428_10462231 | |||
| 3998 | Ga0207428_10537799 | |||
| 3999 | Ga0268266_10070586 | |||
| 4000 | Ga0268266_10104469 | |||
| 4001 | Ga0268266_10389395 | |||
| 4002 | Ga0268266_10720992 | |||
| 4003 | Ga0268265_10025059 | |||
| 4004 | Ga0268265_10132618 | |||
| 4005 | Ga0268265_10168709 | |||
| 4006 | Ga0268265_10183110 | |||
| 4007 | Ga0268265_10228677 | |||
| 4008 | Ga0268265_10236050 | |||
| 4009 | Ga0268265_10267179 | |||
| 4010 | Ga0268265_10682809 | |||
| 4011 | Ga0268265_10766813 | |||
| 4012 | Ga0268265_10766927 | |||
| 4013 | Ga0268265_10824037 | |||
| 4014 | Ga0268265_11476895 | |||
| 4015 | Ga0268265_11543202 | |||
| 4016 | Ga0268265_11627981 | |||
| 4017 | Ga0268264_10033632 | |||
| 4018 | Ga0268264_10069308 | |||
| 4019 | Ga0268264_10105770 | |||
| 4020 | Ga0268264_10155487 | |||
| 4021 | Ga0268264_10301829 | |||
| 4022 | Ga0268264_10390593 | |||
| 4023 | Ga0268264_10730107 | |||
| 4024 | Ga0268264_10756336 | |||
| 4025 | Ga0268264_11012984 | |||
| 4026 | Ga0265760_10099524 | |||
| 4027 | Ga0307408_100018434 | |||
| 4028 | Ga0307408_100022422 | |||
| 4029 | Ga0307408_100040916 | |||
| 4030 | Ga0307408_100060654 | |||
| 4031 | Ga0307408_100128001 | |||
| 4032 | Ga0307408_100155651 | |||
| 4033 | Ga0307408_100271349 | |||
| 4034 | Ga0307408_100533532 | |||
| 4035 | Ga0307408_100604161 | |||
| 4036 | Ga0307408_100692153 | |||
| 4037 | Ga0307408_100938590 | |||
| 4038 | Ga0307408_101485769 | |||
| 4039 | Ga0316579_10068235 | |||
| 4040 | Ga0316576_10020354 | |||
| 4041 | Ga0316576_10321802 | |||
| 4042 | Ga0316578_10009002 | |||
| 4043 | Ga0316578_10098604 | |||
| 4044 | Ga0307405_10004541 | |||
| 4045 | Ga0307405_10005212 | |||
| 4046 | Ga0307405_10025371 | |||
| 4047 | Ga0307405_10026646 | |||
| 4048 | Ga0307405_10037389 | |||
| 4049 | Ga0307405_10066098 | |||
| 4050 | Ga0307405_10113704 | |||
| 4051 | Ga0307405_10148239 | |||
| 4052 | Ga0307405_10168485 | |||
| 4053 | Ga0307405_10244599 | |||
| 4054 | Ga0307405_10399696 | |||
| 4055 | Ga0307405_11097520 | |||
| 4056 | Ga0307405_11209323 | |||
| 4057 | Ga0307405_11267971 | |||
| 4058 | Ga0307405_11420203 | |||
| 4059 | Ga0307405_11566132 | |||
| 4060 | Ga0316577_10020084 | |||
| 4061 | Ga0316577_10130274 | |||
| 4062 | Ga0307413_10023575 | |||
| 4063 | Ga0307413_10062289 | |||
| 4064 | Ga0307413_10081365 | |||
| 4065 | Ga0307413_10147528 | |||
| 4066 | Ga0307413_10216100 | |||
| 4067 | Ga0307413_10447390 | |||
| 4068 | Ga0307413_10647620 | |||
| 4069 | Ga0307413_11132004 | |||
| 4070 | Ga0307413_11565089 | |||
| 4071 | Ga0307413_11858290 | |||
| 4072 | Ga0307410_10000307 | |||
| 4073 | Ga0307410_10000496 | |||
| 4074 | Ga0307410_10008471 | |||
| 4075 | Ga0307410_10008609 | |||
| 4076 | Ga0307410_10040853 | |||
| 4077 | Ga0307410_10041843 | |||
| 4078 | Ga0307410_10059115 | |||
| 4079 | Ga0307410_10071183 | |||
| 4080 | Ga0307410_10073086 | |||
| 4081 | Ga0307410_10131435 | |||
| 4082 | Ga0307410_10166674 | |||
| 4083 | Ga0307410_10176352 | |||
| 4084 | Ga0307410_10230645 | |||
| 4085 | Ga0307410_10317613 | |||
| 4086 | Ga0307410_10405950 | |||
| 4087 | Ga0307410_10467285 | |||
| 4088 | Ga0307410_10630759 | |||
| 4089 | Ga0307406_10004596 | |||
| 4090 | Ga0307406_10015426 | |||
| 4091 | Ga0307406_10019042 | |||
| 4092 | Ga0307406_10026228 | |||
| 4093 | Ga0307406_10026663 | |||
| 4094 | Ga0307406_10046155 | |||
| 4095 | Ga0307406_10084331 | |||
| 4096 | Ga0307406_10173551 | |||
| 4097 | Ga0307406_10178237 | |||
| 4098 | Ga0307406_10262378 | |||
| 4099 | Ga0307406_10457333 | |||
| 4100 | Ga0307406_10589796 | |||
| 4101 | Ga0307406_10601396 | |||
| 4102 | Ga0307407_10001077 | |||
| 4103 | Ga0307407_10004826 | |||
| 4104 | Ga0307407_10012768 | |||
| 4105 | Ga0307407_10014268 | |||
| 4106 | Ga0307407_10015136 | |||
| 4107 | Ga0307407_10061360 | |||
| 4108 | Ga0307407_10085926 | |||
| 4109 | Ga0307407_10185836 | |||
| 4110 | Ga0307407_10206144 | |||
| 4111 | Ga0307407_10346251 | |||
| 4112 | Ga0307407_10388036 | |||
| 4113 | Ga0307407_10881278 | |||
| 4114 | Ga0307412_10013099 | |||
| 4115 | Ga0307412_10023664 | |||
