F496273
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2022 | 926 | 1595 | 569 |
Family's Representative Sequence
| Representative Sequence | 3300049580|Ga0501046_0000883|Ga0501046_0000883_10380_12320 |
| Length | 637 |
| Sequence | MNLPASPMTRLAPDTRISLRGDLDVIAVTSPVGPWAGTVGPFADSGRIRGETTLSKPLGKVLIANRGEIAVRVIRACKDAGIGSVAVYADPDRDALHVRLADEAYSLEGATPADSYLSIEKIVDVALRSGADSVHPGYGFLAENADFAQAVLDAGLTWIGPSPAAIDALGDKAKAKHIAQKANAPLAPGTKDPVKDADEVIAFAREFGLPVAIKAVFGGGGRGLKVARTLEEIPDAYESAVREAVTAFGRGECLVEKFLDKPRHVETQCLADSHGNVVVISTRDCSLQRRHQKLVEEAPAPFLTDDQMKRLYDSSKAILKEAGYVGAGTCEFLVAADGTISFLEVNTRLQVEHCVSEEVTGIDLVREMFRIAAGEELGYDDPDIRGHAIEFRINAEDGGRNFMPAPGTLTEWAPPQGPGVRVDGGYEKGETIPGSFDSLIAKLIVSGRDRTQALERSRRALAEFQVDGMPTVIPFHRAIVSDPAYVGSSNPTGEGSFDVYTTWIETEFDNQIQPYDGEPGEAAEAGERQTVVVEVGGKRIDVVIPAGLGGLSAGSAXXXXKKPKRVSGDAVTSPMQGTVVKVVVEEGQEVAEGDTVVVIEAMKMEQPLKAHKAGTITGLSAAVGETVTNGAVICEIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 4 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 5 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 6 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 7 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 8 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 9 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 10 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 11 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 12 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 13 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 14 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 15 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 16 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 17 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 18 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 19 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 20 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 21 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 22 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 23 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 24 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 25 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 26 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 27 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 28 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 29 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 30 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 31 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 32 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 33 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 34 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 35 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 36 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 37 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 38 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 39 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 40 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 41 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 42 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 43 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 44 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 45 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 46 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 47 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 48 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 49 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 50 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 51 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 52 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 53 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 54 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 55 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 56 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 57 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 58 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 59 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 60 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 61 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 62 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 63 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 64 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 65 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 66 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 67 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 68 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 69 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 70 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 71 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 72 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 73 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 74 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 75 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 76 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 77 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 78 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 79 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 80 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 81 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 82 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 83 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 84 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 85 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 86 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 87 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 88 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 89 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 90 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 91 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 92 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 93 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 94 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 95 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 96 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 97 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 98 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 99 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 100 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 101 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 102 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 103 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 104 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 105 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 106 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 107 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 108 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 109 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 110 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 111 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 112 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 113 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 114 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 115 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 116 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 117 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 118 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 119 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 120 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 121 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 122 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 123 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 124 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 125 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 126 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 127 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 128 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 129 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 130 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 131 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 132 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 133 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 134 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 135 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 136 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 137 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 138 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 139 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 140 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 141 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 142 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 143 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 144 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 145 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 146 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 147 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 148 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 149 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 150 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 151 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 152 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 153 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 154 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 155 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 156 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 157 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 158 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 159 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 160 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 161 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 162 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 163 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 164 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 165 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 166 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 167 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 168 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 169 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 170 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 171 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 172 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 173 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 174 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 175 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 176 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 177 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 178 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 179 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 180 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 181 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 182 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 183 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 184 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 185 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 186 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 187 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 188 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 189 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 190 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 191 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 192 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 193 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 194 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 195 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 196 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 197 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 198 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 199 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 200 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 201 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 202 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 203 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 204 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 205 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 206 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 207 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 208 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 209 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 210 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 211 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 212 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 213 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 214 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 215 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 216 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 217 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 218 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 219 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 220 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 221 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 222 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 223 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 224 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 225 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 226 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 227 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 228 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 229 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 230 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 231 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 232 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 233 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 234 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 235 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 236 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 237 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 238 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 239 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 240 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 241 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 242 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 243 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 244 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 245 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 246 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 247 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 248 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 249 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 250 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 251 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 252 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 253 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 254 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 255 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 256 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 257 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 258 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 259 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 260 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 261 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 262 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 263 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 264 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 265 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 266 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 267 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 268 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 269 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 270 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 271 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 272 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 273 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 274 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 275 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 276 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 277 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 278 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 279 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 280 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 281 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 282 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 283 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 284 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 285 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 286 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 287 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 288 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 289 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 290 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 291 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 292 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 293 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 294 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 295 | 2941479691 | |||