| 4116 | Ga0307412_10040994 | |||
| 4117 | Ga0307412_10043777 | |||
| 4118 | Ga0307412_10057923 | |||
| 4119 | Ga0307412_10087097 | |||
| 4120 | Ga0307412_10595858 | |||
| 4121 | Ga0307412_11046686 | |||
| 4122 | Ga0307412_11372912 | |||
| 4123 | Ga0307409_100001975 | |||
| 4124 | Ga0307409_100004653 | |||
| 4125 | Ga0307409_100006880 | |||
| 4126 | Ga0307409_100008181 | |||
| 4127 | Ga0307409_100010352 | |||
| 4128 | Ga0307409_100012553 | |||
| 4129 | Ga0307409_100022195 | |||
| 4130 | Ga0307409_100026827 | |||
| 4131 | Ga0307409_100031536 | |||
| 4132 | Ga0307409_100060369 | |||
| 4133 | Ga0307409_100071029 | |||
| 4134 | Ga0307409_100237118 | |||
| 4135 | Ga0307409_100309992 | |||
| 4136 | Ga0307409_100422600 | |||
| 4137 | Ga0307409_100444613 | |||
| 4138 | Ga0307409_100453485 | |||
| 4139 | Ga0307409_100465044 | |||
| 4140 | Ga0307409_100591174 | |||
| 4141 | Ga0307409_100733291 | |||
| 4142 | Ga0307409_100868054 | |||
| 4143 | Ga0307416_100000301 | |||
| 4144 | Ga0307416_100000547 | |||
| 4145 | Ga0307416_100004673 | |||
| 4146 | Ga0307416_100008092 | |||
| 4147 | Ga0307416_100009818 | |||
| 4148 | Ga0307416_100027663 | |||
| 4149 | Ga0307416_100038126 | |||
| 4150 | Ga0307416_100047123 | |||
| 4151 | Ga0307416_100108198 | |||
| 4152 | Ga0307416_100183783 | |||
| 4153 | Ga0307416_100190125 | |||
| 4154 | Ga0307416_100210276 | |||
| 4155 | Ga0307416_100215876 | |||
| 4156 | Ga0307416_100406598 | |||
| 4157 | Ga0307416_100483270 | |||
| 4158 | Ga0307416_100568648 | |||
| 4159 | Ga0307416_100570571 | |||
| 4160 | Ga0307416_101023857 | |||
| 4161 | Ga0307416_101225321 | |||
| 4162 | Ga0307416_101566843 | |||
| 4163 | Ga0307416_101732448 | |||
| 4164 | Ga0307416_103137529 | |||
| 4165 | Ga0307414_10002345 | |||
| 4166 | Ga0307414_10031627 | |||
| 4167 | Ga0307414_10039801 | |||
| 4168 | Ga0307414_10061464 | |||
| 4169 | Ga0307414_10082711 | |||
| 4170 | Ga0307414_10086510 | |||
| 4171 | Ga0307414_10113187 | |||
| 4172 | Ga0307414_10190151 | |||
| 4173 | Ga0307414_10298256 | |||
| 4174 | Ga0307414_10372958 | |||
| 4175 | Ga0307414_10950300 | |||
| 4176 | Ga0307414_11918610 | |||
| 4177 | Ga0307411_10000678 | |||
| 4178 | Ga0307411_10004614 | |||
| 4179 | Ga0307411_10006364 | |||
| 4180 | Ga0307411_10023903 | |||
| 4181 | Ga0307411_10042142 | |||
| 4182 | Ga0307411_10079019 | |||
| 4183 | Ga0307411_10122529 | |||
| 4184 | Ga0307411_10123940 | |||
| 4185 | Ga0307411_10142965 | |||
| 4186 | Ga0307411_10182459 | |||
| 4187 | Ga0307411_10443945 | |||
| 4188 | Ga0307411_10449795 | |||
| 4189 | Ga0307411_10649336 | |||
| 4190 | Ga0307411_11832403 | |||
| 4191 | Ga0307411_12243655 | |||
| 4192 | Ga0307415_100002962 | |||
| 4193 | Ga0307415_100004118 | |||
| 4194 | Ga0307415_100010642 | |||
| 4195 | Ga0307415_100028989 | |||
| 4196 | Ga0307415_100036961 | |||
| 4197 | Ga0307415_100097657 | |||
| 4198 | Ga0307415_100129104 | |||
| 4199 | Ga0307415_100130485 | |||
| 4200 | Ga0307415_100215353 | |||
| 4201 | Ga0307415_100233706 | |||
| 4202 | Ga0307415_100337486 | |||
| 4203 | Ga0307415_100480261 | |||
| 4204 | Ga0307415_100482765 | |||
| 4205 | Ga0307415_100500788 | |||
| 4206 | Ga0307415_102507753 | |||
| 4207 | Ga0316583_10043713 | |||
| 4208 | Ga0316585_10072636 | |||
| 4209 | Ga0316580_10050237 | |||
| 4210 | Ga0316580_10050511 | |||
| 4211 | Ga0316592_1020238 | |||
| 4212 | Ga0316592_1121437 | |||
| 4213 | Ga0316586_1011327 | |||
| 4214 | Ga0316588_1025317 | |||
| 4215 | Ga0316588_1071865 | |||
| 4216 | Ga0316596_1000579 | |||
| 4217 | Ga0373930_0000502 | |||
| 4218 | Ga0373948_0028349 | |||
| 4219 | Ga0373948_0057710 | |||
| 4220 | Ga0373950_0000257 | |||
| 4221 | Ga0373958_0021368 | |||
| 4222 | Ga0373958_0076427 | |||
| 4223 | Ga0373959_0001619 | |||
| 4224 | Ga0373959_0139092 | |||
| 4225 | Ga0373959_0170995 | |||
| 4226 | Ga0373928_0012159 | |||
| 4227 | Ga0373928_0032887 | |||
| 4228 | Ga0373928_0145627 | |||
| 4229 | Ga0373929_0002346 | |||
| 4230 | Ga0373940_0014920 | |||
| 4231 | Ga0373940_0019643 | |||
| 4232 | Ga0373940_0033061 | |||
| 4233 | Ga0373940_0073925 | |||