| 296 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 297 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 298 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 299 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 300 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 301 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 302 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 303 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 304 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 305 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 306 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 307 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 308 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 309 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 310 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 311 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 312 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 313 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 314 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 315 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 316 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 317 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 318 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 319 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 320 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 321 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 322 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 323 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 324 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 325 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 326 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 327 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 328 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 329 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 330 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 331 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 332 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 333 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 334 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 335 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 336 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 337 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 338 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 339 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 340 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 341 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 342 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 343 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 344 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 345 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 346 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 347 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 348 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 349 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 350 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 351 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 352 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 353 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 354 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 355 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 356 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 357 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 358 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 359 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 360 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 361 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 362 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 363 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 364 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 365 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 366 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 367 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 368 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 369 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 370 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 371 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 372 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 373 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 374 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 375 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 376 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 377 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 378 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 379 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 380 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 381 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 382 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 383 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 384 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 385 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 386 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 387 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 388 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 389 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 390 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 391 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 392 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 393 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 394 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 395 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 396 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 397 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 398 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 399 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 400 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 401 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 402 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 403 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 404 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 405 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 406 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 407 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 408 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 409 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 410 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 411 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 412 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 413 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 414 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 415 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 416 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 417 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 418 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 419 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 420 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 421 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 422 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 423 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 424 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 425 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 426 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 427 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 428 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 429 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 430 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 431 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 432 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 433 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 434 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 435 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 436 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 437 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 438 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 439 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 440 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 441 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 442 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 443 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 444 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 445 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 446 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 447 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 448 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 449 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 450 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 451 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 452 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 453 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 454 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 456 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 457 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 458 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 459 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 460 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 461 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 462 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 463 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 464 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 466 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 467 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 468 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 469 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 470 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 472 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 473 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 475 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 476 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 477 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 478 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 479 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 480 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 481 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 482 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 483 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 484 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 485 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 486 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 487 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 488 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 489 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 490 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 491 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 492 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 493 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 494 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 495 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 496 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 497 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 498 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 499 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 500 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 501 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 502 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 503 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 504 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 505 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 506 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 507 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 508 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 509 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 510 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 511 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 512 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 513 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 514 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 515 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 516 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 517 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 518 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 519 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 520 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 521 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 522 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 523 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 524 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 525 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 526 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 527 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 528 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 529 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 530 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 531 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 532 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 533 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 534 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 535 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 536 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 537 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 538 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 539 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 540 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 541 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 542 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 543 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 544 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 545 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 546 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 547 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 548 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 549 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 550 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 551 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 552 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 553 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 554 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 555 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 556 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 557 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 558 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 559 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 560 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 561 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 562 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 563 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 564 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 565 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 566 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 567 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 568 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 569 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 570 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 571 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 572 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 573 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 574 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 575 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 576 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 577 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 578 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 579 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 580 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 581 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 582 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 583 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 584 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 585 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 586 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 587 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 588 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 589 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 590 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 591 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 592 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 593 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 594 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 595 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 596 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 597 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 598 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 599 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 600 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 601 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 602 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 603 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 604 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 605 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 606 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 607 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 608 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 609 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 610 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 611 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 612 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 613 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 614 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 615 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 616 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 617 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 618 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 619 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 620 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 621 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 622 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 623 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 624 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 625 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 626 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 627 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 628 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 629 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 630 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 631 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 632 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 633 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 634 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 635 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 636 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 637 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 638 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 639 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 640 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 641 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 642 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 643 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 644 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 645 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 646 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 647 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 648 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 649 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 650 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 651 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 652 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 653 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 654 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 655 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 656 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 657 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 658 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 659 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 660 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 661 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 662 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 663 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 664 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 665 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 666 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 667 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 668 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 669 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 670 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 671 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 672 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 673 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 674 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 675 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 676 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 677 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 678 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 679 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 680 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 681 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 682 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 683 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 684 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 685 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 686 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 687 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 688 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 689 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 690 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 691 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 692 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 693 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 694 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 695 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 696 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 697 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 698 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 699 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 700 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 701 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 702 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 703 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 704 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 705 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 706 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 707 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 708 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 709 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 710 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 711 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 712 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 713 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 714 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 715 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 716 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 717 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 718 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 719 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 720 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 721 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 722 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 723 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 724 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 725 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 726 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 727 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 728 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 729 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 730 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 731 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 732 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 733 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 734 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 735 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 736 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 737 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 738 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 739 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 740 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 741 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 742 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 743 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 744 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 745 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 746 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 747 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 748 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 749 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 750 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 751 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 752 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 753 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 754 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 755 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 756 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 757 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 758 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 759 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 760 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 761 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 762 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 763 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 764 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 765 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 766 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 767 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 769 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 770 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 773 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 774 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 775 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 776 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 777 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 778 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 779 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 780 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 781 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 782 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 783 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 784 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 785 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 786 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 787 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 788 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 789 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 790 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 791 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 792 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 793 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 794 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 795 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 796 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 797 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 798 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 799 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 800 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 801 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 802 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 803 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 804 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 805 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 806 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 807 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 808 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 809 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 810 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 811 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 812 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 813 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 814 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 815 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 816 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 817 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 818 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 819 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 820 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 821 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 822 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 823 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 824 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 825 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 826 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 827 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 828 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 829 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 830 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 831 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 832 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 