| 4234 | Ga0373949_0001484 | |||
| 4235 | Ga0373949_0032741 | |||
| 4236 | Ga0373951_0000863 | |||
| 4237 | Ga0373951_0172954 | |||
| 4238 | Ga0373951_0195226 | |||
| 4239 | Ga0373951_0291502 | |||
| 4240 | Ga0373952_0000941 | |||
| 4241 | Ga0373952_0143647 | |||
| 4242 | Ga0373923_0070100 | |||
| 4243 | Ga0373932_0002685 | |||
| 4244 | Ga0373936_0156589 | |||
| 4245 | Ga0373936_0631444 | |||
| 4246 | Ga0373939_0000955 | |||
| 4247 | Ga0373939_0289672 | |||
| 4248 | Ga0373941_0000416 | |||
| 4249 | Ga0373941_0046536 | |||
| 4250 | Ga0373941_0409202 | |||
| 4251 | Ga0373953_0280197 | |||
| 4252 | Ga0373953_0525159 | |||
| 4253 | Ga0373954_0194852 | |||
| 4254 | Ga0373956_0052915 | |||
| 4255 | Ga0373956_0216868 | |||
| 4256 | Ga0373960_0001972 | |||
| 4257 | Ga0373960_0111265 | |||
| 4258 | Ga0373960_0132087 | |||
| 4259 | Ga0373960_0379874 | |||
| 4260 | Ga0373943_0027049 | |||
| 4261 | Ga0373943_0111231 | |||
| 4262 | Ga0373955_0033008 | |||
| 4263 | Ga0373955_0258639 | |||
| 4264 | Ga0373955_0346012 | |||
| 4265 | Ga0373955_0389046 | |||
| 4266 | Ga0373942_0000646 | |||
| 4267 | Ga0373961_0001109 | |||
| 4268 | Ga0373961_0013630 | |||
| 4269 | Ga0373961_0020541 | |||
| 4270 | Ga0373961_0057864 | |||
| 4271 | Ga0373961_0090345 | |||
| 4272 | Ga0373961_0164621 | |||
| 4273 | Ga0373962_0008999 | |||
| 4274 | Ga0373962_0032408 | |||
| 4275 | Ga0316574_0069547 | |||
| 4276 | Ga0316574_0227298 | |||
| 4277 | Ga0373924_0007968 | |||
| 4278 | Ga0373924_0060596 | |||
| 4279 | Ga0373931_0003553 | |||
| 4280 | Ga0373931_0007754 | |||
| 4281 | Ga0373931_0532287 | |||
| 4282 | Ga0373931_0975739 | |||
| 4283 | Ga0373931_1223573 | |||
| 4284 | Ga0373935_0016403 | |||
| 4285 | Ga0373933_0499490 | |||
| 4286 | Ga0373947_0032817 | |||
| 4287 | Ga0373947_1233867 | |||
| 4288 | Ga0373937_0501500 | |||
| 4289 | Ga0373937_1347734 | |||
| 4290 | Ga0373937_1579293 | |||
| 4291 | Ga0316582_0111879 | |||
| 4292 | Ga0316584_0018602 | |||
| 4293 | Ga0316584_0029321 | |||
| 4294 | Ga0373925_0007543 | |||
| 4295 | Ga0373925_0380924 | |||
| 4296 | Ga0373925_1418243 | |||
| 4297 | Ga0395900_0911398 | |||
| 4298 | Ga0395905_0022010 | |||
| 4299 | Ga0395905_0124711 | |||
| 4300 | Ga0395905_0607717 | |||
| 4301 | Ga0316581_0011219 | |||
| 4302 | Ga0242420_000338 | |||
| 4303 | Ga0242420_010894 | |||
| 4304 | Ga0242420_022802 | |||
| 4305 | Ga0242420_059230 | |||
| 4306 | Ga0439453_0123914 | |||
| 4307 | Ga0439453_0126300 | |||
| 4308 | Ga0439461_0035822 | |||
| 4309 | Ga0439461_0141873 | |||
| 4310 | Ga0451800_1156250 | |||
| 4311 | Ga0451853_2096646 | |||
| 4312 | Ga0451853_3590826 | |||
| 4313 | Ga0439433_0108600 | |||
| 4314 | Ga0439437_054421 | |||
| 4315 | Ga0439443_061431 | |||
| 4316 | Ga0439445_0058744 | |||
| 4317 | Ga0439448_0031978 | |||
| 4318 | Ga0439449_0320252 | |||
| 4319 | Ga0450890_017760 | |||
| 4320 | Ga0450892_003125 | |||
| 4321 | Ga0450894_042307 | |||
| 4322 | Ga0439446_0120578 | |||
| 4323 | Ga0439446_0161527 | |||
| 4324 | Ga0439446_0227446 | |||
| 4325 | Ga0439434_0273475 | |||
| 4326 | Ga0439435_0062660 | |||
| 4327 | Ga0439435_0096037 | |||
| 4328 | Ga0439435_0185635 | |||
| 4329 | Ga0439444_0052429 | |||
| 4330 | Ga0439444_0161545 | |||
| 4331 | Ga0439460_0125294 | |||
| 4332 | Ga0439460_0230773 | |||
| 4333 | Ga0450916_090056 | |||
| 4334 | Ga0451577_0272475 | |||
| 4335 | Ga0453683_0012827 | |||
| 4336 | Ga0466963_0758982 | |||
| 4337 | Ga0466964_0780489 | |||
| 4338 | Ga0466971_0330826 | |||
| 4339 | Ga0466957_0261605 | |||
| 4340 | Ga0466959_0912624 | |||
| 4341 | Ga0451576_0014237 | |||
| 4342 | Ga0451576_0014722 | |||
| 4343 | Ga0451576_0042564 | |||
| 4344 | Ga0451576_0063120 | |||
| 4345 | Ga0451576_0167079 | |||
| 4346 | Ga0451576_0295536 | |||
| 4347 | Ga0451576_0753265 | |||
| 4348 | Ga0451576_0760017 | |||
| 4349 | Ga0451576_0959744 | |||
| 4350 | Ga0451576_2482557 | |||
| 4351 | Ga0466958_0125667 | |||
| 4352 | Ga0466967_1806805 | |||
| 4353 | Ga0466967_2212105 | |||
| 4354 | Ga0495592_0113233 | |||
| 4355 | Ga0495603_0217060 | |||
| 4356 | Ga0495629_0113019 | |||