833 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 834 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 835 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 836 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 837 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 838 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 839 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 840 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 841 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 842 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 843 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 844 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 845 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 846 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 847 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 848 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 849 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 850 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 851 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 852 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 853 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 854 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 855 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 856 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 857 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 858 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 859 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 860 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 861 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 862 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 863 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 864 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 865 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 866 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 867 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 868 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 869 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 870 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 871 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 872 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 873 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 874 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 875 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 876 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 877 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 878 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 879 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 880 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 881 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 882 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 883 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 884 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 885 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 886 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 887 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 888 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 889 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 890 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 891 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 892 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 893 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 894 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 895 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 896 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 897 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 898 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 899 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 900 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 901 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 902 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 903 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 904 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 905 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 906 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 907 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 908 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 909 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 910 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 911 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 912 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 913 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 914 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 915 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 916 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 917 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 918 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 919 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 920 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 921 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 922 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 923 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
| 924 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 925 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
| 926 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.34 |
| Metatranscriptomes | 0.54 |
| Isolates | 21.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.3 |
| Bulb | 0 |
| Endosphere | 8.06 |
| Nodule | 2.18 |
| Rhizoplane | 5.19 |
| Rhizosphere | 66.72 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 17.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2512745 | 2162886007 | Bacteria | 2656 |
| 2 | MRS1b_contig_5332385 | 2162886011 | Bacteria | 2334 |
| 3 | JGI24739J22299_10003636 | 3300001989 | Bacteria | 5889 |
| 4 | JGI24739J22299_10023236 | 3300001989 | Bacteria | 2193 |
| 5 | JGI24737J22298_10002216 | 3300001990 | Bacteria | 6927 |
| 6 | JGI24735J21928_10007117 | 3300002067 | Bacteria | 3654 |
| 7 | JGI24744J21845_10000282 | 3300002077 | Bacteria | 8421 |
| 8 | JGI25152J39213_1000090 | 3300002773 | Bacteria | 63717 |
| 9 | JGI25152J39213_1003304 | 3300002773 | Bacteria | 5567 |
| 10 | JGI25159J45721_1007018 | 3300002987 | Bacteria | 3287 |
| 11 | JGI25151J46595_10007031 | 3300003187 | Bacteria | 5567 |
| 12 | JGI25151J46595_10014470 | 3300003187 | Bacteria | 3512 |
| 13 | JGI25406J46586_10008172 | 3300003203 | Bacteria | 4751 |
| 14 | JGI25165J46597_1000044 | 3300003214 | Bacteria | 263289 |
| 15 | JGI25153J46596_10007089 | 3300003215 | Bacteria | 5567 |
| 16 | JGI25160J50197_1010761 | 3300003354 | Bacteria | 3287 |
| 17 | JGI25161J50226_1002092 | 3300003374 | Bacteria | 5391 |
| 18 | Ga0006562J51391_1022179 | 3300003578 | Bacteria | 13092 |
| 19 | Ga0006562J51391_1053958 | 3300003578 | Bacteria | 2175 |
| 20 | Ga0006562J51391_1059279 | 3300003578 | Bacteria | 5581 |
| 21 | Ga0006562J51391_1094765 | 3300003578 | Bacteria | 5389 |
| 22 | Ga0006562J51391_1099265 | 3300003578 | Bacteria | 2579 |
| 23 | Ga0006562J51391_1099266 | 3300003578 | Bacteria | 1870 |
| 24 | Ga0006562J51391_1101838 | 3300003578 | Bacteria | 2250 |
| 25 | JGI25404J52841_10000835 | 3300003659 | Bacteria | 4937 |
| 26 | Ga0055539_1000027 | 3300003752 | Bacteria | 258020 |
| 27 | Ga0055533_1000020 | 3300003756 | Bacteria | 353998 |
| 28 | Ga0055525_1000151 | 3300003759 | Bacteria | 94158 |
| 29 | Ga0055527_1000005 | 3300003760 | Bacteria | 504776 |
| 30 | Ga0055535_1000522 | 3300003761 | Bacteria | 33444 |
| 31 | Ga0055542_1000003 | 3300003762 | Bacteria | 582721 |
| 32 | Ga0055542_1000006 | 3300003762 | Bacteria | 504776 |
| 33 | Ga0055529_1000400 | 3300003763 | Bacteria | 46269 |
| 34 | Ga0055526_1014173 | 3300003771 | Bacteria | 3302 |
| 35 | Ga0055526_1014242 | 3300003771 | Bacteria | 3287 |
| 36 | Ga0055537_1006217 | 3300003773 | Bacteria | 3068 |
| 37 | Ga0055524_1013525 | 3300003775 | Bacteria | 3073 |
| 38 | Ga0055524_1013538 | 3300003775 | Bacteria | 3072 |
| 39 | Ga0055536_1001522 | 3300003781 | Bacteria | 13907 |
| 40 | Ga0055536_1002089 | 3300003781 | Bacteria | 11385 |
| 41 | Ga0055536_1003520 | 3300003781 | Bacteria | 8386 |
| 42 | Ga0055534_1006353 | 3300003784 | Bacteria | 2985 |
| 43 | Ga0055534_1007404 | 3300003784 | Bacteria | 2618 |
| 44 | Ga0055530_10000773 | 3300003791 | Bacteria | 26694 |
| 45 | Ga0055540_1001603 | 3300003792 | Bacteria | 13189 |
| 46 | Ga0055540_1002446 | 3300003792 | Bacteria | 9794 |
| 47 | Ga0055531_10001546 | 3300003794 | Bacteria | 16850 |
| 48 | Ga0055531_10016147 | 3300003794 | Bacteria | 3240 |
| 49 | Ga0055531_10017628 | 3300003794 | Bacteria | 3001 |
| 50 | Ga0055541_1000508 | 3300003841 | Bacteria | 10819 |
| 51 | Ga0055543_1001840 | 3300004625 | Bacteria | 7760 |
| 52 | Ga0065165_1000076 | 3300005262 | Bacteria | 163890 |
| 53 | Ga0065165_1007043 | 3300005262 | Bacteria | 5661 |
| 54 | Ga0065714_10090062 | 3300005288 | Bacteria | 1957 |
| 55 | Ga0065704_10075631 | 3300005289 | Bacteria | 5491 |
| 56 | Ga0065712_10071676 | 3300005290 | Bacteria | 5119 |
| 57 | Ga0070658_10001484 | 3300005327 | Bacteria | 19913 |
| 58 | Ga0070658_10010283 | 3300005327 | Bacteria | 7504 |
| 59 | Ga0070658_10016932 | 3300005327 | Bacteria | 5834 |
| 60 | Ga0070658_10040342 | 3300005327 | Bacteria | 3766 |
| 61 | Ga0070683_100009374 | 3300005329 | Bacteria | 8368 |
| 62 | Ga0070683_100020474 | 3300005329 | Bacteria | 5888 |
| 63 | Ga0070683_100026289 | 3300005329 | Bacteria | 5239 |
| 64 | Ga0070682_100007546 | 3300005337 | Bacteria | 6128 |
| 65 | Ga0068868_100121629 | 3300005338 | Bacteria | 2130 |
| 66 | Ga0070660_100005500 | 3300005339 | Bacteria | 8776 |
| 67 | Ga0070660_100015206 | 3300005339 | Bacteria | 5552 |
| 68 | Ga0070660_100068251 | 3300005339 | Bacteria | 2771 |
| 69 | Ga0070660_100077012 | 3300005339 | Bacteria | 2612 |
| 70 | Ga0070691_10010169 | 3300005341 | Bacteria | 4288 |
| 71 | Ga0070687_100062940 | 3300005343 | Bacteria | 1966 |
| 72 | Ga0070668_100000752 | 3300005347 | Bacteria | 22213 |
| 73 | Ga0070668_100075630 | 3300005347 | Bacteria | 2629 |
| 74 | Ga0070673_100024309 | 3300005364 | Bacteria | 4440 |
| 75 | Ga0070659_100000513 | 3300005366 | Bacteria | 28466 |
| 76 | Ga0070659_100004357 | 3300005366 | Bacteria | 10106 |
| 77 | Ga0070659_100017069 | 3300005366 | Bacteria | 5456 |
| 78 | Ga0070659_100018431 | 3300005366 | Bacteria | 5268 |
| 79 | Ga0070659_100026681 | 3300005366 | Bacteria | 4446 |
| 80 | Ga0070659_100047517 | 3300005366 | Bacteria | 3367 |
| 81 | Ga0070667_100023307 | 3300005367 | Bacteria | 5134 |
| 82 | Ga0070667_100034330 | 3300005367 | Bacteria | 4244 |
| 83 | Ga0070667_100095660 | 3300005367 | Bacteria | 2561 |
| 84 | Ga0070709_10000118 | 3300005434 | Bacteria | 53312 |
| 85 | Ga0070714_100008719 | 3300005435 | Bacteria | 7926 |
| 86 | Ga0070714_100009991 | 3300005435 | Bacteria | 7485 |
| 87 | Ga0070714_100012884 | 3300005435 | Bacteria | 6686 |
| 88 | Ga0070714_100025037 | 3300005435 | Bacteria | 4921 |
| 89 | Ga0070714_100063812 | 3300005435 | Bacteria | 3169 |
| 90 | Ga0070714_100081990 | 3300005435 | Bacteria | 2809 |
| 91 | Ga0070713_100001150 | 3300005436 | Bacteria | 16960 |
| 92 | Ga0070713_100010863 | 3300005436 | Bacteria | 6602 |
| 93 | Ga0070713_100119942 | 3300005436 | Bacteria | 2305 |
| 94 | Ga0070710_10000216 | 3300005437 | Bacteria | 26980 |
| 95 | Ga0070710_10047928 | 3300005437 | Bacteria | 2385 |
| 96 | Ga0070701_10011409 | 3300005438 | Bacteria | 3971 |
| 97 | Ga0070711_100000161 | 3300005439 | Bacteria | 36464 |
| 98 | Ga0070711_100073680 | 3300005439 | Bacteria | 2413 |
| 99 | Ga0070700_100023955 | 3300005441 | Bacteria | 3577 |
| 100 | Ga0070700_100061722 | 3300005441 | Bacteria | 2365 |
| 101 | Ga0070708_100006414 | 3300005445 | Bacteria | 9365 |
| 102 | Ga0070708_100051587 | 3300005445 | Bacteria | 3645 |
| 103 | Ga0070663_100000324 | 3300005455 | Bacteria | 24761 |
| 104 | Ga0070678_100038330 | 3300005456 | Bacteria | 3373 |
| 105 | Ga0068867_100021638 | 3300005459 | Bacteria | 4590 |
| 106 | Ga0070685_10001210 | 3300005466 | Bacteria | 13726 |
| 107 | Ga0070706_100001268 | 3300005467 | Bacteria | 26964 |
| 108 | Ga0070706_100008575 | 3300005467 | Bacteria | 9528 |
| 109 | Ga0070706_100022289 | 3300005467 | Bacteria | 5831 |
| 110 | Ga0070706_100066715 | 3300005467 | Bacteria | 3328 |
| 111 | Ga0070707_100013921 | 3300005468 | Bacteria | 7533 |
| 112 | Ga0070707_100014576 | 3300005468 | Bacteria | 7372 |
| 113 | Ga0070707_100015820 | 3300005468 | Bacteria | 7082 |
| 114 | Ga0070698_100000621 | 3300005471 | Bacteria | 38176 |
| 115 | Ga0070698_100001158 | 3300005471 | Bacteria | 29227 |
| 116 | Ga0070698_100006233 | 3300005471 | Bacteria | 12978 |
| 117 | Ga0070698_100013176 | 3300005471 | Bacteria | 8749 |
| 118 | Ga0070698_100032360 | 3300005471 | Bacteria | 5417 |
| 119 | Ga0070698_100040406 | 3300005471 | Bacteria | 4794 |
| 120 | Ga0070699_100005880 | 3300005518 | Bacteria | 10716 |
| 121 | Ga0070679_100057096 | 3300005530 | Bacteria | 3890 |
| 122 | Ga0070679_100101454 | 3300005530 | Bacteria | 2864 |
| 123 | Ga0070684_100008587 | 3300005535 | Bacteria | 8000 |
| 124 | Ga0070684_100142538 | 3300005535 | Bacteria | 2168 |
| 125 | Ga0070697_100008356 | 3300005536 | Bacteria | 8077 |
| 126 | Ga0068853_100052939 | 3300005539 | Bacteria | 3496 |
| 127 | Ga0068853_100057556 | 3300005539 | Bacteria | 3355 |
| 128 | Ga0070672_100012309 | 3300005543 | Bacteria | 6000 |
| 129 | Ga0070672_100017922 | 3300005543 | Bacteria | 5107 |
| 130 | Ga0070693_100023994 | 3300005547 | Bacteria | 3266 |
| 131 | Ga0070665_100007856 | 3300005548 | Bacteria | 10818 |
| 132 | Ga0070665_100012763 | 3300005548 | Bacteria | 8463 |
| 133 | Ga0070665_100016627 | 3300005548 | Bacteria | 7372 |
| 134 | Ga0068855_100002245 | 3300005563 | Bacteria | 23878 |
| 135 | Ga0068855_100006136 | 3300005563 | Bacteria | 14647 |
| 136 | Ga0068855_100009451 | 3300005563 | Bacteria | 11782 |
| 137 | Ga0068855_100020286 | 3300005563 | Bacteria | 7976 |
| 138 | Ga0068855_100029077 | 3300005563 | Bacteria | 6609 |
| 139 | Ga0068855_100130463 | 3300005563 | Bacteria | 2871 |
| 140 | Ga0068855_100220376 | 3300005563 | Bacteria | 2128 |
| 141 | Ga0068857_100008845 | 3300005577 | Bacteria | 8722 |
| 142 | Ga0068857_100040492 | 3300005577 | Bacteria | 4131 |
| 143 | Ga0068857_100163022 | 3300005577 | Bacteria | 2023 |
| 144 | Ga0068854_100011506 | 3300005578 | Bacteria | 5765 |
| 145 | Ga0068856_100036826 | 3300005614 | Bacteria | 4798 |
| 146 | Ga0068852_100002359 | 3300005616 | Bacteria | 13006 |
| 147 | Ga0068852_100003937 | 3300005616 | Bacteria | 10438 |
| 148 | Ga0068852_100012789 | 3300005616 | Bacteria | 6394 |
| 149 | Ga0068852_100023223 | 3300005616 | Bacteria | 4988 |
| 150 | Ga0068852_100064681 | 3300005616 | Bacteria | 3189 |
| 151 | Ga0068852_100093836 | 3300005616 | Bacteria | 2691 |
| 152 | Ga0068852_100126261 | 3300005616 | Bacteria | 2350 |
| 153 | Ga0068859_100000049 | 3300005617 | Bacteria | 137619 |
| 154 | Ga0068864_100019057 | 3300005618 | Bacteria | 5735 |
| 155 | Ga0068866_10016443 | 3300005718 | Bacteria | 3308 |
| 156 | Ga0068861_100016118 | 3300005719 | Bacteria | 5279 |
| 157 | Ga0068851_10000001 | 3300005834 | Bacteria | 495512 |
| 158 | Ga0068863_100000604 | 3300005841 | Bacteria | 36426 |
| 159 | Ga0068858_100000003 | 3300005842 | Bacteria | 349151 |
| 160 | Ga0068858_100000048 | 3300005842 | Bacteria | 126360 |
| 161 | Ga0068858_100013685 | 3300005842 | Bacteria | 7656 |
| 162 | Ga0068858_100062383 | 3300005842 | Bacteria | 3446 |
| 163 | Ga0068860_100000286 | 3300005843 | Bacteria | 71981 |
| 164 | Ga0068860_100158790 | 3300005843 | Bacteria | 2179 |
| 165 | Ga0068862_100000200 | 3300005844 | Bacteria | 66299 |
| 166 | Ga0081455_10000144 | 3300005937 | Bacteria | 84406 |
| 167 | Ga0081455_10000454 | 3300005937 | Bacteria | 53871 |
| 168 | Ga0081455_10000683 | 3300005937 | Bacteria | 44068 |
| 169 | Ga0081455_10000960 | 3300005937 | Bacteria | 36843 |
| 170 | Ga0081455_10001546 | 3300005937 | Bacteria | 28331 |
| 171 | Ga0081455_10005669 | 3300005937 | Bacteria | 13626 |