| 4357 | Ga0495629_0448152 | |||
| 4358 | Ga0495651_0210454 | |||
| 4359 | Ga0495653_0317956 | |||
| 4360 | Ga0495580_0028437 | |||
| 4361 | Ga0495582_0606491 | |||
| 4362 | Ga0495639_0181686 | |||
| 4363 | Ga0495639_0619612 | |||
| 4364 | Ga0495664_0208517 | |||
| 4365 | Ga0495584_0609398 | |||
| 4366 | Ga0495585_0626184 | |||
| 4367 | Ga0495594_0184204 | |||
| 4368 | Ga0495594_0494135 | |||
| 4369 | Ga0495608_0001637 | |||
| 4370 | Ga0495618_0131565 | |||
| 4371 | Ga0495628_0014871 | |||
| 4372 | Ga0495630_0003056 | |||
| 4373 | Ga0495652_0060495 | |||
| 4374 | Ga0495640_0639495 | |||
| 4375 | Ga0495640_0971444 | |||
| 4376 | Ga0495586_0169829 | |||
| 4377 | Ga0495587_0022813 | |||
| 4378 | Ga0495598_0013933 | |||
| 4379 | Ga0495598_0110356 | |||
| 4380 | Ga0495621_0435016 | |||
| 4381 | Ga0495645_0049219 | |||
| 4382 | Ga0495633_0535138 | |||
| 4383 | Ga0495667_0062506 | |||
| 4384 | Ga0495656_0078774 | |||
| 4385 | Ga0495656_0132195 | |||
| 4386 | Ga0495656_0476445 | |||
| 4387 | Ga0495634_0054123 | |||
| 4388 | Ga0495634_0056489 | |||
| 4389 | Ga0495635_0255839 | |||
| 4390 | Ga0495635_1006766 | |||
| 4391 | Ga0495659_0157520 | |||
| 4392 | Ga0495659_0176411 | |||
| 4393 | Ga0495588_0040517 | |||
| 4394 | Ga0495588_0182840 | |||
| 4395 | Ga0495647_0070998 | |||
| 4396 | Ga0495647_0116464 | |||
| 4397 | Ga0495647_0284728 | |||
| 4398 | Ga0495647_0637581 | |||
| 4399 | Ga0495658_0103609 | |||
| 4400 | Ga0495658_0148170 | |||
| 4401 | Ga0495658_0237058 | |||
| 4402 | Ga0495658_0804381 | |||
| 4403 | Ga0495669_0004726 | |||
| 4404 | Ga0495613_0000660 | |||
| 4405 | Ga0495613_0652193 | |||
| 4406 | Ga0495670_0263482 | |||
| 4407 | Ga0495670_0421527 | |||
| 4408 | Ga0495670_0742340 | |||
| 4409 | Ga0495600_0072829 | |||
| 4410 | Ga0495581_0087255 | |||
| 4411 | Ga0495604_0016487 | |||
| 4412 | Ga0495604_0267245 | |||
| 4413 | Ga0495636_0320035 | |||
| 4414 | Ga0495674_0016565 | |||
| 4415 | Ga0495674_0820829 | |||
| 4416 | Ga0495674_1458071 | |||
| 4417 | Ga0495684_0000093 | |||
| 4418 | Ga0495684_0577360 | |||
| 4419 | Ga0495684_0935546 | |||
| 4420 | Ga0495615_0041022 | |||
| 4421 | Ga0496100_0011330 | |||
| 4422 | Ga0496100_0096766 | |||
| 4423 | Ga0496101_0000386 | |||
| 4424 | Ga0496101_0269432 | |||
| 4425 | Ga0496102_0039987 | |||
| 4426 | Ga0496102_0046742 | |||
| 4427 | Ga0496102_0088959 | |||
| 4428 | Ga0496102_0190034 | |||
| 4429 | Ga0496102_0193086 | |||
| 4430 | Ga0496102_0412738 | |||
| 4431 | Ga0496102_0415166 | |||
| 4432 | Ga0496102_0451226 | |||
| 4433 | Ga0496102_0544112 | |||
| 4434 | Ga0496102_1428731 | |||
| 4435 | Ga0496102_1450889 | |||
| 4436 | Ga0496102_1499049 | |||
| 4437 | Ga0496103_0002555 | |||
| 4438 | Ga0496103_0023679 | |||
| 4439 | Ga0496103_0414870 | |||
| 4440 | Ga0496103_0540433 | |||
| 4441 | Ga0496104_0001703 | |||
| 4442 | Ga0496104_0014766 | |||
| 4443 | Ga0496104_0034749 | |||
| 4444 | Ga0496104_0059644 | |||
| 4445 | Ga0496104_0264350 | |||
| 4446 | Ga0496104_0709796 | |||
| 4447 | Ga0496104_0715657 | |||
| 4448 | Ga0496104_1090698 | |||
| 4449 | Ga0496105_0046856 | |||
| 4450 | Ga0496105_0422029 | |||
| 4451 | Ga0496105_0494527 | |||
| 4452 | Ga0496106_0030890 | |||
| 4453 | Ga0496106_0033151 | |||
| 4454 | Ga0496106_0043997 | |||
| 4455 | Ga0496106_0107087 | |||
| 4456 | Ga0496106_0163995 | |||
| 4457 | Ga0496106_0181710 | |||
| 4458 | Ga0496106_0629225 | |||
| 4459 | Ga0496106_0820648 | |||
| 4460 | Ga0496106_0852035 | |||
| 4461 | Ga0496106_0950143 | |||
| 4462 | Ga0496107_0069624 | |||
| 4463 | Ga0496107_0860531 | |||
| 4464 | Ga0496107_1326923 | |||
| 4465 | Ga0496108_0000426 | |||
| 4466 | Ga0496108_0001436 | |||
| 4467 | Ga0496108_0010988 | |||
| 4468 | Ga0496108_0053819 | |||
| 4469 | Ga0496108_1253256 | |||
| 4470 | Ga0496109_0000596 | |||
| 4471 | Ga0496109_0012088 | |||
| 4472 | Ga0496109_0012820 | |||
| 4473 | Ga0496109_0059262 | |||
| 4474 | Ga0496109_0211109 | |||
| 4475 | Ga0496109_0256512 | |||
| 4476 | Ga0496109_0539617 | |||
| 4477 | Ga0496109_0900039 | |||
| 4478 | Ga0496109_1389878 | |||
| 4479 | Ga0496109_2063575 | |||
| 4480 | Ga0496110_0005269 | |||
| 4481 | Ga0496110_0007351 | |||
| 4482 | Ga0496110_0013891 | |||
| 4483 | Ga0496110_0905282 | |||
| 4484 | Ga0496110_0962075 | |||
| 4485 | Ga0496111_0008529 | |||
| 4486 | Ga0496111_0018021 | |||
| 4487 | Ga0496111_0038776 | |||
| 4488 | Ga0496111_0084476 | |||
| 4489 | Ga0496111_0375334 | |||
| 4490 | Ga0496111_0654838 | |||
| 4491 | Ga0496112_0013329 | |||
| 4492 | Ga0496112_0015487 | |||
| 4493 | Ga0496112_0021767 | |||
| 4494 | Ga0496112_0024657 | |||
| 4495 | Ga0496112_0226530 | |||
| 4496 | Ga0496112_0319855 | |||
| 4497 | Ga0496112_0528176 | |||
| 4498 | Ga0496112_1131485 | |||
| 4499 | Ga0496112_1747747 | |||
| 4500 | Ga0496113_0000965 | |||
| 4501 | Ga0496113_0027101 | |||
| 4502 | Ga0496113_0051169 | |||
| 4503 | Ga0496113_0380573 | |||
| 4504 | Ga0496113_0389651 | |||
| 4505 | Ga0496114_0006394 | |||
| 4506 | Ga0496114_0103281 | |||
| 4507 | Ga0496114_0267194 | |||
| 4508 | Ga0496114_0655983 | |||
| 4509 | Ga0496114_0789103 | |||
| 4510 | Ga0496114_1534038 | |||
| 4511 | Ga0496115_0559201 | |||
| 4512 | Ga0501290_017501 | |||
| 4513 | Ga0501290_091781 | |||
| 4514 | Ga0501291_109114 | |||
| 4515 | Ga0501293_022033 | |||
| 4516 | Ga0501297_008752 | |||
| 4517 | Ga0501031_0012344 | |||
| 4518 | Ga0501031_0073898 | |||
| 4519 | Ga0501031_0177978 | |||
| 4520 | Ga0501031_0278468 | |||
| 4521 | Ga0501032_0137790 | |||
| 4522 | Ga0501032_0303987 | |||
| 4523 | Ga0501033_0574694 | |||
| 4524 | Ga0501036_0082097 | |||
| 4525 | Ga0501036_0226983 | |||
| 4526 | Ga0501036_0342398 | |||
| 4527 | Ga0501036_0461402 | |||
| 4528 | Ga0501036_0935434 | |||
| 4529 | Ga0501037_0078470 | |||
| 4530 | Ga0501037_0154571 | |||
| 4531 | Ga0501037_0310704 | |||
| 4532 | Ga0501037_0411392 | |||
| 4533 | Ga0501038_0075080 | |||
| 4534 | Ga0501038_0075401 | |||
| 4535 | Ga0501038_0381292 | |||
| 4536 | Ga0501039_0051039 | |||
| 4537 | Ga0501039_0054060 | |||
| 4538 | Ga0501039_0169904 | |||
| 4539 | Ga0501039_0779641 | |||
| 4540 | Ga0501039_1367026 | |||
| 4541 | Ga0501039_1597259 | |||
| 4542 | Ga0501040_0023204 | |||
| 4543 | Ga0501040_0024445 | |||
| 4544 | Ga0501040_0029327 | |||
| 4545 | Ga0501040_0047825 | |||
| 4546 | Ga0501040_0053348 | |||
| 4547 | Ga0501040_0084734 | |||
| 4548 | Ga0501040_0306504 | |||
| 4549 | Ga0501040_0307849 | |||
| 4550 | Ga0501041_0007325 | |||
| 4551 | Ga0501041_0026916 | |||
| 4552 | Ga0501041_0164529 | |||
| 4553 | Ga0501041_0193742 | |||
| 4554 | Ga0501041_0860003 | |||
| 4555 | Ga0501041_1024032 | |||
| 4556 | Ga0501041_1138406 | |||
| 4557 | Ga0501042_0035476 | |||
| 4558 | Ga0501042_0049346 | |||
| 4559 | Ga0501042_0057869 | |||
| 4560 | Ga0501042_0311692 | |||
| 4561 | Ga0501042_0337990 | |||
| 4562 | Ga0501042_0896809 | |||
| 4563 | Ga0501042_1157041 | |||
| 4564 | Ga0501043_0113838 | |||
| 4565 | Ga0501046_0010812 | |||
| 4566 | Ga0501046_0042477 | |||
| 4567 | Ga0501046_0197977 | |||
| 4568 | Ga0501046_0652940 | |||
| 4569 | Ga0501046_0812728 | |||
| 4570 | Ga0501048_0008220 | |||
| 4571 | Ga0501048_0053669 | |||
| 4572 | Ga0501048_0144464 | |||
| 4573 | Ga0501048_0161835 | |||
| 4574 | Ga0501048_0448449 | |||
| 4575 | Ga0501048_0945476 | |||
| 4576 | Ga0501067_0017818 | |||
| 4577 | Ga0501067_0338734 | |||
| 4578 | Ga0501067_0805730 | |||
| 4579 | Ga0501068_0081033 | |||
| 4580 | Ga0501068_0132415 | |||
| 4581 | Ga0501068_0207578 | |||
| 4582 | Ga0501068_0732255 | |||
| 4583 | Ga0501068_1136661 | |||
| 4584 | Ga0501069_0006531 | |||
| 4585 | Ga0501069_0054383 | |||
| 4586 | Ga0501069_0135692 | |||
| 4587 | Ga0501069_0170293 | |||
| 4588 | Ga0501069_0481020 | |||
| 4589 | Ga0501069_0840203 | |||
| 4590 | Ga0501071_0030630 | |||
| 4591 | Ga0501071_0033222 | |||
| 4592 | Ga0501071_0073436 | |||
| 4593 | Ga0501071_0283479 | |||
| 4594 | Ga0501071_0477909 | |||
| 4595 | Ga0501071_1056364 | |||
| 4596 | Ga0501072_0002602 | |||
| 4597 | Ga0501072_0054708 | |||
| 4598 | Ga0501072_0092842 | |||
| 4599 | Ga0501072_0126612 | |||
| 4600 | Ga0501072_1373192 | |||
| 4601 | Ga0501073_1266347 | |||
| 4602 | Ga0501074_0107226 | |||