| 172 | Ga0081455_10007554 | 3300005937 | Bacteria | 11432 |
| 173 | Ga0081455_10015373 | 3300005937 | Bacteria | 7439 |
| 174 | Ga0081455_10017647 | 3300005937 | Bacteria | 6832 |
| 175 | Ga0081455_10033912 | 3300005937 | Bacteria | 4580 |
| 176 | Ga0081538_10000079 | 3300005981 | Bacteria | 92419 |
| 177 | Ga0081538_10000350 | 3300005981 | Bacteria | 52656 |
| 178 | Ga0081538_10003762 | 3300005981 | Bacteria | 14206 |
| 179 | Ga0081538_10026557 | 3300005981 | Bacteria | 4046 |
| 180 | Ga0081538_10034927 | 3300005981 | Bacteria | 3314 |
| 181 | Ga0081540_1000292 | 3300005983 | Bacteria | 52588 |
| 182 | Ga0081539_10000356 | 3300005985 | Bacteria | 100748 |
| 183 | Ga0081539_10004815 | 3300005985 | Bacteria | 14485 |
| 184 | Ga0081539_10022964 | 3300005985 | Bacteria | 4103 |
| 185 | Ga0070717_10000504 | 3300006028 | Bacteria | 24742 |
| 186 | Ga0070717_10052397 | 3300006028 | Bacteria | 3361 |
| 187 | Ga0070717_10082444 | 3300006028 | Bacteria | 2703 |
| 188 | Ga0075365_10012704 | 3300006038 | Bacteria | 5010 |
| 189 | Ga0075365_10014987 | 3300006038 | Bacteria | 4676 |
| 190 | Ga0075368_10004038 | 3300006042 | Bacteria | 4936 |
| 191 | Ga0075363_100000523 | 3300006048 | Bacteria | 12347 |
| 192 | Ga0075363_100007222 | 3300006048 | Bacteria | 5092 |
| 193 | Ga0075363_100012544 | 3300006048 | Bacteria | 4091 |
| 194 | Ga0075364_10003312 | 3300006051 | Bacteria | 9137 |
| 195 | Ga0075364_10004093 | 3300006051 | Bacteria | 8366 |
| 196 | Ga0075432_10000101 | 3300006058 | Bacteria | 18315 |
| 197 | Ga0070715_10001275 | 3300006163 | Bacteria | 7221 |
| 198 | Ga0070716_100000491 | 3300006173 | Bacteria | 16432 |
| 199 | Ga0070712_100009384 | 3300006175 | Bacteria | 6164 |
| 200 | Ga0075367_10034800 | 3300006178 | Bacteria | 2912 |
| 201 | Ga0075369_10001262 | 3300006186 | Bacteria | 8618 |
| 202 | Ga0097621_100026268 | 3300006237 | Bacteria | 4566 |
| 203 | Ga0097621_100028229 | 3300006237 | Bacteria | 4422 |
| 204 | Ga0075370_10007332 | 3300006353 | Bacteria | 5615 |
| 205 | Ga0075370_10015790 | 3300006353 | Bacteria | 4050 |
| 206 | Ga0075428_100000616 | 3300006844 | Bacteria | 36391 |
| 207 | Ga0075430_100009757 | 3300006846 | Bacteria | 8118 |
| 208 | Ga0075430_100021990 | 3300006846 | Bacteria | 5420 |
| 209 | Ga0075430_100079552 | 3300006846 | Bacteria | 2747 |
| 210 | Ga0075431_100004927 | 3300006847 | Bacteria | 13146 |
| 211 | Ga0075431_100022382 | 3300006847 | Bacteria | 6459 |
| 212 | Ga0075431_100062498 | 3300006847 | Bacteria | 3842 |
| 213 | Ga0075433_10000832 | 3300006852 | Bacteria | 21596 |
| 214 | Ga0075433_10038687 | 3300006852 | Bacteria | 4121 |
| 215 | Ga0075434_100000238 | 3300006871 | Bacteria | 38170 |
| 216 | Ga0075429_100006984 | 3300006880 | Bacteria | 9810 |
| 217 | Ga0075429_100046081 | 3300006880 | Bacteria | 3794 |
| 218 | Ga0075429_100081459 | 3300006880 | Bacteria | 2822 |
| 219 | Ga0075429_100100345 | 3300006880 | Bacteria | 2526 |
| 220 | Ga0068865_100015082 | 3300006881 | Bacteria | 4923 |
| 221 | Ga0075436_100002267 | 3300006914 | Bacteria | 13278 |
| 222 | Ga0097620_100000049 | 3300006931 | Bacteria | 137619 |
| 223 | Ga0079104_1000016 | 3300006946 | Bacteria | 313865 |
| 224 | Ga0075435_100003528 | 3300007076 | Bacteria | 10617 |
| 225 | Ga0105244_10000125 | 3300009036 | Bacteria | 78586 |
| 226 | Ga0105244_10011954 | 3300009036 | Bacteria | 5167 |
| 227 | Ga0105244_10054775 | 3300009036 | Bacteria | 2023 |
| 228 | Ga0105250_10009500 | 3300009092 | Bacteria | 4093 |
| 229 | Ga0105240_10000538 | 3300009093 | Bacteria | 70068 |
| 230 | Ga0105240_10034274 | 3300009093 | Bacteria | 6550 |
| 231 | Ga0105240_10037482 | 3300009093 | Bacteria | 6231 |
| 232 | Ga0111539_10000095 | 3300009094 | Bacteria | 93635 |
| 233 | Ga0111539_10020703 | 3300009094 | Bacteria | 8100 |
| 234 | Ga0105245_10004429 | 3300009098 | Bacteria | 12427 |
| 235 | Ga0105245_10023441 | 3300009098 | Bacteria | 5418 |
| 236 | Ga0105245_10087168 | 3300009098 | Bacteria | 2865 |
| 237 | Ga0105245_10161910 | 3300009098 | Bacteria | 2124 |
| 238 | Ga0105247_10000016 | 3300009101 | Bacteria | 263389 |
| 239 | Ga0105247_10001447 | 3300009101 | Bacteria | 17144 |
| 240 | Ga0114129_10032099 | 3300009147 | Bacteria | 7423 |
| 241 | Ga0114129_10037355 | 3300009147 | Bacteria | 6858 |
| 242 | Ga0114129_10069299 | 3300009147 | Bacteria | 4916 |
| 243 | Ga0105243_10001051 | 3300009148 | Bacteria | 25286 |
| 244 | Ga0105243_10002952 | 3300009148 | Bacteria | 14064 |
| 245 | Ga0105243_10008770 | 3300009148 | Bacteria | 7744 |
| 246 | Ga0105243_10011876 | 3300009148 | Bacteria | 6588 |
| 247 | Ga0105243_10022266 | 3300009148 | Bacteria | 4814 |
| 248 | Ga0105243_10085039 | 3300009148 | Bacteria | 2592 |
| 249 | Ga0105241_10000768 | 3300009174 | Bacteria | 24407 |
| 250 | Ga0105241_10014845 | 3300009174 | Bacteria | 5703 |
| 251 | Ga0105242_10001582 | 3300009176 | Bacteria | 17897 |
| 252 | Ga0105242_10088615 | 3300009176 | Bacteria | 2600 |
| 253 | Ga0105248_10000108 | 3300009177 | Bacteria | 93521 |
| 254 | Ga0105248_10000890 | 3300009177 | Bacteria | 33432 |
| 255 | Ga0105248_10014121 | 3300009177 | Bacteria | 8790 |
| 256 | Ga0105248_10026802 | 3300009177 | Bacteria | 6410 |
| 257 | Ga0105248_10072231 | 3300009177 | Bacteria | 3878 |
| 258 | Ga0105248_10102589 | 3300009177 | Bacteria | 3224 |
| 259 | Ga0105237_10001702 | 3300009545 | Bacteria | 28464 |
| 260 | Ga0105237_10014162 | 3300009545 | Bacteria | 8348 |
| 261 | Ga0105238_10001962 | 3300009551 | Bacteria | 20721 |
| 262 | Ga0105238_10037448 | 3300009551 | Bacteria | 4931 |
| 263 | Ga0105249_10004792 | 3300009553 | Bacteria | 11679 |
| 264 | Ga0105249_10020433 | 3300009553 | Bacteria | 5919 |
| 265 | Ga0105249_10022400 | 3300009553 | Bacteria | 5658 |
| 266 | Ga0105249_10095806 | 3300009553 | Bacteria | 2783 |
| 267 | Ga0105239_10009208 | 3300010375 | Bacteria | 11167 |
| 268 | Ga0105239_10030862 | 3300010375 | Bacteria | 5896 |
| 269 | Ga0105239_10036954 | 3300010375 | Bacteria | 5358 |
| 270 | Ga0105246_10000370 | 3300011119 | Bacteria | 23989 |
| 271 | Ga0105246_10003548 | 3300011119 | Bacteria | 9442 |
| 272 | Ga0105246_10011718 | 3300011119 | Bacteria | 5449 |
| 273 | Ga0105246_10045538 | 3300011119 | Bacteria | 2988 |
| 274 | Ga0105246_10051663 | 3300011119 | Bacteria | 2824 |
| 275 | Ga0105246_10076994 | 3300011119 | Bacteria | 2365 |
| 276 | Ga0157371_10107012 | 3300013102 | Bacteria | 1984 |
| 277 | Ga0157371_10114335 | 3300013102 | Bacteria | 1917 |
| 278 | Ga0157370_10011155 | 3300013104 | Bacteria | 9418 |
| 279 | Ga0157370_10027475 | 3300013104 | Bacteria | 5611 |
| 280 | Ga0157369_10009270 | 3300013105 | Bacteria | 11262 |
| 281 | Ga0157369_10073150 | 3300013105 | Bacteria | 3678 |
| 282 | Ga0157369_10092031 | 3300013105 | Bacteria | 3236 |
| 283 | Ga0157369_10166995 | 3300013105 | Bacteria | 2320 |
| 284 | Ga0157369_10179529 | 3300013105 | Bacteria | 2228 |
| 285 | Ga0171462_1001 | 3300013250 | Bacteria | 1135406 |
| 286 | Ga0163162_10096158 | 3300013306 | Bacteria | 3050 |
| 287 | Ga0163162_10180635 | 3300013306 | Bacteria | 2236 |
| 288 | Ga0157372_10024275 | 3300013307 | Bacteria | 6583 |
| 289 | Ga0157372_10240518 | 3300013307 | Bacteria | 2101 |
| 290 | Ga0157375_10009533 | 3300013308 | Bacteria | 8524 |
| 291 | Ga0157375_10113808 | 3300013308 | Bacteria | 2807 |
| 292 | Ga0163163_10023526 | 3300014325 | Bacteria | 5848 |
| 293 | Ga0163163_10027387 | 3300014325 | Bacteria | 5459 |
| 294 | Ga0163163_10094123 | 3300014325 | Bacteria | 3013 |
| 295 | Ga0157380_10123417 | 3300014326 | Bacteria | 2198 |
| 296 | Ga0182008_10000566 | 3300014497 | Bacteria | 27335 |
| 297 | Ga0182008_10001782 | 3300014497 | Bacteria | 14098 |
| 298 | Ga0182008_10012848 | 3300014497 | Bacteria | 4412 |
| 299 | Ga0157379_10001992 | 3300014968 | Bacteria | 16912 |
| 300 | Ga0157379_10018022 | 3300014968 | Bacteria | 6223 |
| 301 | Ga0157379_10169475 | 3300014968 | Bacteria | 1971 |
| 302 | Ga0157376_10013386 | 3300014969 | Bacteria | 6119 |
| 303 | Ga0182007_10001078 | 3300015262 | Bacteria | 14864 |
| 304 | Ga0182007_10009441 | 3300015262 | Bacteria | 3930 |
| 305 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 306 | Ga0163161_10082328 | 3300017792 | Bacteria | 2371 |
| 307 | Ga0197907_10217434 | 3300020069 | Bacteria | 2413 |
| 308 | Ga0206350_10893355 | 3300020080 | Bacteria | 2188 |
| 309 | Ga0206354_10551289 | 3300020081 | Bacteria | 2130 |
| 310 | Ga0206353_10548390 | 3300020082 | Bacteria | 10514 |
| 311 | Ga0213875_10000250 | 3300021388 | Bacteria | 54123 |
| 312 | Ga0213875_10000488 | 3300021388 | Bacteria | 33637 |
| 313 | Ga0213875_10000514 | 3300021388 | Bacteria | 32222 |
| 314 | Ga0213875_10005151 | 3300021388 | Bacteria | 7072 |
| 315 | Ga0213875_10009992 | 3300021388 | Bacteria | 4775 |
| 316 | Ga0209436_104146 | 3300025208 | Bacteria | 3643 |
| 317 | Ga0209566_100043 | 3300025225 | Bacteria | 266609 |
| 318 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 319 | Ga0209672_100003 | 3300025228 | Bacteria | 1560476 |
| 320 | Ga0209672_101287 | 3300025228 | Bacteria | 9832 |
| 321 | Ga0209147_100285 | 3300025229 | Bacteria | 42943 |
| 322 | Ga0209147_100657 | 3300025229 | Bacteria | 17942 |
| 323 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 324 | Ga0209563_100222 | 3300025230 | Bacteria | 28212 |
| 325 | Ga0207427_100077 | 3300025231 | Bacteria | 149591 |
| 326 | Ga0209437_101291 | 3300025233 | Bacteria | 6746 |
| 327 | Ga0209258_100015 | 3300025242 | Bacteria | 706310 |
| 328 | Ga0209258_102017 | 3300025242 | Bacteria | 5848 |
| 329 | Ga0207425_1000229 | 3300025245 | Bacteria | 43700 |
| 330 | Ga0207425_1011324 | 3300025245 | Bacteria | 2133 |
| 331 | Ga0209646_1000209 | 3300025246 | Bacteria | 66608 |
| 332 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 333 | Ga0209677_100723 | 3300025253 | Bacteria | 16824 |
| 334 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 335 | Ga0209148_1000028 | 3300025254 | Bacteria | 582773 |
| 336 | Ga0209148_1003188 | 3300025254 | Bacteria | 4708 |
| 337 | Ga0209148_1003774 | 3300025254 | Bacteria | 3984 |
| 338 | Ga0209129_1000049 | 3300025258 | Bacteria | 268086 |
| 339 | Ga0209129_1000201 | 3300025258 | Bacteria | 75344 |
| 340 | Ga0209233_1000014 | 3300025261 | Bacteria | 996641 |
| 341 | Ga0209565_1001437 | 3300025263 | Bacteria | 10524 |
| 342 | Ga0209565_1002407 | 3300025263 | Bacteria | 6774 |
| 343 | Ga0209565_1003093 | 3300025263 | Bacteria | 5583 |
| 344 | Ga0209455_1000046 | 3300025272 | Bacteria | 382681 |
| 345 | Ga0209455_1002176 | 3300025272 | Bacteria | 7779 |
| 346 | Ga0209673_1001483 | 3300025273 | Bacteria | 21915 |
| 347 | Ga0209673_1005158 | 3300025273 | Bacteria | 6681 |
| 348 | Ga0209130_1000974 | 3300025284 | Bacteria | 22515 |
| 349 | Ga0209130_1004840 | 3300025284 | Bacteria | 4926 |
| 350 | Ga0209675_1002160 | 3300025291 | Bacteria | 10362 |
| 351 | Ga0209675_1004266 | 3300025291 | Bacteria | 6435 |
| 352 | Ga0209675_1005987 | 3300025291 | Bacteria | 4977 |
| 353 | Ga0209676_1000074 | 3300025292 | Bacteria | 305770 |
| 354 | Ga0209676_1000209 | 3300025292 | Bacteria | 130388 |
| 355 | Ga0209676_1000961 | 3300025292 | Bacteria | 34895 |
| 356 | Ga0209025_1000086 | 3300025294 | Bacteria | 262586 |
| 357 | Ga0209025_1000279 | 3300025294 | Bacteria | 116352 |
| 358 | Ga0209025_1000822 | 3300025294 | Bacteria | 49588 |
| 359 | Ga0209025_1001092 | 3300025294 | Bacteria | 39204 |
| 360 | Ga0209025_1041585 | 3300025294 | Bacteria | 1966 |
| 361 | Ga0209564_1004997 | 3300025295 | Bacteria | 7793 |
| 362 | Ga0209564_1005012 | 3300025295 | Bacteria | 7774 |
| 363 | Ga0209758_1000496 | 3300025297 | Bacteria | 64085 |
| 364 | Ga0209758_1006882 | 3300025297 | Bacteria | 7944 |
| 365 | Ga0209050_1000015 | 3300025298 | Bacteria | 759102 |
| 366 | Ga0209050_1000884 | 3300025298 | Bacteria | 40094 |
| 367 | Ga0209256_1000264 | 3300025299 | Bacteria | 92750 |
| 368 | Ga0209256_1000304 | 3300025299 | Bacteria | 85971 |
| 369 | Ga0207426_1000108 | 3300025302 | Bacteria | 242257 |
| 370 | Ga0207426_1000130 | 3300025302 | Bacteria | 210271 |
| 371 | Ga0207426_1006087 | 3300025302 | Bacteria | 5319 |
| 372 | Ga0207426_1006196 | 3300025302 | Bacteria | 5258 |
| 373 | Ga0209051_1000010 | 3300025303 | Bacteria | 641298 |
| 374 | Ga0209051_1000156 | 3300025303 | Bacteria | 128246 |
| 375 | Ga0209051_1000830 | 3300025303 | Bacteria | 31912 |
| 376 | Ga0209051_1001619 | 3300025303 | Bacteria | 18363 |
| 377 | Ga0209257_1000026 | 3300025304 | Bacteria | 723225 |
| 378 | Ga0209257_1000172 | 3300025304 | Bacteria | 167434 |
| 379 | Ga0209257_1003207 | 3300025304 | Bacteria | 14476 |
| 380 | Ga0207697_10001781 | 3300025315 | Bacteria | 11535 |
| 381 | Ga0207697_10014594 | 3300025315 | Bacteria | 3257 |
| 382 | Ga0207656_10000002 | 3300025321 | Bacteria | 792178 |
| 383 | Ga0207656_10026211 | 3300025321 | Bacteria | 2374 |
| 384 | Ga0207655_1010439 | 3300025728 | Bacteria | 5630 |
| 385 | Ga0207682_10025978 | 3300025893 | Bacteria | 2324 |
| 386 | Ga0207692_10000186 | 3300025898 | Bacteria | 20249 |
| 387 | Ga0207692_10004777 | 3300025898 | Bacteria | 5384 |
| 388 | Ga0207692_10024588 | 3300025898 | Bacteria | 2802 |
| 389 | Ga0207692_10033752 | 3300025898 | Bacteria | 2472 |
| 390 | Ga0207710_10000017 | 3300025900 | Bacteria | 370962 |
| 391 | Ga0207710_10000062 | 3300025900 | Bacteria | 164192 |
| 392 | Ga0207710_10011096 | 3300025900 | Bacteria | 3793 |
| 393 | Ga0207688_10048179 | 3300025901 | Bacteria | 2381 |
| 394 | Ga0207688_10051593 | 3300025901 | Bacteria | 2304 |
| 395 | Ga0207647_10003148 | 3300025904 | Bacteria | 12376 |
| 396 | Ga0207647_10012451 | 3300025904 | Bacteria | 5920 |
| 397 | Ga0207699_10000106 | 3300025906 | Bacteria | 58842 |
| 398 | Ga0207699_10009598 | 3300025906 | Bacteria | 4827 |
| 399 | Ga0207699_10017708 | 3300025906 | Bacteria | 3759 |
| 400 | Ga0207699_10061248 | 3300025906 | Bacteria | 2263 |
| 401 | Ga0207699_10061634 | 3300025906 | Bacteria | 2257 |
| 402 | Ga0207645_10006791 | 3300025907 | Bacteria | 8169 |
| 403 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 404 | Ga0207705_10070691 | 3300025909 | Bacteria | 2529 |
| 405 | Ga0207684_10003330 | 3300025910 | Bacteria | 15772 |
| 406 | Ga0207684_10010264 | 3300025910 | Bacteria | 8243 |
| 407 | Ga0207684_10017354 | 3300025910 | Bacteria | 6175 |
| 408 | Ga0207684_10024597 | 3300025910 | Bacteria | 5134 |
| 409 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 410 | Ga0207695_10000983 | 3300025913 | Bacteria | 50658 |
| 411 | Ga0207695_10001199 | 3300025913 | Bacteria | 44583 |
| 412 | Ga0207695_10012810 | 3300025913 | Bacteria | 10042 |
| 413 | Ga0207695_10034932 | 3300025913 | Bacteria | 5459 |
| 414 | Ga0207671_10000002 | 3300025914 | Bacteria | 1144816 |
| 415 | Ga0207671_10000371 | 3300025914 | Bacteria | 63641 |
| 416 | Ga0207693_10014760 | 3300025915 | Bacteria | 6275 |
| 417 | Ga0207693_10020593 | 3300025915 | Bacteria | 5244 |
| 418 | Ga0207693_10042577 | 3300025915 | Bacteria | 3574 |
| 419 | Ga0207663_10000661 | 3300025916 | Bacteria | 15240 |
| 420 | Ga0207663_10050913 | 3300025916 | Bacteria | 2576 |
| 421 | Ga0207663_10063777 | 3300025916 | Bacteria | 2348 |
| 422 | Ga0207657_10006095 | 3300025919 | Bacteria | 12537 |
| 423 | Ga0207657_10031297 | 3300025919 | Bacteria | 4823 |
| 424 | Ga0207657_10035487 | 3300025919 | Bacteria | 4471 |
| 425 | Ga0207649_10043813 | 3300025920 | Bacteria | 2738 |
| 426 | Ga0207652_10015342 | 3300025921 | Bacteria | 6221 |
| 427 | Ga0207646_10000434 | 3300025922 | Bacteria | 55879 |
| 428 | Ga0207646_10009064 | 3300025922 | Bacteria | 9882 |
| 429 | Ga0207646_10017313 | 3300025922 | Bacteria | 6747 |
| 430 | Ga0207646_10045671 | 3300025922 | Bacteria | 3932 |
| 431 | Ga0207646_10046390 | 3300025922 | Bacteria | 3898 |
| 432 | Ga0207646_10094101 | 3300025922 | Bacteria | 2684 |
| 433 | Ga0207681_10022072 | 3300025923 | Bacteria | 4055 |
| 434 | Ga0207694_10000022 | 3300025924 | Bacteria | 288900 |
| 435 | Ga0207694_10006984 | 3300025924 | Bacteria | 8571 |
| 436 | Ga0207687_10042757 | 3300025927 | Bacteria | 3119 |
| 437 | Ga0207687_10043672 | 3300025927 | Bacteria | 3089 |
| 438 | Ga0207687_10092574 | 3300025927 | Bacteria | 2208 |
| 439 | Ga0207700_10000053 | 3300025928 | Bacteria | 75986 |
| 440 | Ga0207700_10020110 | 3300025928 | Bacteria | 4526 |
| 441 | Ga0207700_10033204 | 3300025928 | Bacteria | 3691 |
| 442 | Ga0207700_10034015 | 3300025928 | Bacteria | 3654 |
| 443 | Ga0207664_10000869 | 3300025929 | Bacteria | 20441 |
| 444 | Ga0207664_10000949 | 3300025929 | Bacteria | 19516 |
| 445 | Ga0207664_10003140 | 3300025929 | Bacteria | 10973 |
| 446 | Ga0207664_10007844 | 3300025929 | Bacteria | 7417 |
| 447 | Ga0207664_10019890 | 3300025929 | Bacteria | 4969 |
| 448 | Ga0207664_10042322 | 3300025929 | Bacteria | 3555 |
| 449 | Ga0207664_10053802 | 3300025929 | Bacteria | 3188 |
| 450 | Ga0207664_10070580 | 3300025929 | Bacteria | 2812 |
| 451 | Ga0207664_10072195 | 3300025929 | Bacteria | 2782 |
| 452 | Ga0207690_10000189 | 3300025932 | Bacteria | 47490 |
| 453 | Ga0207690_10019543 | 3300025932 | Bacteria | 4174 |
| 454 | Ga0207706_10091931 | 3300025933 | Bacteria | 2668 |
| 455 | Ga0207686_10012807 | 3300025934 | Bacteria | 4621 |
| 456 | Ga0207686_10106914 | 3300025934 | Bacteria | 1879 |
| 457 | Ga0207709_10000433 | 3300025935 | Bacteria | 39614 |
| 458 | Ga0207709_10001930 | 3300025935 | Bacteria | 13624 |
| 459 | Ga0207709_10003225 | 3300025935 | Bacteria | 9792 |
| 460 | Ga0207709_10004881 | 3300025935 | Bacteria | 7676 |
| 461 | Ga0207709_10011362 | 3300025935 | Bacteria | 4910 |
| 462 | Ga0207709_10016612 | 3300025935 | Bacteria | 4093 |
| 463 | Ga0207709_10017782 | 3300025935 | Bacteria | 3973 |
| 464 | Ga0207709_10036161 | 3300025935 | Bacteria | 2926 |
| 465 | Ga0207709_10036449 | 3300025935 | Bacteria | 2915 |
| 466 | Ga0207665_10000166 | 3300025939 | Bacteria | 44650 |
| 467 | Ga0207665_10003060 | 3300025939 | Bacteria | 11221 |
| 468 | Ga0207665_10005581 | 3300025939 | Bacteria | 8389 |
| 469 | Ga0207665_10012322 | 3300025939 | Bacteria | 5616 |
| 470 | Ga0207691_10001822 | 3300025940 | Bacteria | 20843 |
| 471 | Ga0207691_10004770 | 3300025940 | Bacteria | 13115 |
| 472 | Ga0207691_10076862 | 3300025940 | Bacteria | 3009 |
| 473 | Ga0207711_10000593 | 3300025941 | Bacteria | 36689 |
| 474 | Ga0207711_10001430 | 3300025941 | Bacteria | 22343 |
| 475 | Ga0207711_10004915 | 3300025941 | Bacteria | 11346 |
| 476 | Ga0207711_10018109 | 3300025941 | Bacteria | 5856 |
| 477 | Ga0207689_10020565 | 3300025942 | Bacteria | 5554 |
| 478 | Ga0207661_10028912 | 3300025944 | Bacteria | 4251 |
| 479 | Ga0207661_10029768 | 3300025944 | Bacteria | 4197 |
| 480 | Ga0207661_10035553 | 3300025944 | Bacteria | 3883 |
| 481 | Ga0207679_10078159 | 3300025945 | Bacteria | 2520 |
| 482 | Ga0207667_10014198 | 3300025949 | Bacteria | 9089 |
| 483 | Ga0207667_10021231 | 3300025949 | Bacteria | 7198 |
| 484 | Ga0207667_10021635 | 3300025949 | Bacteria | 7124 |
| 485 | Ga0207667_10024976 | 3300025949 | Bacteria | 6551 |
| 486 | Ga0207667_10154988 | 3300025949 | Bacteria | 2357 |
| 487 | Ga0207667_10188859 | 3300025949 | Bacteria | 2114 |
| 488 | Ga0207712_10001330 | 3300025961 | Bacteria | 16919 |
| 489 | Ga0207712_10024793 | 3300025961 | Bacteria | 3978 |
| 490 | Ga0207668_10019243 | 3300025972 | Bacteria | 4311 |
| 491 | Ga0207658_10061919 | 3300025986 | Bacteria | 2798 |
| 492 | Ga0207703_10000006 | 3300026035 | Bacteria | 502351 |
| 493 | Ga0207703_10000064 | 3300026035 | Bacteria | 126619 |
| 494 | Ga0207703_10127966 | 3300026035 | Bacteria | 2189 |
| 495 | Ga0207639_10058457 | 3300026041 | Bacteria | 2966 |
| 496 | Ga0207639_10096701 | 3300026041 | Bacteria | 2376 |
| 497 | Ga0207678_10026466 | 3300026067 | Bacteria | 5059 |
| 498 | Ga0207708_10000897 | 3300026075 | Bacteria | 22343 |
| 499 | Ga0207708_10019229 | 3300026075 | Bacteria | 5145 |
| 500 | Ga0207702_10016001 | 3300026078 | Bacteria | 6210 |
| 501 | Ga0207702_10038950 | 3300026078 | Bacteria | 3982 |
| 502 | Ga0207702_10050966 | 3300026078 | Bacteria | 3496 |
| 503 | Ga0207641_10000357 | 3300026088 | Bacteria | 54479 |
| 504 | Ga0207648_10001889 | 3300026089 | Bacteria | 22892 |
| 505 | Ga0207674_10002289 | 3300026116 | Bacteria | 24291 |
| 506 | Ga0207674_10002541 | 3300026116 | Bacteria | 22988 |
| 507 | Ga0207674_10004262 | 3300026116 | Bacteria | 17251 |
| 508 | Ga0207674_10027562 | 3300026116 | Bacteria | 6007 |
| 509 | Ga0207674_10040825 | 3300026116 | Bacteria | 4803 |
| 510 | Ga0207674_10112573 | 3300026116 | Bacteria | 2695 |
| 511 | Ga0207674_10118576 | 3300026116 | Bacteria | 2616 |
| 512 | Ga0207675_100017737 | 3300026118 | Bacteria | 6640 |
| 513 | Ga0207675_100021530 | 3300026118 | Bacteria | 6005 |
| 514 | Ga0207675_100037656 | 3300026118 | Bacteria | 4512 |
| 515 | Ga0207683_10006712 | 3300026121 | Bacteria | 9847 |
| 516 | Ga0207683_10010893 | 3300026121 | Bacteria | 7755 |
| 517 | Ga0207698_10000744 | 3300026142 | Bacteria | 18903 |
| 518 | Ga0207698_10000881 | 3300026142 | Bacteria | 17390 |
| 519 | Ga0207698_10062208 | 3300026142 | Bacteria | 2914 |
| 520 | Ga0207698_10070547 | 3300026142 | Bacteria | 2769 |
| 521 | Ga0207698_10134565 | 3300026142 | Bacteria | 2119 |
| 522 | Ga0209281_1000017 | 3300027111 | Bacteria | 583251 |
| 523 | Ga0209389_1000059 | 3300027296 | Bacteria | 106207 |
| 524 | Ga0209813_10003346 | 3300027866 | Bacteria | 3743 |
| 525 | Ga0207428_10000102 | 3300027907 | Bacteria | 118940 |
| 526 | Ga0207428_10021600 | 3300027907 | Bacteria | 5447 |
| 527 | Ga0207428_10023405 | 3300027907 | Bacteria | 5195 |
| 528 | Ga0268266_10005786 | 3300028379 | Bacteria | 11448 |
| 529 | Ga0268266_10007499 | 3300028379 | Bacteria | 9836 |
| 530 | Ga0268266_10135855 | 3300028379 | Bacteria | 2203 |
| 531 | Ga0268265_10000041 | 3300028380 | Bacteria | 189918 |
| 532 | Ga0268264_10000246 | 3300028381 | Bacteria | 102361 |
| 533 | Ga0268264_10089662 | 3300028381 | Bacteria | 2648 |
| 534 | Ga0265337_1000031 | 3300028556 | Bacteria | 64194 |
| 535 | Ga0265319_1003061 | 3300028563 | Bacteria | 8856 |
| 536 | Ga0265334_10000091 | 3300028573 | Bacteria | 64750 |
| 537 | Ga0265334_10001270 | 3300028573 | Bacteria | 12251 |
| 538 | Ga0265323_10005541 | 3300028653 | Bacteria | 5356 |
| 539 | Ga0307517_10014055 | 3300028786 | Bacteria | 10797 |
| 540 | Ga0307517_10038332 | 3300028786 | Bacteria | 5310 |
| 541 | Ga0307515_10009209 | 3300028794 | Bacteria | 19123 |
| 542 | Ga0307515_10011010 | 3300028794 | Bacteria | 17230 |
| 543 | Ga0307515_10068065 | 3300028794 | Bacteria | 4899 |
| 544 | Ga0307515_10075891 | 3300028794 | Bacteria | 4469 |
| 545 | Ga0265338_10000233 | 3300028800 | Bacteria | 103593 |
| 546 | Ga0265338_10007550 | 3300028800 | Bacteria | 13445 |
| 547 | Ga0265338_10008581 | 3300028800 | Bacteria | 12367 |
| 548 | Ga0265338_10008722 | 3300028800 | Bacteria | 12255 |
| 549 | Ga0265338_10013142 | 3300028800 | Bacteria | 9378 |
| 550 | Ga0307511_10000751 | 3300030521 | Bacteria | 34613 |
| 551 | Ga0307511_10008735 | 3300030521 | Bacteria | 10125 |
| 552 | Ga0307512_10007694 | 3300030522 | Bacteria | 10622 |
| 553 | Ga0314311_1181306 | 3300030733 | Bacteria | 2776 |
| 554 | Ga0265332_10000006 | 3300031238 | Bacteria | 327963 |
| 555 | Ga0265328_10013552 | 3300031239 | Bacteria | 3226 |
| 556 | Ga0265320_10004172 | 3300031240 | Bacteria | 9495 |
| 557 | Ga0265325_10008286 | 3300031241 | Bacteria | 6139 |
| 558 | Ga0265325_10041176 | 3300031241 | Bacteria | 2422 |
| 559 | Ga0265340_10007133 | 3300031247 | Bacteria | 6090 |
| 560 | Ga0265340_10028204 | 3300031247 | Bacteria | 2825 |
| 561 | Ga0265339_10022542 | 3300031249 | Bacteria | 3649 |
| 562 | Ga0265327_10000019 | 3300031251 | Bacteria | 427653 |
| 563 | Ga0265327_10000183 | 3300031251 | Bacteria | 133191 |
| 564 | Ga0307513_10014769 | 3300031456 | Bacteria | 9496 |
| 565 | Ga0307513_10027182 | 3300031456 | Bacteria | 6574 |
| 566 | Ga0307513_10140542 | 3300031456 | Bacteria | 2342 |
| 567 | Ga0307513_10170324 | 3300031456 | Bacteria | 2056 |
| 568 | Ga0307509_10188955 | 3300031507 | Bacteria | 1913 |
| 569 | Ga0307408_100003857 | 3300031548 | Bacteria | 10200 |
| 570 | Ga0307408_100005598 | 3300031548 | Bacteria | 8399 |
| 571 | Ga0307408_100006285 | 3300031548 | Bacteria | 7886 |
| 572 | Ga0307408_100007559 | 3300031548 | Bacteria | 7185 |
| 573 | Ga0307408_100016251 | 3300031548 | Bacteria | 4964 |
| 574 | Ga0307408_100017107 | 3300031548 | Bacteria | 4850 |
| 575 | Ga0307408_100019305 | 3300031548 | Bacteria | 4588 |
| 576 | Ga0307408_100019852 | 3300031548 | Bacteria | 4527 |
| 577 | Ga0265313_10016922 | 3300031595 | Bacteria | 4170 |
| 578 | Ga0307508_10004145 | 3300031616 | Bacteria | 14266 |
| 579 | Ga0307508_10005673 | 3300031616 | Bacteria | 11829 |
| 580 | Ga0307514_10001437 | 3300031649 | Bacteria | 29185 |
| 581 | Ga0307514_10004905 | 3300031649 | Bacteria | 12158 |
| 582 | Ga0307514_10019860 | 3300031649 | Bacteria | 5494 |
| 583 | Ga0307514_10026254 | 3300031649 | Bacteria | 4711 |
| 584 | Ga0316575_10000018 | 3300031665 | Bacteria | 42928 |
| 585 | Ga0316575_10001941 | 3300031665 | Bacteria | 6843 |
| 586 | Ga0316579_10013154 | 3300031691 | Bacteria | 3557 |
| 587 | Ga0265314_10004372 | 3300031711 | Bacteria | 13149 |
| 588 | Ga0265314_10026176 | 3300031711 | Bacteria | 4387 |
| 589 | Ga0265342_10007083 | 3300031712 | Bacteria | 8264 |
| 590 | Ga0316576_10004581 | 3300031727 | Bacteria | 8314 |
| 591 | Ga0316578_10000364 | 3300031728 | Bacteria | 14435 |
| 592 | Ga0316578_10025309 | 3300031728 | Bacteria | 3335 |
| 593 | Ga0307516_10093837 | 3300031730 | Bacteria | 2826 |
| 594 | Ga0307405_10001845 | 3300031731 | Bacteria | 9086 |
| 595 | Ga0307405_10002105 | 3300031731 | Bacteria | 8674 |
| 596 | Ga0307405_10010452 | 3300031731 | Bacteria | 4811 |
| 597 | Ga0307405_10011740 | 3300031731 | Bacteria | 4608 |
| 598 | Ga0307405_10015727 | 3300031731 | Bacteria | 4105 |
| 599 | Ga0307405_10018242 | 3300031731 | Bacteria | 3868 |
| 600 | Ga0307405_10032042 | 3300031731 | Bacteria | 3102 |
| 601 | Ga0307405_10052973 | 3300031731 | Bacteria | 2525 |
| 602 | Ga0307413_10001911 | 3300031824 | Bacteria | 8246 |
| 603 | Ga0307413_10014644 | 3300031824 | Bacteria | 3992 |
| 604 | Ga0307410_10000323 | 3300031852 | Bacteria | 18618 |
| 605 | Ga0307410_10014413 | 3300031852 | Bacteria | 4650 |
| 606 | Ga0307410_10017434 | 3300031852 | Bacteria | 4313 |
| 607 | Ga0307410_10025312 | 3300031852 | Bacteria | 3722 |
| 608 | Ga0307410_10047928 | 3300031852 | Bacteria | 2859 |
| 609 | Ga0307410_10048087 | 3300031852 | Bacteria | 2854 |
| 610 | Ga0307406_10000126 | 3300031901 | Bacteria | 44932 |
| 611 | Ga0307406_10001419 | 3300031901 | Bacteria | 13274 |
| 612 | Ga0307406_10002924 | 3300031901 | Bacteria | 9302 |
| 613 | Ga0307406_10004754 | 3300031901 | Bacteria | 7396 |
| 614 | Ga0307406_10015634 | 3300031901 | Bacteria | 4396 |
| 615 | Ga0307406_10033406 | 3300031901 | Bacteria | 3149 |
| 616 | Ga0307406_10040519 | 3300031901 | Bacteria | 2897 |
| 617 | Ga0307406_10061689 | 3300031901 | Bacteria | 2422 |
| 618 | Ga0307407_10002987 | 3300031903 | Bacteria | 6792 |
| 619 | Ga0307407_10003910 | 3300031903 | Bacteria | 6219 |
| 620 | Ga0307407_10010042 | 3300031903 | Bacteria | 4444 |
| 621 | Ga0307407_10015535 | 3300031903 | Bacteria | 3767 |
| 622 | Ga0307407_10023760 | 3300031903 | Bacteria | 3203 |
| 623 | Ga0307407_10028232 | 3300031903 | Bacteria | 2997 |
| 624 | Ga0307412_10002071 | 3300031911 | Bacteria | 11131 |
| 625 | Ga0307412_10005539 | 3300031911 | Bacteria | 7092 |
| 626 | Ga0307412_10008137 | 3300031911 | Bacteria | 5974 |
| 627 | Ga0307412_10010104 | 3300031911 | Bacteria | 5428 |
| 628 | Ga0307412_10013117 | 3300031911 | Bacteria | 4849 |
| 629 | Ga0307412_10016091 | 3300031911 | Bacteria | 4447 |
| 630 | Ga0307412_10018006 | 3300031911 | Bacteria | 4240 |
| 631 | Ga0307412_10064512 | 3300031911 | Bacteria | 2475 |
| 632 | Ga0307412_10114192 | 3300031911 | Bacteria | 1933 |
| 633 | Ga0307409_100002136 | 3300031995 | Bacteria | 10185 |
| 634 | Ga0307409_100002325 | 3300031995 | Bacteria | 9871 |
| 635 | Ga0307409_100006212 | 3300031995 | Bacteria | 6992 |
| 636 | Ga0307409_100021393 | 3300031995 | Bacteria | 4434 |
| 637 | Ga0307409_100031733 | 3300031995 | Bacteria | 3818 |
| 638 | Ga0307409_100036390 | 3300031995 | Bacteria | 3618 |
| 639 | Ga0307416_100000046 | 3300032002 | Bacteria | 120916 |
| 640 | Ga0307416_100010993 | 3300032002 | Bacteria | 6009 |
| 641 | Ga0307416_100015457 | 3300032002 | Bacteria | 5274 |
| 642 | Ga0307416_100015813 | 3300032002 | Bacteria | 5223 |
| 643 | Ga0307416_100028464 | 3300032002 | Bacteria | 4155 |
| 644 | Ga0307416_100028502 | 3300032002 | Bacteria | 4153 |
| 645 | Ga0307416_100039439 | 3300032002 | Bacteria | 3657 |
| 646 | Ga0307416_100120896 | 3300032002 | Bacteria | 2333 |
| 647 | Ga0307416_100146689 | 3300032002 | Bacteria | 2156 |
| 648 | Ga0307411_10000436 | 3300032005 | Bacteria | 14249 |
| 649 | Ga0307411_10042891 | 3300032005 | Bacteria | 2891 |
| 650 | Ga0307415_100000050 | 3300032126 | Bacteria | 51540 |
| 651 | Ga0307415_100001823 | 3300032126 | Bacteria | 10436 |
| 652 | Ga0307415_100030264 | 3300032126 | Bacteria | 3472 |
| 653 | Ga0307415_100031243 | 3300032126 | Bacteria | 3428 |
| 654 | Ga0307415_100044246 | 3300032126 | Bacteria | 2975 |
| 655 | Ga0316585_10012240 | 3300032137 | Bacteria | 2538 |
| 656 | Ga0316585_10013757 | 3300032137 | Bacteria | 2410 |
| 657 | Ga0307507_10013353 | 3300033179 | Bacteria | 9980 |
| 658 | Ga0307507_10119239 | 3300033179 | Bacteria | 2117 |
| 659 | Ga0307510_10027928 | 3300033180 | Bacteria | 6453 |
| 660 | Ga0307510_10088495 | 3300033180 | Bacteria | 2956 |
| 661 | Ga0373926_0000865 | 3300035083 | Bacteria | 8653 |
| 662 | Ga0373926_0002814 | 3300035083 | Bacteria | 5557 |
| 663 | Ga0373934_0006884 | 3300035086 | Bacteria | 4220 |
| 664 | Ga0373944_0003068 | 3300035089 | Bacteria | 4293 |
| 665 | Ga0373923_0003076 | 3300035111 | Bacteria | 5285 |
| 666 | Ga0373923_0007372 | 3300035111 | Bacteria | 3863 |
| 667 | Ga0373923_0027195 | 3300035111 | Bacteria | 2280 |
| 668 | Ga0373936_0008511 | 3300035113 | Bacteria | 3865 |
| 669 | Ga0373945_0000182 | 3300035116 | Bacteria | 16849 |
| 670 | Ga0373954_0005660 | 3300035118 | Bacteria | 5416 |
| 671 | Ga0373954_0007919 | 3300035118 | Bacteria | 4654 |
| 672 | Ga0373956_0001955 | 3300035119 | Bacteria | 8527 |
| 673 | Ga0373956_0003024 | 3300035119 | Bacteria | 6811 |
| 674 | Ga0373957_0000075 | 3300035120 | Bacteria | 24277 |
| 675 | Ga0373957_0005287 | 3300035120 | Bacteria | 3995 |
| 676 | Ga0373943_0000977 | 3300035170 | Bacteria | 12693 |
| 677 | Ga0373943_0008756 | 3300035170 | Bacteria | 4532 |
| 678 | Ga0373946_0000413 | 3300035171 | Bacteria | 13922 |
| 679 | Ga0373955_0000013 | 3300035172 | Bacteria | 73449 |
| 680 | Ga0316574_0000620 | 3300035398 | Bacteria | 14834 |
| 681 | Ga0316574_0006103 | 3300035398 | Bacteria | 6483 |
| 682 | Ga0316574_0099693 | 3300035398 | Bacteria | 1858 |
| 683 | Ga0373924_0000065 | 3300035410 | Bacteria | 27687 |
| 684 | Ga0373924_0002376 | 3300035410 | Bacteria | 6335 |
| 685 | Ga0373924_0004378 | 3300035410 | Bacteria | 4927 |
| 686 | Ga0373931_0017406 | 3300035691 | Bacteria | 3554 |
| 687 | Ga0373935_0000348 | 3300035692 | Bacteria | 23484 |
| 688 | Ga0373935_0004199 | 3300035692 | Bacteria | 8436 |
| 689 | Ga0373935_0084097 | 3300035692 | Bacteria | 2072 |
| 690 | Ga0373927_0006703 | 3300035695 | Bacteria | 7835 |
| 691 | Ga0373933_0009213 | 3300035724 | Bacteria | 5389 |
| 692 | Ga0373933_0013657 | 3300035724 | Bacteria | 4503 |
| 693 | Ga0373933_0057308 | 3300035724 | Bacteria | 2341 |
| 694 | Ga0373947_0000004 | 3300035725 | Bacteria | 248228 |
| 695 | Ga0373937_0000336 | 3300036401 | Bacteria | 44361 |
| 696 | Ga0373937_0058487 | 3300036401 | Bacteria | 3541 |
| 697 | Ga0373937_0070358 | 3300036401 | Bacteria | 3227 |
| 698 | Ga0316582_0005540 | 3300036647 | Bacteria | 6515 |
| 699 | Ga0373925_0000008 | 3300037068 | Bacteria | 249158 |
| 700 | Ga0373925_0034901 | 3300037068 | Bacteria | 3708 |
| 701 | Ga0373925_0057053 | 3300037068 | Bacteria | 2925 |
| 702 | Ga0395899_0000958 | 3300037312 | Bacteria | 26854 |
| 703 | Ga0395899_0001686 | 3300037312 | Bacteria | 18415 |
| 704 | Ga0395899_0005130 | 3300037312 | Bacteria | 10185 |
| 705 | Ga0395900_0005784 | 3300037418 | Bacteria | 12916 |
| 706 | Ga0395900_0016794 | 3300037418 | Bacteria | 7466 |
| 707 | Ga0395900_0059129 | 3300037418 | Bacteria | 3946 |