| 4603 | Ga0501074_0380492 | |||
| 4604 | Ga0501074_0623908 | |||
| 4605 | Ga0501075_0029125 | |||
| 4606 | Ga0501075_0036043 | |||
| 4607 | Ga0501075_0042421 | |||
| 4608 | Ga0501075_0051199 | |||
| 4609 | Ga0501075_0111541 | |||
| 4610 | Ga0501075_0123059 | |||
| 4611 | Ga0501075_0154761 | |||
| 4612 | Ga0501075_0748970 | |||
| 4613 | Ga0501075_1019110 | |||
| 4614 | Ga0501076_0010522 | |||
| 4615 | Ga0501076_0065511 | |||
| 4616 | Ga0501076_0110293 | |||
| 4617 | Ga0501076_0839192 | |||
| 4618 | Ga0501076_0957351 | |||
| 4619 | Ga0501076_1202930 | |||
| 4620 | Ga0501076_1712990 | |||
| 4621 | Ga0501077_0000553 | |||
| 4622 | Ga0501077_0001357 | |||
| 4623 | Ga0501077_0014550 | |||
| 4624 | Ga0501077_0090853 | |||
| 4625 | Ga0501077_0466907 | |||
| 4626 | Ga0501202_050481 | |||
| 4627 | Ga0501208_145530 | |||
| 4628 | Ga0501216_016571 | |||
| 4629 | Ga0501216_028197 | |||
| 4630 | Ga0501217_037625 | |||
| 4631 | Ga0501217_169187 | |||
| 4632 | Ga0501217_331080 | |||
| 4633 | Ga0501223_016395 | |||
| 4634 | Ga0501223_061929 | |||
| 4635 | Ga0501224_030574 | |||
| 4636 | Ga0501227_141529 | |||
| 4637 | Ga0501230_044421 | |||
| 4638 | Ga0501233_132108 | |||
| 4639 | Ga0501235_013159 | |||
| 4640 | Ga0501235_078278 | |||
| 4641 | Ga0501235_194971 | |||
| 4642 | Ga0501236_015165 | |||
| 4643 | Ga0501239_001266 | |||
| 4644 | Ga0501249_006178 | |||
| 4645 | Ga0501250_039760 | |||
| 4646 | Ga0501252_013775 | |||
| 4647 | Ga0501256_024453 | |||
| 4648 | Ga0501258_000477 | |||
| 4649 | Ga0501259_066458 | |||
| 4650 | Ga0501225_0038264 | |||
| 4651 | Ga0501225_0110131 | |||
| 4652 | Ga0501225_0357439 | |||
| 4653 | Ga0501229_029780 | |||
| 4654 | Ga0501245_019917 | |||
| 4655 | Ga0501079_0033321 | |||
| 4656 | Ga0501079_0033532 | |||
| 4657 | Ga0501079_0036945 | |||
| 4658 | Ga0501079_0051025 | |||
| 4659 | Ga0501079_0085799 | |||
| 4660 | Ga0501079_0401677 | |||
| 4661 | Ga0501080_0022592 | |||
| 4662 | Ga0501080_0682794 | |||
| 4663 | Ga0501080_0733852 | |||
| 4664 | Ga0501080_1315246 | |||
| 4665 | Ga0501081_0004156 | |||
| 4666 | Ga0501081_0009862 | |||
| 4667 | Ga0501081_0064871 | |||
| 4668 | Ga0501081_0075416 | |||
| 4669 | Ga0501081_0080700 | |||
| 4670 | Ga0501081_0083158 | |||
| 4671 | Ga0501081_1507906 | |||
| 4672 | Ga0501083_0496276 | |||
| 4673 | Ga0501083_0539586 | |||
| 4674 | Ga0501083_0673766 | |||
| 4675 | Ga0501083_0960016 | |||
| 4676 | Ga0501232_090615 | |||
| 4677 | Ga0501263_011864 | |||
| 4678 | Ga0501266_032896 | |||
| 4679 | Ga0501267_005248 | |||
| 4680 | Ga0501268_000075 | |||
| 4681 | Ga0501268_015308 | |||
| 4682 | Ga0501270_174433 | |||
| 4683 | Ga0501271_004898 | |||
| 4684 | Ga0501272_011595 | |||
| 4685 | Ga0501272_040611 | |||
| 4686 | Ga0501273_000801 | |||
| 4687 | Ga0501273_098045 | |||
| 4688 | Ga0501274_010219 | |||
| 4689 | Ga0501283_066870 | |||
| 4690 | Ga0501035_0066426 | |||
| 4691 | Ga0501035_0113556 | |||
| 4692 | Ga0501035_0595786 | |||
| 4693 | Ga0501035_0881571 | |||
| 4694 | Ga0501045_0020496 | |||
| 4695 | Ga0501045_0107044 | |||
| 4696 | Ga0501045_0199632 | |||
| 4697 | Ga0501045_0210794 | |||
| 4698 | Ga0501045_0225974 | |||
| 4699 | Ga0501045_0233057 | |||
| 4700 | Ga0501045_0310563 | |||
| 4701 | nmdc:mga05p37_11456_c1 | |||
| 4702 | nmdc:mga05p37_1181696_c1 | |||
| 4703 | nmdc:mga05p37_131131_c1 | |||
| 4704 | nmdc:mga05p37_139794_c1 | |||
| 4705 | nmdc:mga05p37_1507797_c1 | |||
| 4706 | nmdc:mga05p37_1531952_c1 | |||
| 4707 | nmdc:mga05p37_156240_c1 | |||
| 4708 | nmdc:mga05p37_209560_c1 | |||
| 4709 | nmdc:mga05p37_270046_c1 | |||
| 4710 | nmdc:mga05p37_29782_c1 | |||
| 4711 | nmdc:mga05p37_330855_c1 | |||
| 4712 | nmdc:mga05p37_34220_c1 | |||
| 4713 | nmdc:mga05p37_377921_c1 | |||
| 4714 | nmdc:mga05p37_399786_c1 | |||
| 4715 | nmdc:mga05p37_450555_c1 | |||
| 4716 | nmdc:mga05p37_4525_c1 | |||
| 4717 | nmdc:mga05p37_544378_c1 | |||
| 4718 | nmdc:mga05p37_89624_c1 | |||
| 4719 | nmdc:mga05p37_93457_c1 | |||
| 4720 | nmdc:mga05p37_960740_c1 | |||
| 4721 | nmdc:mga09592_108596_c1 | |||
| 4722 | nmdc:mga09592_152535_c1 | |||
| 4723 | nmdc:mga09592_1667285_c1 | |||
| 4724 | nmdc:mga09592_35857_c1 | |||
| 4725 | nmdc:mga09592_4164_c1 | |||
| 4726 | nmdc:mga09592_568416_c1 | |||
| 4727 | nmdc:mga09592_639981_c1 | |||
| 4728 | nmdc:mga09592_724890_c1 | |||
| 4729 | nmdc:mga09592_80668_c1 | |||
| 4730 | nmdc:mga09592_8477_c1 | |||
| 4731 | nmdc:mga09592_85922_c1 | |||
| 4732 | nmdc:mga09592_869304_c1 | |||
| 4733 | nmdc:mga0qj67_1133837_c1 | |||
| 4734 | nmdc:mga0qj67_1154588_c1 | |||
| 4735 | nmdc:mga0qj67_136576_c1 | |||
| 4736 | nmdc:mga0qj67_163476_c1 | |||
| 4737 | nmdc:mga0qj67_17070_c1 | |||
| 4738 | nmdc:mga0qj67_191061_c1 | |||
| 4739 | nmdc:mga0qj67_207428_c1 | |||
| 4740 | nmdc:mga0qj67_34235_c2 | |||
| 4741 | nmdc:mga0qj67_467505_c1 | |||
| 4742 | nmdc:mga0qj67_6585_c1 | |||
| 4743 | nmdc:mga0qj67_684210_c1 | |||
| 4744 | nmdc:mga0qj67_78673_c1 | |||
| 4745 | nmdc:mga0qj67_868_c1 | |||
| 4746 | nmdc:mga06r32_1042442_c1 | |||
| 4747 | nmdc:mga06r32_1156967_c1 | |||
| 4748 | nmdc:mga06r32_131415_c1 | |||
| 4749 | nmdc:mga06r32_149677_c1 | |||
| 4750 | nmdc:mga06r32_168350_c1 | |||
| 4751 | nmdc:mga06r32_202052_c1 | |||
| 4752 | nmdc:mga06r32_28504_c1 | |||
| 4753 | nmdc:mga06r32_37015_c1 | |||
| 4754 | nmdc:mga06r32_51466_c1 | |||
| 4755 | nmdc:mga06r32_6540_c1 | |||
| 4756 | nmdc:mga06r32_6937_c1 | |||
| 4757 | nmdc:mga06r32_90791_c1 | |||
| 4758 | nmdc:mga08y16_105924_c1 | |||
| 4759 | nmdc:mga08y16_1116961_c1 | |||
| 4760 | nmdc:mga08y16_1183282_c1 | |||
| 4761 | nmdc:mga08y16_139831_c1 | |||
| 4762 | nmdc:mga08y16_1517009_c1 | |||
| 4763 | nmdc:mga08y16_1786835_c1 | |||
| 4764 | nmdc:mga08y16_1851255_c1 | |||
| 4765 | nmdc:mga08y16_21264_c1 | |||
| 4766 | nmdc:mga08y16_298867_c1 | |||
| 4767 | nmdc:mga08y16_31545_c1 | |||
| 4768 | nmdc:mga08y16_3223_c1 | |||
| 4769 | nmdc:mga08y16_339638_c1 | |||
| 4770 | nmdc:mga08y16_3813_c1 | |||
| 4771 | nmdc:mga08y16_419401_c1 | |||
| 4772 | nmdc:mga08y16_447777_c1 | |||
| 4773 | nmdc:mga08y16_54764_c1 | |||
| 4774 | nmdc:mga08y16_571748_c1 | |||
| 4775 | nmdc:mga08y16_742741_c1 | |||
| 4776 | nmdc:mga08y16_833392_c1 | |||
| 4777 | nmdc:mga0n895_10112_c1 | |||
| 4778 | nmdc:mga0n895_1068993_c1 | |||
| 4779 | nmdc:mga0n895_1092008_c1 | |||
| 4780 | nmdc:mga0n895_12894_c1 | |||
| 4781 | nmdc:mga0n895_1349481_c1 | |||
| 4782 | nmdc:mga0n895_1497197_c1 | |||
| 4783 | nmdc:mga0n895_195045_c1 | |||
| 4784 | nmdc:mga0n895_198827_c1 | |||
| 4785 | nmdc:mga0n895_2002_c1 | |||
| 4786 | nmdc:mga0n895_20269_c1 | |||
| 4787 | nmdc:mga0n895_25460_c1 | |||
| 4788 | nmdc:mga0n895_267977_c1 | |||
| 4789 | nmdc:mga0n895_312179_c1 | |||
| 4790 | nmdc:mga0n895_34298_c1 | |||
| 4791 | nmdc:mga0n895_444357_c1 | |||
| 4792 | nmdc:mga0n895_47704_c1 | |||
| 4793 | nmdc:mga0n895_5310_c1 | |||
| 4794 | nmdc:mga0n895_576869_c1 | |||
| 4795 | nmdc:mga0n895_593220_c1 | |||
| 4796 | nmdc:mga0n895_593537_c1 | |||
| 4797 | nmdc:mga0n895_699929_c1 | |||
| 4798 | nmdc:mga0n895_93_c1 | |||
| 4799 | nmdc:mga0n895_98770_c1 | |||
| 4800 | nmdc:mga0rr50_10_c1 | |||
| 4801 | nmdc:mga0rr50_130956_c1 | |||
| 4802 | nmdc:mga0rr50_1333261_c1 | |||
| 4803 | nmdc:mga0rr50_138603_c1 | |||
| 4804 | nmdc:mga0rr50_157632_c1 | |||
| 4805 | nmdc:mga0rr50_181852_c1 | |||
| 4806 | nmdc:mga0rr50_219311_c1 | |||
| 4807 | nmdc:mga0rr50_262572_c1 | |||
| 4808 | nmdc:mga0rr50_294639_c1 | |||
| 4809 | nmdc:mga0rr50_30735_c1 | |||
| 4810 | nmdc:mga0rr50_31817_c1 | |||
| 4811 | nmdc:mga0rr50_376608_c1 | |||
| 4812 | nmdc:mga0rr50_532095_c1 | |||
| 4813 | nmdc:mga0rr50_561327_c1 | |||
| 4814 | nmdc:mga0rr50_7671_c1 | |||
| 4815 | nmdc:mga0rr50_86929_c1 | |||
| 4816 | nmdc:mga0rr50_87633_c1 | |||
| 4817 | nmdc:mga0rr50_88000_c1 | |||
| 4818 | nmdc:mga08x19_1152161_c1 | |||
| 4819 | nmdc:mga08x19_12270_c1 | |||
| 4820 | nmdc:mga08x19_135010_c1 | |||
| 4821 | nmdc:mga08x19_209_c1 | |||
| 4822 | nmdc:mga08x19_23693_c1 | |||
| 4823 | nmdc:mga08x19_240788_c1 | |||
| 4824 | nmdc:mga08x19_33721_c1 | |||
| 4825 | nmdc:mga08x19_34866_c1 | |||
| 4826 | nmdc:mga08x19_459935_c1 | |||
| 4827 | nmdc:mga08x19_4666_c1 | |||