| 708 | Ga0395900_0060860 | 3300037418 | Bacteria | 3884 |
| 709 | Ga0395900_0222184 | 3300037418 | Bacteria | 1903 |
| 710 | Ga0395898_0000098 | 3300037466 | Bacteria | 229806 |
| 711 | Ga0395898_0008019 | 3300037466 | Bacteria | 11200 |
| 712 | Ga0395898_0057804 | 3300037466 | Bacteria | 3778 |
| 713 | Ga0395898_0062169 | 3300037466 | Bacteria | 3626 |
| 714 | Ga0395898_0099706 | 3300037466 | Bacteria | 2790 |
| 715 | Ga0395898_0108430 | 3300037466 | Bacteria | 2662 |
| 716 | Ga0395898_0114974 | 3300037466 | Bacteria | 2578 |
| 717 | Ga0395905_0005189 | 3300037471 | Bacteria | 13351 |
| 718 | Ga0436364_0132601 | 3300037853 | Bacteria | 24278 |
| 719 | Ga0436364_0214533 | 3300037853 | Bacteria | 14394 |
| 720 | Ga0436364_0220436 | 3300037853 | Bacteria | 2228 |
| 721 | Ga0436364_0287407 | 3300037853 | Bacteria | 132611 |
| 722 | Ga0436364_0370872 | 3300037853 | Bacteria | 2378 |
| 723 | Ga0436364_0711490 | 3300037853 | Bacteria | 21692 |
| 724 | Ga0436364_1085870 | 3300037853 | Bacteria | 14936 |
| 725 | Ga0436364_1379988 | 3300037853 | Bacteria | 24630 |
| 726 | Ga0395901_0004916 | 3300038443 | Bacteria | 13488 |
| 727 | Ga0395901_0007569 | 3300038443 | Bacteria | 10967 |
| 728 | Ga0395901_0012624 | 3300038443 | Bacteria | 8571 |
| 729 | Ga0395901_0012908 | 3300038443 | Bacteria | 8473 |
| 730 | Ga0395901_0024722 | 3300038443 | Bacteria | 6167 |
| 731 | Ga0395901_0029932 | 3300038443 | Bacteria | 5608 |
| 732 | Ga0395901_0048675 | 3300038443 | Bacteria | 4402 |
| 733 | Ga0395901_0048880 | 3300038443 | Bacteria | 4393 |
| 734 | Ga0395901_0075774 | 3300038443 | Bacteria | 3510 |
| 735 | Ga0395901_0091401 | 3300038443 | Bacteria | 3186 |
| 736 | Ga0400485_06792 | 3300038735 | Bacteria | 25476 |
| 737 | Ga0400488_30705 | 3300038741 | Bacteria | 11438 |
| 738 | Ga0400486_28029 | 3300038742 | Bacteria | 34737 |
| 739 | Ga0436365_0033839 | 3300039437 | Bacteria | 5986 |
| 740 | Ga0436365_1506144 | 3300039437 | Bacteria | 2818 |
| 741 | Ga0439436_0001748 | 3300041404 | Bacteria | 6370 |
| 742 | Ga0439436_0003722 | 3300041404 | Bacteria | 4653 |
| 743 | Ga0439436_0005736 | 3300041404 | Bacteria | 3805 |
| 744 | Ga0439436_0007310 | 3300041404 | Bacteria | 3399 |
| 745 | Ga0439439_0001564 | 3300041406 | Bacteria | 4603 |
| 746 | Ga0439466_0009365 | 3300041411 | Bacteria | 3659 |
| 747 | Ga0439466_0016304 | 3300041411 | Bacteria | 2686 |
| 748 | Ga0439465_0008468 | 3300041413 | Bacteria | 3247 |
| 749 | Ga0439465_0015558 | 3300041413 | Bacteria | 2374 |
| 750 | Ga0451837_0657235 | 3300041494 | Bacteria | 6107 |
| 751 | Ga0439433_0000773 | 3300041999 | Bacteria | 6312 |
| 752 | Ga0439433_0004729 | 3300041999 | Bacteria | 2923 |
| 753 | Ga0439442_000057 | 3300042002 | Bacteria | 26095 |
| 754 | Ga0439442_002691 | 3300042002 | Bacteria | 3487 |
| 755 | Ga0439448_0004385 | 3300042005 | Bacteria | 3983 |
| 756 | Ga0439432_000995 | 3300042006 | Bacteria | 10711 |
| 757 | Ga0439449_0004606 | 3300042007 | Bacteria | 5327 |
| 758 | Ga0439449_0005656 | 3300042007 | Bacteria | 4781 |
| 759 | Ga0439452_009170 | 3300042010 | Bacteria | 2929 |
| 760 | Ga0439457_000316 | 3300042014 | Bacteria | 13330 |
| 761 | Ga0439457_002913 | 3300042014 | Bacteria | 4768 |
| 762 | Ga0439457_004376 | 3300042014 | Bacteria | 3688 |
| 763 | Ga0439457_006789 | 3300042014 | Bacteria | 2777 |
| 764 | Ga0439462_0000292 | 3300042015 | Bacteria | 9240 |
| 765 | Ga0450911_000036 | 3300042115 | Bacteria | 60797 |
| 766 | Ga0450894_000053 | 3300042131 | Bacteria | 17593 |
| 767 | Ga0450899_001598 | 3300042135 | Bacteria | 2502 |
| 768 | Ga0450902_000354 | 3300042137 | Bacteria | 5599 |
| 769 | Ga0450905_003021 | 3300042142 | Bacteria | 2196 |
| 770 | Ga0450907_000926 | 3300042146 | Bacteria | 6981 |
| 771 | Ga0439434_0007901 | 3300042435 | Bacteria | 3119 |
| 772 | Ga0450901_000013 | 3300042533 | Bacteria | 18184 |
| 773 | Ga0451577_0008355 | 3300042876 | Bacteria | 10075 |
| 774 | Ga0451577_0020062 | 3300042876 | Bacteria | 6138 |
| 775 | Ga0439440_0003562 | 3300042993 | Bacteria | 3011 |
| 776 | Ga0466969_0003237 | 3300044656 | Bacteria | 8662 |
| 777 | Ga0466969_0003937 | 3300044656 | Bacteria | 7886 |
| 778 | Ga0466969_0011020 | 3300044656 | Bacteria | 4787 |
| 779 | Ga0466969_0013550 | 3300044656 | Bacteria | 4294 |
| 780 | Ga0466969_0021423 | 3300044656 | Bacteria | 3342 |
| 781 | Ga0466969_0027170 | 3300044656 | Bacteria | 2931 |
| 782 | Ga0466972_0002348 | 3300044658 | Bacteria | 9327 |
| 783 | Ga0466972_0008717 | 3300044658 | Bacteria | 5084 |
| 784 | Ga0466972_0011951 | 3300044658 | Bacteria | 4362 |
| 785 | Ga0466972_0015351 | 3300044658 | Bacteria | 3829 |
| 786 | Ga0466972_0016390 | 3300044658 | Bacteria | 3706 |
| 787 | Ga0466972_0038856 | 3300044658 | Bacteria | 2324 |
| 788 | Ga0453683_0007877 | 3300044673 | Bacteria | 7187 |
| 789 | Ga0466965_0001118 | 3300044683 | Bacteria | 10481 |
| 790 | Ga0466965_0003356 | 3300044683 | Bacteria | 7019 |
| 791 | Ga0466965_0011414 | 3300044683 | Bacteria | 4164 |
| 792 | Ga0466965_0028398 | 3300044683 | Bacteria | 2718 |
| 793 | Ga0466965_0047653 | 3300044683 | Bacteria | 2122 |
| 794 | Ga0466966_0002982 | 3300044684 | Bacteria | 11147 |
| 795 | Ga0466966_0005391 | 3300044684 | Bacteria | 8407 |
| 796 | Ga0466966_0014252 | 3300044684 | Bacteria | 5264 |
| 797 | Ga0466966_0018034 | 3300044684 | Bacteria | 4661 |
| 798 | Ga0466966_0027234 | 3300044684 | Bacteria | 3728 |
| 799 | Ga0466966_0082728 | 3300044684 | Bacteria | 1997 |
| 800 | Ga0466966_0084442 | 3300044684 | Bacteria | 1975 |
| 801 | Ga0466961_0003814 | 3300044693 | Bacteria | 9431 |
| 802 | Ga0466961_0011269 | 3300044693 | Bacteria | 5715 |
| 803 | Ga0466961_0027590 | 3300044693 | Bacteria | 3652 |
| 804 | Ga0466961_0029108 | 3300044693 | Bacteria | 3551 |
| 805 | Ga0466961_0044676 | 3300044693 | Bacteria | 2835 |
| 806 | Ga0466961_0049372 | 3300044693 | Bacteria | 2689 |
| 807 | Ga0466961_0049728 | 3300044693 | Bacteria | 2679 |
| 808 | Ga0466961_0070653 | 3300044693 | Bacteria | 2216 |
| 809 | Ga0466963_0000177 | 3300044694 | Bacteria | 26340 |
| 810 | Ga0466963_0000859 | 3300044694 | Bacteria | 15348 |
| 811 | Ga0466963_0001380 | 3300044694 | Bacteria | 12998 |
| 812 | Ga0466963_0023435 | 3300044694 | Bacteria | 3921 |
| 813 | Ga0466963_0029795 | 3300044694 | Bacteria | 3516 |
| 814 | Ga0466963_0035088 | 3300044694 | Bacteria | 3266 |
| 815 | Ga0466963_0036504 | 3300044694 | Bacteria | 3206 |
| 816 | Ga0466963_0100299 | 3300044694 | Bacteria | 1981 |
| 817 | Ga0466964_0003790 | 3300044706 | Bacteria | 5543 |
| 818 | Ga0466964_0005906 | 3300044706 | Bacteria | 4558 |
| 819 | Ga0453684_0028691 | 3300044712 | Bacteria | 7928 |
| 820 | Ga0453684_0039654 | 3300044712 | Bacteria | 6412 |
| 821 | Ga0466971_0000394 | 3300044719 | Bacteria | 16912 |
| 822 | Ga0466971_0000548 | 3300044719 | Bacteria | 14868 |
| 823 | Ga0466971_0001709 | 3300044719 | Bacteria | 9301 |
| 824 | Ga0466971_0005419 | 3300044719 | Bacteria | 5535 |
| 825 | Ga0466971_0008322 | 3300044719 | Bacteria | 4526 |
| 826 | Ga0466971_0014172 | 3300044719 | Bacteria | 3505 |
| 827 | Ga0466971_0019127 | 3300044719 | Bacteria | 3040 |
| 828 | Ga0466971_0025072 | 3300044719 | Bacteria | 2663 |
| 829 | Ga0466968_0002141 | 3300044735 | Bacteria | 7197 |
| 830 | Ga0466968_0020101 | 3300044735 | Bacteria | 2692 |
| 831 | Ga0466968_0052709 | 3300044735 | Bacteria | 1741 |
| 832 | Ga0466970_0000599 | 3300044765 | Bacteria | 17670 |
| 833 | Ga0466970_0000683 | 3300044765 | Bacteria | 16572 |
| 834 | Ga0466970_0000767 | 3300044765 | Bacteria | 15563 |
| 835 | Ga0466970_0008393 | 3300044765 | Bacteria | 5197 |
| 836 | Ga0466970_0016267 | 3300044765 | Bacteria | 3833 |
| 837 | Ga0466970_0021539 | 3300044765 | Bacteria | 3357 |
| 838 | Ga0466970_0026285 | 3300044765 | Bacteria | 3051 |
| 839 | Ga0466970_0036219 | 3300044765 | Bacteria | 2613 |
| 840 | Ga0466970_0048458 | 3300044765 | Bacteria | 2265 |
| 841 | Ga0466957_0000564 | 3300044842 | Bacteria | 18694 |
| 842 | Ga0466957_0002004 | 3300044842 | Bacteria | 10844 |
| 843 | Ga0466957_0002915 | 3300044842 | Bacteria | 9266 |
| 844 | Ga0466957_0003511 | 3300044842 | Bacteria | 8620 |
| 845 | Ga0466957_0005913 | 3300044842 | Bacteria | 6897 |
| 846 | Ga0466957_0006505 | 3300044842 | Bacteria | 6598 |
| 847 | Ga0466957_0008538 | 3300044842 | Bacteria | 5829 |
| 848 | Ga0466957_0044097 | 3300044842 | Bacteria | 2702 |
| 849 | Ga0466957_0051141 | 3300044842 | Bacteria | 2515 |
| 850 | Ga0466957_0092920 | 3300044842 | Bacteria | 1893 |
| 851 | Ga0466960_0001455 | 3300044901 | Bacteria | 8629 |
| 852 | Ga0466960_0005069 | 3300044901 | Bacteria | 5205 |
| 853 | Ga0466960_0010726 | 3300044901 | Bacteria | 3812 |
| 854 | Ga0466960_0024582 | 3300044901 | Bacteria | 2719 |
| 855 | Ga0466960_0037581 | 3300044901 | Bacteria | 2272 |
| 856 | Ga0466960_0061772 | 3300044901 | Bacteria | 1840 |
| 857 | Ga0466959_0001241 | 3300045049 | Bacteria | 15410 |
| 858 | Ga0466959_0003447 | 3300045049 | Bacteria | 10352 |
| 859 | Ga0466959_0003694 | 3300045049 | Bacteria | 10096 |
| 860 | Ga0466959_0021315 | 3300045049 | Bacteria | 4778 |
| 861 | Ga0466959_0027764 | 3300045049 | Bacteria | 4197 |
| 862 | Ga0466959_0046007 | 3300045049 | Bacteria | 3212 |
| 863 | Ga0466959_0047755 | 3300045049 | Bacteria | 3148 |
| 864 | Ga0451576_0018666 | 3300045051 | Bacteria | 7588 |
| 865 | Ga0466958_0000784 | 3300045836 | Bacteria | 14001 |
| 866 | Ga0466958_0002002 | 3300045836 | Bacteria | 10028 |
| 867 | Ga0466958_0009851 | 3300045836 | Bacteria | 5333 |
| 868 | Ga0466958_0010462 | 3300045836 | Bacteria | 5197 |
| 869 | Ga0466958_0012190 | 3300045836 | Bacteria | 4861 |
| 870 | Ga0466958_0014277 | 3300045836 | Bacteria | 4535 |
| 871 | Ga0466958_0026999 | 3300045836 | Bacteria | 3395 |
| 872 | Ga0466958_0069878 | 3300045836 | Bacteria | 2148 |
| 873 | Ga0466967_0000237 | 3300045976 | Bacteria | 24015 |
| 874 | Ga0466967_0000439 | 3300045976 | Bacteria | 19905 |
| 875 | Ga0466967_0006810 | 3300045976 | Bacteria | 8147 |
| 876 | Ga0466967_0009642 | 3300045976 | Bacteria | 7179 |
| 877 | Ga0466967_0010619 | 3300045976 | Bacteria | 6920 |
| 878 | Ga0466967_0014660 | 3300045976 | Bacteria | 6117 |
| 879 | Ga0466967_0015286 | 3300045976 | Bacteria | 6012 |
| 880 | Ga0466967_0016174 | 3300045976 | Bacteria | 5873 |
| 881 | Ga0466967_0016752 | 3300045976 | Bacteria | 5791 |
| 882 | Ga0466967_0027070 | 3300045976 | Bacteria | 4763 |
| 883 | Ga0466967_0056008 | 3300045976 | Bacteria | 3475 |
| 884 | Ga0466967_0065625 | 3300045976 | Bacteria | 3231 |
| 885 | Ga0466967_0067148 | 3300045976 | Bacteria | 3198 |
| 886 | Ga0466967_0071568 | 3300045976 | Bacteria | 3106 |
| 887 | Ga0466967_0098880 | 3300045976 | Bacteria | 2664 |
| 888 | Ga0466967_0100182 | 3300045976 | Bacteria | 2647 |
| 889 | Ga0466967_0117740 | 3300045976 | Bacteria | 2449 |
| 890 | Ga0466967_0133703 | 3300045976 | Bacteria | 2305 |
| 891 | Ga0466967_0137789 | 3300045976 | Bacteria | 2270 |
| 892 | Ga0466967_0144086 | 3300045976 | Bacteria | 2221 |
| 893 | Ga0466967_0163906 | 3300045976 | Bacteria | 2088 |
| 894 | Ga0466967_0172165 | 3300045976 | Bacteria | 2038 |
| 895 | Ga0466967_0232033 | 3300045976 | Bacteria | 1757 |
| 896 | Ga0495617_019271 | 3300046452 | Bacteria | 2307 |
| 897 | Ga0495592_0000094 | 3300046454 | Bacteria | 78801 |
| 898 | Ga0495592_0006662 | 3300046454 | Bacteria | 8610 |
| 899 | Ga0495592_0023690 | 3300046454 | Bacteria | 4669 |
| 900 | Ga0495592_0033965 | 3300046454 | Bacteria | 3847 |
| 901 | Ga0495603_0000669 | 3300046455 | Bacteria | 19408 |
| 902 | Ga0495603_0001010 | 3300046455 | Bacteria | 16242 |
| 903 | Ga0495603_0002872 | 3300046455 | Bacteria | 10187 |
| 904 | Ga0495603_0004938 | 3300046455 | Bacteria | 7984 |
| 905 | Ga0495603_0006758 | 3300046455 | Bacteria | 6882 |
| 906 | Ga0495603_0078736 | 3300046455 | Bacteria | 1932 |
| 907 | Ga0495590_0000227 | 3300046457 | Bacteria | 30807 |
| 908 | Ga0495629_0002738 | 3300046459 | Bacteria | 13485 |
| 909 | Ga0495629_0004235 | 3300046459 | Bacteria | 10754 |
| 910 | Ga0495629_0022598 | 3300046459 | Bacteria | 4482 |
| 911 | Ga0495629_0029618 | 3300046459 | Bacteria | 3881 |
| 912 | Ga0495629_0042180 | 3300046459 | Bacteria | 3207 |
| 913 | Ga0495651_0000041 | 3300046462 | Bacteria | 94160 |
| 914 | Ga0495651_0002692 | 3300046462 | Bacteria | 13787 |
| 915 | Ga0495651_0013925 | 3300046462 | Bacteria | 6219 |
| 916 | Ga0495651_0017144 | 3300046462 | Bacteria | 5612 |
| 917 | Ga0495651_0020354 | 3300046462 | Bacteria | 5150 |
| 918 | Ga0495651_0027748 | 3300046462 | Bacteria | 4412 |
| 919 | Ga0495651_0077856 | 3300046462 | Bacteria | 2509 |
| 920 | Ga0495651_0078318 | 3300046462 | Bacteria | 2500 |
| 921 | Ga0495653_0000888 | 3300046463 | Bacteria | 23132 |
| 922 | Ga0495653_0001553 | 3300046463 | Bacteria | 17945 |
| 923 | Ga0495653_0005594 | 3300046463 | Bacteria | 10247 |
| 924 | Ga0495653_0009782 | 3300046463 | Bacteria | 7840 |
| 925 | Ga0495653_0016023 | 3300046463 | Bacteria | 6109 |
| 926 | Ga0495653_0035328 | 3300046463 | Bacteria | 3945 |
| 927 | Ga0495653_0057281 | 3300046463 | Bacteria | 2966 |
| 928 | Ga0495653_0061707 | 3300046463 | Bacteria | 2835 |
| 929 | Ga0495650_0002733 | 3300046471 | Bacteria | 13667 |
| 930 | Ga0495580_0004763 | 3300046472 | Bacteria | 11354 |
| 931 | Ga0495582_0020589 | 3300046473 | Bacteria | 3611 |
| 932 | Ga0495582_0040292 | 3300046473 | Bacteria | 2572 |
| 933 | Ga0495639_0005355 | 3300046475 | Bacteria | 5524 |
| 934 | Ga0495639_0014844 | 3300046475 | Bacteria | 3376 |
| 935 | Ga0495639_0015370 | 3300046475 | Bacteria | 3319 |
| 936 | Ga0495662_0000490 | 3300046476 | Bacteria | 18037 |
| 937 | Ga0495662_0003913 | 3300046476 | Bacteria | 7512 |
| 938 | Ga0495662_0016589 | 3300046476 | Bacteria | 3568 |
| 939 | Ga0495662_0018560 | 3300046476 | Bacteria | 3366 |
| 940 | Ga0495662_0051892 | 3300046476 | Bacteria | 1979 |
| 941 | Ga0495664_0006585 | 3300046477 | Bacteria | 6420 |
| 942 | Ga0495664_0014367 | 3300046477 | Bacteria | 4488 |
| 943 | Ga0495664_0060537 | 3300046477 | Bacteria | 2254 |
| 944 | Ga0495585_0025941 | 3300046492 | Bacteria | 3351 |
| 945 | Ga0495594_0004245 | 3300046499 | Bacteria | 7359 |
| 946 | Ga0495594_0039489 | 3300046499 | Bacteria | 2581 |
| 947 | Ga0495607_0012834 | 3300046501 | Bacteria | 5510 |
| 948 | Ga0495607_0054822 | 3300046501 | Bacteria | 2296 |
| 949 | Ga0495608_0000081 | 3300046511 | Bacteria | 69898 |
| 950 | Ga0495608_0003322 | 3300046511 | Bacteria | 11507 |
| 951 | Ga0495608_0019838 | 3300046511 | Bacteria | 4624 |
| 952 | Ga0495608_0030128 | 3300046511 | Bacteria | 3676 |
| 953 | Ga0495608_0050312 | 3300046511 | Bacteria | 2764 |
| 954 | Ga0495608_0053335 | 3300046511 | Bacteria | 2675 |
| 955 | Ga0495616_0001315 | 3300046513 | Bacteria | 17340 |
| 956 | Ga0495618_0005659 | 3300046514 | Bacteria | 7597 |
| 957 | Ga0495618_0010625 | 3300046514 | Bacteria | 5572 |
| 958 | Ga0495620_0009619 | 3300046515 | Bacteria | 5131 |
| 959 | Ga0495628_0000164 | 3300046516 | Bacteria | 57810 |
| 960 | Ga0495628_0005418 | 3300046516 | Bacteria | 11179 |
| 961 | Ga0495628_0011191 | 3300046516 | Bacteria | 7592 |
| 962 | Ga0495628_0021126 | 3300046516 | Bacteria | 5360 |
| 963 | Ga0495628_0027189 | 3300046516 | Bacteria | 4657 |
| 964 | Ga0495628_0087074 | 3300046516 | Bacteria | 2422 |
| 965 | Ga0495630_0004990 | 3300046517 | Bacteria | 9336 |
| 966 | Ga0495630_0019859 | 3300046517 | Bacteria | 4945 |
| 967 | Ga0495630_0025052 | 3300046517 | Bacteria | 4410 |
| 968 | Ga0495630_0091446 | 3300046517 | Bacteria | 2299 |
| 969 | Ga0495631_0000382 | 3300046518 | Bacteria | 30522 |
| 970 | Ga0495637_0011661 | 3300046520 | Bacteria | 4219 |
| 971 | Ga0495643_0028846 | 3300046522 | Bacteria | 3108 |
| 972 | Ga0495663_0015683 | 3300046525 | Bacteria | 2136 |
| 973 | Ga0495666_0014640 | 3300046526 | Bacteria | 3904 |
| 974 | Ga0495666_0022852 | 3300046526 | Bacteria | 3094 |
| 975 | Ga0495642_0022835 | 3300046528 | Bacteria | 2467 |
| 976 | Ga0495642_0042216 | 3300046528 | Bacteria | 1857 |
| 977 | Ga0495652_0000289 | 3300046529 | Bacteria | 59692 |
| 978 | Ga0495652_0009990 | 3300046529 | Bacteria | 8601 |
| 979 | Ga0495652_0014752 | 3300046529 | Bacteria | 7006 |
| 980 | Ga0495652_0015739 | 3300046529 | Bacteria | 6769 |