| 4828 | nmdc:mga08x19_825_c1 | |||
| 4829 | nmdc:mga08x19_9990_c1 | |||
| 4830 | nmdc:mga0a205_111930_c1 | |||
| 4831 | nmdc:mga0a205_1242_c1 | |||
| 4832 | nmdc:mga0a205_140316_c3 | |||
| 4833 | nmdc:mga0a205_140435_c1 | |||
| 4834 | nmdc:mga0a205_1426_c1 | |||
| 4835 | nmdc:mga0a205_1582987_c1 | |||
| 4836 | nmdc:mga0a205_164538_c1 | |||
| 4837 | nmdc:mga0a205_18731_c1 | |||
| 4838 | nmdc:mga0a205_210957_c1 | |||
| 4839 | nmdc:mga0a205_26440_c1 | |||
| 4840 | nmdc:mga0a205_272365_c1 | |||
| 4841 | nmdc:mga0a205_321281_c1 | |||
| 4842 | nmdc:mga0a205_356067_c1 | |||
| 4843 | nmdc:mga0a205_40568_c1 | |||
| 4844 | nmdc:mga0a205_50347_c1 | |||
| 4845 | nmdc:mga0a205_636_c1 | |||
| 4846 | nmdc:mga0a205_656387_c1 | |||
| 4847 | nmdc:mga0a205_69433_c1 | |||
| 4848 | nmdc:mga0a205_89226_c1 | |||
| 4849 | Ga0495601_0018679 | |||
| 4850 | Ga0495601_0051585 | |||
| 4851 | Ga0495655_0054532 | |||
| 4852 | Ga0495619_0001650 | |||
| 4853 | Ga0495619_0298902 | |||
| 4854 | Ga0501084_0010001 | |||
| 4855 | Ga0501084_0022445 | |||
| 4856 | Ga0501084_0035787 | |||
| 4857 | Ga0501084_0111570 | |||
| 4858 | Ga0501084_0167063 | |||
| 4859 | Ga0501084_0212370 | |||
| 4860 | Ga0501084_0415284 | |||
| 4861 | Ga0501084_0737512 | |||
| 4862 | Ga0501084_0990023 | |||
| 4863 | Ga0501084_1697492 | |||
| 4864 | Ga0590071_010375 | |||
| 4865 | Ga0590071_026680 | |||
| 4866 | Ga0590075_024884 | |||
| 4867 | Ga0590077_010280 | |||
| 4868 | Ga0587073_0161859 | |||
| 4869 | Ga0587082_184194 | |||
| 4870 | Ga0587128_048671 | |||
| 4871 | Ga0587075_011331 | |||
| 4872 | Ga0587075_141515 | |||
| 4873 | Ga0587107_077142 | |||
| 4874 | Ga0587111_0240831 | |||
| 4875 | Ga0501082_0020795 | |||
| 4876 | Ga0501082_0022918 | |||
| 4877 | Ga0501082_0030982 | |||
| 4878 | Ga0501082_0056157 | |||
| 4879 | Ga0501082_0608670 | |||
| 4880 | Ga0501082_0962859 | |||
| 4881 | Ga0501082_1995625 | |||
| 4882 | Ga0530510_0002558 | |||
| 4883 | Ga0530510_0080393 | |||
| 4884 | Ga0530510_0135946 | |||
| 4885 | Ga0530510_0140991 | |||
| 4886 | Ga0530510_0172280 | |||
| 4887 | Ga0530510_0219905 | |||
| 4888 | Ga0530510_0326031 | |||
| 4889 | Ga0530510_0441750 | |||
| 4890 | Ga0530510_0820683 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ebb-assembly1.cif.gz_A-2 | crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426 | 0.9494 | 7 | 95 |
| 3jst-assembly2.cif.gz_B | crystal structure of transcriptional coactivator/pterin dehydratase from brucella melitensis | 0.9391 | 7 | 94 |
| 1usm-assembly1.cif.gz_A-2 | dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant | 0.935 | 24 | 98 |
| 3hxa-assembly1.cif.gz_D | crystal structure of dcoh1thr51ser | 0.8916 | 6 | 95 |
| 1usm-assembly1.cif.gz_A-2 | dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant | 0.8895 | 24 | 98 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WI93_1_93_3.30.1360.20 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9675 | 7 | 94 | 3.30.1360.20 |
| 2ebbA00 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9494 | 7 | 95 | 3.30.1360.20 |
| af_Q4CYK3_54_151_3.30.1360.20 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9467 | 7 | 95 | 3.30.1360.20 |
| 1usoB00 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9448 | 23 | 94 | 3.30.1360.20 |
| af_Q6MX13_31_126_3.30.1360.20 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase | 0.9392 | 8 | 98 | 3.30.1360.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2K9NU76-F1-model_v4 | 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) | 0.9852 | 9 | 95 |
GO:0006729
GO:0008124 |
| AF-A0A368L4A6-F1-model_v4 | 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) | 0.985 | 8 | 94 |
GO:0006729
GO:0008124 |
| AF-A0A521ZB07-F1-model_v4 | Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) | 0.9836 | 8 | 94 |
GO:0006729
GO:0008124 |
| AF-A0A2E0D1I4-F1-model_v4 | 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) | 0.9821 | 22 | 95 |
GO:0006729
GO:0008124 |
| AF-A0A7J4TP39-F1-model_v4 | 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) | 0.9798 | 22 | 94 |
GO:0006729
GO:0008124 |