| 981 | Ga0495652_0023514 | 3300046529 | Bacteria | 5463 |
| 982 | Ga0495652_0049005 | 3300046529 | Bacteria | 3617 |
| 983 | Ga0495665_0001254 | 3300046531 | Bacteria | 13505 |
| 984 | Ga0495665_0003807 | 3300046531 | Bacteria | 8164 |
| 985 | Ga0495665_0007087 | 3300046531 | Bacteria | 6050 |
| 986 | Ga0495665_0024051 | 3300046531 | Bacteria | 3272 |
| 987 | Ga0495640_0005210 | 3300046533 | Bacteria | 10332 |
| 988 | Ga0495640_0026089 | 3300046533 | Bacteria | 4228 |
| 989 | Ga0495640_0041777 | 3300046533 | Bacteria | 3203 |
| 990 | Ga0495640_0045965 | 3300046533 | Bacteria | 3027 |
| 991 | Ga0495586_0008159 | 3300046535 | Bacteria | 5580 |
| 992 | Ga0495586_0015352 | 3300046535 | Bacteria | 4075 |
| 993 | Ga0495586_0022466 | 3300046535 | Bacteria | 3366 |
| 994 | Ga0495587_0000038 | 3300046536 | Bacteria | 116118 |
| 995 | Ga0495587_0000669 | 3300046536 | Bacteria | 22978 |
| 996 | Ga0495587_0003319 | 3300046536 | Bacteria | 10743 |
| 997 | Ga0495587_0011319 | 3300046536 | Bacteria | 5654 |
| 998 | Ga0495587_0055243 | 3300046536 | Bacteria | 2339 |
| 999 | Ga0495609_0049091 | 3300046538 | Bacteria | 1884 |
| 1000 | Ga0495597_0001209 | 3300046542 | Bacteria | 19263 |
| 1001 | Ga0495645_0004299 | 3300046543 | Bacteria | 9733 |
| 1002 | Ga0495645_0007697 | 3300046543 | Bacteria | 7495 |
| 1003 | Ga0495645_0008837 | 3300046543 | Bacteria | 7036 |
| 1004 | Ga0495645_0033523 | 3300046543 | Bacteria | 3746 |
| 1005 | Ga0495645_0054733 | 3300046543 | Bacteria | 2898 |
| 1006 | Ga0495622_0003240 | 3300046557 | Bacteria | 7705 |
| 1007 | Ga0495633_0000657 | 3300046558 | Bacteria | 31904 |
| 1008 | Ga0495633_0063266 | 3300046558 | Bacteria | 1731 |
| 1009 | Ga0495667_0000070 | 3300046559 | Bacteria | 78776 |
| 1010 | Ga0495667_0002311 | 3300046559 | Bacteria | 12765 |
| 1011 | Ga0495667_0003843 | 3300046559 | Bacteria | 10087 |
| 1012 | Ga0495667_0004000 | 3300046559 | Bacteria | 9898 |
| 1013 | Ga0495667_0019683 | 3300046559 | Bacteria | 4553 |
| 1014 | Ga0495667_0044554 | 3300046559 | Bacteria | 2938 |
| 1015 | Ga0495656_0032591 | 3300046615 | Bacteria | 2121 |
| 1016 | Ga0495668_0001747 | 3300046616 | Bacteria | 19925 |
| 1017 | Ga0495634_0001770 | 3300046642 | Bacteria | 18689 |
| 1018 | Ga0495634_0012977 | 3300046642 | Bacteria | 6028 |
| 1019 | Ga0495634_0016111 | 3300046642 | Bacteria | 5350 |
| 1020 | Ga0495634_0026200 | 3300046642 | Bacteria | 4070 |
| 1021 | Ga0495611_0006045 | 3300046648 | Bacteria | 5164 |
| 1022 | Ga0495625_0027105 | 3300046660 | Bacteria | 4319 |
| 1023 | Ga0495625_0082704 | 3300046660 | Bacteria | 2232 |
| 1024 | Ga0495635_0022760 | 3300046663 | Bacteria | 4368 |
| 1025 | Ga0495635_0054674 | 3300046663 | Bacteria | 2749 |
| 1026 | Ga0495635_0106102 | 3300046663 | Bacteria | 1919 |
| 1027 | Ga0495588_0009123 | 3300046674 | Bacteria | 4575 |
| 1028 | Ga0495588_0011498 | 3300046674 | Bacteria | 4157 |
| 1029 | Ga0495588_0011567 | 3300046674 | Bacteria | 4144 |
| 1030 | Ga0495588_0012941 | 3300046674 | Bacteria | 3960 |
| 1031 | Ga0495588_0014089 | 3300046674 | Bacteria | 3822 |
| 1032 | Ga0495588_0023001 | 3300046674 | Bacteria | 3082 |
| 1033 | Ga0495588_0027976 | 3300046674 | Bacteria | 2819 |
| 1034 | Ga0495657_0000192 | 3300046675 | Bacteria | 55017 |
| 1035 | Ga0495657_0001890 | 3300046675 | Bacteria | 17803 |
| 1036 | Ga0495657_0005519 | 3300046675 | Bacteria | 9995 |
| 1037 | Ga0495657_0006450 | 3300046675 | Bacteria | 9179 |
| 1038 | Ga0495657_0044179 | 3300046675 | Bacteria | 3032 |
| 1039 | Ga0495657_0047372 | 3300046675 | Bacteria | 2906 |
| 1040 | Ga0495657_0054015 | 3300046675 | Bacteria | 2685 |
| 1041 | Ga0495657_0084082 | 3300046675 | Bacteria | 2053 |
| 1042 | Ga0495599_0002816 | 3300046678 | Bacteria | 10130 |
| 1043 | Ga0495599_0003579 | 3300046678 | Bacteria | 9107 |
| 1044 | Ga0495599_0030269 | 3300046678 | Bacteria | 3395 |
| 1045 | Ga0495623_0000248 | 3300046679 | Bacteria | 34834 |
| 1046 | Ga0495623_0002383 | 3300046679 | Bacteria | 12478 |
| 1047 | Ga0495623_0034878 | 3300046679 | Bacteria | 3225 |
| 1048 | Ga0495646_0000278 | 3300046680 | Bacteria | 26142 |
| 1049 | Ga0495646_0001725 | 3300046680 | Bacteria | 13115 |
| 1050 | Ga0495646_0014856 | 3300046680 | Bacteria | 4945 |
| 1051 | Ga0495646_0036489 | 3300046680 | Bacteria | 3044 |
| 1052 | Ga0495647_0000976 | 3300046681 | Bacteria | 8665 |
| 1053 | Ga0495658_0048348 | 3300046683 | Bacteria | 2398 |
| 1054 | Ga0495658_0055715 | 3300046683 | Bacteria | 2253 |
| 1055 | Ga0495658_0072858 | 3300046683 | Bacteria | 1998 |
| 1056 | Ga0495669_0021449 | 3300046684 | Bacteria | 2803 |
| 1057 | Ga0495613_0003778 | 3300046689 | Bacteria | 11345 |
| 1058 | Ga0495613_0006602 | 3300046689 | Bacteria | 8670 |
| 1059 | Ga0495613_0028816 | 3300046689 | Bacteria | 4129 |
| 1060 | Ga0495613_0034771 | 3300046689 | Bacteria | 3742 |
| 1061 | Ga0495613_0063948 | 3300046689 | Bacteria | 2691 |
| 1062 | Ga0495624_0007537 | 3300046690 | Bacteria | 7636 |
| 1063 | Ga0495624_0042797 | 3300046690 | Bacteria | 2893 |
| 1064 | Ga0495670_0022410 | 3300046691 | Bacteria | 3118 |
| 1065 | Ga0495671_0008689 | 3300046692 | Bacteria | 5707 |
| 1066 | Ga0495589_0027648 | 3300046794 | Bacteria | 2868 |
| 1067 | Ga0495589_0029548 | 3300046794 | Bacteria | 2763 |
| 1068 | Ga0495600_0005479 | 3300046809 | Bacteria | 7655 |
| 1069 | Ga0495600_0016887 | 3300046809 | Bacteria | 4640 |
| 1070 | Ga0495600_0022609 | 3300046809 | Bacteria | 4038 |
| 1071 | Ga0495600_0029739 | 3300046809 | Bacteria | 3537 |
| 1072 | Ga0495600_0047245 | 3300046809 | Bacteria | 2807 |
| 1073 | Ga0495600_0057700 | 3300046809 | Bacteria | 2535 |
| 1074 | Ga0495600_0082472 | 3300046809 | Bacteria | 2098 |
| 1075 | Ga0495660_0002746 | 3300046810 | Bacteria | 11100 |
| 1076 | Ga0495581_0001126 | 3300047315 | Bacteria | 14627 |
| 1077 | Ga0495581_0004980 | 3300047315 | Bacteria | 7689 |
| 1078 | Ga0495581_0011966 | 3300047315 | Bacteria | 5020 |
| 1079 | Ga0495581_0015229 | 3300047315 | Bacteria | 4464 |
| 1080 | Ga0495581_0016628 | 3300047315 | Bacteria | 4276 |
| 1081 | Ga0495581_0037166 | 3300047315 | Bacteria | 2817 |
| 1082 | Ga0495581_0085038 | 3300047315 | Bacteria | 1833 |
| 1083 | Ga0495604_0000061 | 3300047317 | Bacteria | 94158 |
| 1084 | Ga0495604_0000868 | 3300047317 | Bacteria | 25246 |
| 1085 | Ga0495604_0025409 | 3300047317 | Bacteria | 4720 |
| 1086 | Ga0495604_0025499 | 3300047317 | Bacteria | 4711 |
| 1087 | Ga0495604_0037243 | 3300047317 | Bacteria | 3831 |
| 1088 | Ga0495604_0055044 | 3300047317 | Bacteria | 3068 |
| 1089 | Ga0495636_0005765 | 3300047318 | Bacteria | 4853 |
| 1090 | Ga0495636_0016968 | 3300047318 | Bacteria | 2911 |
| 1091 | Ga0495636_0018142 | 3300047318 | Bacteria | 2822 |
| 1092 | Ga0495636_0021053 | 3300047318 | Bacteria | 2630 |
| 1093 | Ga0495674_0010600 | 3300047319 | Bacteria | 8722 |
| 1094 | Ga0495674_0026893 | 3300047319 | Bacteria | 5262 |
| 1095 | Ga0495674_0044498 | 3300047319 | Bacteria | 3947 |
| 1096 | Ga0495674_0049212 | 3300047319 | Bacteria | 3725 |
| 1097 | Ga0495672_0009497 | 3300047320 | Bacteria | 7045 |
| 1098 | Ga0495676_0010245 | 3300047321 | Bacteria | 8509 |
| 1099 | Ga0495676_0050630 | 3300047321 | Bacteria | 3329 |
| 1100 | Ga0495676_0051628 | 3300047321 | Bacteria | 3288 |
| 1101 | Ga0495676_0065324 | 3300047321 | Bacteria | 2824 |
| 1102 | Ga0495676_0072838 | 3300047321 | Bacteria | 2636 |
| 1103 | Ga0495676_0104458 | 3300047321 | Bacteria | 2090 |
| 1104 | Ga0495680_0000099 | 3300047322 | Bacteria | 78801 |
| 1105 | Ga0495680_0002145 | 3300047322 | Bacteria | 20477 |
| 1106 | Ga0495680_0007008 | 3300047322 | Bacteria | 10394 |
| 1107 | Ga0495680_0020086 | 3300047322 | Bacteria | 5628 |
| 1108 | Ga0495680_0051439 | 3300047322 | Bacteria | 3216 |
| 1109 | Ga0495680_0086540 | 3300047322 | Bacteria | 2357 |
| 1110 | Ga0495683_0000534 | 3300047323 | Bacteria | 28829 |
| 1111 | Ga0495683_0028087 | 3300047323 | Bacteria | 2876 |
| 1112 | Ga0495687_023466 | 3300047443 | Bacteria | 2945 |
| 1113 | Ga0495687_024164 | 3300047443 | Bacteria | 2893 |
| 1114 | Ga0495675_0000597 | 3300047444 | Bacteria | 23291 |
| 1115 | Ga0495675_0004430 | 3300047444 | Bacteria | 8495 |
| 1116 | Ga0495675_0016513 | 3300047444 | Bacteria | 4669 |
| 1117 | Ga0495677_0026424 | 3300047445 | Bacteria | 2106 |
| 1118 | Ga0495685_004937 | 3300047447 | Bacteria | 4333 |
| 1119 | Ga0495685_007407 | 3300047447 | Bacteria | 3622 |
| 1120 | Ga0495685_009033 | 3300047447 | Bacteria | 3322 |
| 1121 | Ga0495685_009324 | 3300047447 | Bacteria | 3276 |
| 1122 | Ga0495681_0007141 | 3300047470 | Bacteria | 7191 |
| 1123 | Ga0495684_0018790 | 3300047471 | Bacteria | 5325 |
| 1124 | Ga0495684_0026486 | 3300047471 | Bacteria | 4457 |
| 1125 | Ga0495684_0027484 | 3300047471 | Bacteria | 4368 |
| 1126 | Ga0495684_0074495 | 3300047471 | Bacteria | 2579 |
| 1127 | Ga0495684_0076083 | 3300047471 | Bacteria | 2550 |
| 1128 | Ga0495686_0018267 | 3300047472 | Bacteria | 4709 |
| 1129 | Ga0495593_0003998 | 3300047673 | Bacteria | 8795 |
| 1130 | Ga0495593_0009194 | 3300047673 | Bacteria | 5729 |
| 1131 | Ga0495602_0000319 | 3300048088 | Bacteria | 44489 |
| 1132 | Ga0495602_0017318 | 3300048088 | Bacteria | 7225 |
| 1133 | Ga0495602_0018424 | 3300048088 | Bacteria | 6972 |
| 1134 | Ga0495614_0012492 | 3300048089 | Bacteria | 3725 |
| 1135 | Ga0495614_0022327 | 3300048089 | Bacteria | 2731 |
| 1136 | Ga0495614_0039984 | 3300048089 | Bacteria | 2013 |
| 1137 | Ga0496100_0008684 | 3300048903 | Bacteria | 5675 |
| 1138 | Ga0496100_0009015 | 3300048903 | Bacteria | 5588 |
| 1139 | Ga0496100_0009305 | 3300048903 | Bacteria | 5518 |
| 1140 | Ga0496100_0013346 | 3300048903 | Bacteria | 4736 |
| 1141 | Ga0496100_0021797 | 3300048903 | Bacteria | 3865 |
| 1142 | Ga0496100_0024129 | 3300048903 | Bacteria | 3705 |
| 1143 | Ga0496100_0045991 | 3300048903 | Bacteria | 2803 |
| 1144 | Ga0496100_0053971 | 3300048903 | Bacteria | 2619 |
| 1145 | Ga0496101_0006147 | 3300048904 | Bacteria | 7707 |
| 1146 | Ga0496101_0018337 | 3300048904 | Bacteria | 4757 |
| 1147 | Ga0496101_0036802 | 3300048904 | Bacteria | 3467 |
| 1148 | Ga0496101_0069423 | 3300048904 | Bacteria | 2578 |
| 1149 | Ga0496102_0000121 | 3300048905 | Bacteria | 112133 |
| 1150 | Ga0496102_0003371 | 3300048905 | Bacteria | 13548 |
| 1151 | Ga0496102_0011485 | 3300048905 | Bacteria | 7637 |
| 1152 | Ga0496102_0013458 | 3300048905 | Bacteria | 7087 |
| 1153 | Ga0496102_0016668 | 3300048905 | Bacteria | 6426 |
| 1154 | Ga0496102_0021055 | 3300048905 | Bacteria | 5766 |
| 1155 | Ga0496102_0044021 | 3300048905 | Bacteria | 4049 |
| 1156 | Ga0496102_0045926 | 3300048905 | Bacteria | 3966 |
| 1157 | Ga0496102_0054849 | 3300048905 | Bacteria | 3635 |
| 1158 | Ga0496102_0055400 | 3300048905 | Bacteria | 3616 |
| 1159 | Ga0496102_0078123 | 3300048905 | Bacteria | 3047 |
| 1160 | Ga0496102_0116897 | 3300048905 | Bacteria | 2489 |
| 1161 | Ga0496102_0146233 | 3300048905 | Bacteria | 2218 |
| 1162 | Ga0496103_0000224 | 3300048906 | Bacteria | 55730 |
| 1163 | Ga0496103_0009243 | 3300048906 | Bacteria | 5840 |
| 1164 | Ga0496103_0024195 | 3300048906 | Bacteria | 3664 |
| 1165 | Ga0496103_0030937 | 3300048906 | Bacteria | 3259 |
| 1166 | Ga0496104_0003155 | 3300048907 | Bacteria | 14192 |
| 1167 | Ga0496104_0010383 | 3300048907 | Bacteria | 8318 |
| 1168 | Ga0496104_0026269 | 3300048907 | Bacteria | 5374 |
| 1169 | Ga0496104_0042691 | 3300048907 | Bacteria | 4257 |
| 1170 | Ga0496104_0072403 | 3300048907 | Bacteria | 3277 |
| 1171 | Ga0496104_0092129 | 3300048907 | Bacteria | 2898 |
| 1172 | Ga0496105_0001578 | 3300048908 | Bacteria | 16154 |
| 1173 | Ga0496105_0002299 | 3300048908 | Bacteria | 13865 |
| 1174 | Ga0496105_0013756 | 3300048908 | Bacteria | 6424 |
| 1175 | Ga0496105_0062127 | 3300048908 | Bacteria | 3083 |
| 1176 | Ga0496105_0080500 | 3300048908 | Bacteria | 2690 |
| 1177 | Ga0496105_0150492 | 3300048908 | Bacteria | 1913 |
| 1178 | Ga0496106_0030266 | 3300048909 | Bacteria | 4037 |
| 1179 | Ga0496106_0033123 | 3300048909 | Bacteria | 3854 |
| 1180 | Ga0496106_0046042 | 3300048909 | Bacteria | 3278 |
| 1181 | Ga0496106_0066798 | 3300048909 | Bacteria | 2740 |
| 1182 | Ga0496107_0028614 | 3300048910 | Bacteria | 3961 |
| 1183 | Ga0496107_0045741 | 3300048910 | Bacteria | 3149 |
| 1184 | Ga0496107_0047975 | 3300048910 | Bacteria | 3075 |
| 1185 | Ga0496107_0068220 | 3300048910 | Bacteria | 2581 |
| 1186 | Ga0496108_0011795 | 3300048911 | Bacteria | 7109 |
| 1187 | Ga0496108_0011859 | 3300048911 | Bacteria | 7090 |
| 1188 | Ga0496108_0043405 | 3300048911 | Bacteria | 3756 |
| 1189 | Ga0496108_0063215 | 3300048911 | Bacteria | 3117 |
| 1190 | Ga0496108_0075342 | 3300048911 | Bacteria | 2851 |
| 1191 | Ga0496108_0097184 | 3300048911 | Bacteria | 2509 |
| 1192 | Ga0496109_0004982 | 3300048912 | Bacteria | 11090 |
| 1193 | Ga0496109_0007565 | 3300048912 | Bacteria | 9207 |
| 1194 | Ga0496109_0027727 | 3300048912 | Bacteria | 5060 |
| 1195 | Ga0496109_0027940 | 3300048912 | Bacteria | 5042 |
| 1196 | Ga0496109_0047585 | 3300048912 | Bacteria | 3900 |
| 1197 | Ga0496109_0051803 | 3300048912 | Bacteria | 3739 |
| 1198 | Ga0496109_0054036 | 3300048912 | Bacteria | 3665 |
| 1199 | Ga0496109_0054251 | 3300048912 | Bacteria | 3656 |
| 1200 | Ga0496109_0067691 | 3300048912 | Bacteria | 3272 |
| 1201 | Ga0496110_0000029 | 3300048913 | Bacteria | 69418 |
| 1202 | Ga0496110_0006086 | 3300048913 | Bacteria | 9507 |
| 1203 | Ga0496110_0007385 | 3300048913 | Bacteria | 8771 |
| 1204 | Ga0496110_0042296 | 3300048913 | Bacteria | 3977 |
| 1205 | Ga0496110_0070365 | 3300048913 | Bacteria | 3100 |
| 1206 | Ga0496110_0074672 | 3300048913 | Bacteria | 3011 |
| 1207 | Ga0496110_0077499 | 3300048913 | Bacteria | 2957 |
| 1208 | Ga0496110_0136298 | 3300048913 | Bacteria | 2218 |
| 1209 | Ga0496111_0001582 | 3300048914 | Bacteria | 13150 |
| 1210 | Ga0496111_0017455 | 3300048914 | Bacteria | 4963 |
| 1211 | Ga0496111_0023458 | 3300048914 | Bacteria | 4333 |
| 1212 | Ga0496112_0081252 | 3300048915 | Bacteria | 3205 |
| 1213 | Ga0496112_0084481 | 3300048915 | Bacteria | 3140 |
| 1214 | Ga0496112_0087242 | 3300048915 | Bacteria | 3087 |
| 1215 | Ga0496112_0184865 | 3300048915 | Bacteria | 2048 |
| 1216 | Ga0496113_0002367 | 3300048916 | Bacteria | 10927 |
| 1217 | Ga0496113_0022948 | 3300048916 | Bacteria | 4422 |
| 1218 | Ga0496113_0051703 | 3300048916 | Bacteria | 3067 |
| 1219 | Ga0496114_0001105 | 3300048917 | Bacteria | 20371 |
| 1220 | Ga0496114_0002027 | 3300048917 | Bacteria | 15424 |
| 1221 | Ga0496114_0008469 | 3300048917 | Bacteria | 8148 |
| 1222 | Ga0496114_0008504 | 3300048917 | Bacteria | 8136 |
| 1223 | Ga0496114_0068772 | 3300048917 | Bacteria | 2973 |
| 1224 | Ga0496114_0096124 | 3300048917 | Bacteria | 2522 |
| 1225 | Ga0496114_0140665 | 3300048917 | Bacteria | 2089 |
| 1226 | Ga0496115_0001767 | 3300048918 | Bacteria | 15470 |
| 1227 | Ga0496115_0004766 | 3300048918 | Bacteria | 9843 |
| 1228 | Ga0496115_0017134 | 3300048918 | Bacteria | 5530 |
| 1229 | Ga0496115_0034135 | 3300048918 | Bacteria | 4020 |
| 1230 | Ga0496115_0047192 | 3300048918 | Bacteria | 3443 |
| 1231 | Ga0496115_0063077 | 3300048918 | Bacteria | 2990 |
| 1232 | Ga0496115_0122599 | 3300048918 | Bacteria | 2139 |
| 1233 | Ga0496116_0000192 | 3300048919 | Bacteria | 122270 |
| 1234 | Ga0496116_0001646 | 3300048919 | Bacteria | 24574 |
| 1235 | Ga0496116_0024962 | 3300048919 | Bacteria | 4405 |
| 1236 | Ga0496117_0000028 | 3300048920 | Bacteria | 407392 |
| 1237 | Ga0496117_0000084 | 3300048920 | Bacteria | 214308 |
| 1238 | Ga0496117_0000827 | 3300048920 | Bacteria | 47916 |
| 1239 | Ga0496117_0001658 | 3300048920 | Bacteria | 31204 |
| 1240 | Ga0496117_0003700 | 3300048920 | Bacteria | 17553 |
| 1241 | Ga0496117_0004915 | 3300048920 | Bacteria | 14357 |
| 1242 | Ga0496117_0005959 | 3300048920 | Bacteria | 12568 |
| 1243 | Ga0496117_0009224 | 3300048920 | Bacteria | 9226 |
| 1244 | Ga0496117_0010513 | 3300048920 | Bacteria | 8418 |
| 1245 | Ga0496117_0013171 | 3300048920 | Bacteria | 7233 |
| 1246 | Ga0496117_0020415 | 3300048920 | Bacteria | 5400 |
| 1247 | Ga0496117_0046550 | 3300048920 | Bacteria | 3118 |
| 1248 | Ga0496117_0053468 | 3300048920 | Bacteria | 2837 |
| 1249 | Ga0496118_0000240 | 3300048921 | Bacteria | 96796 |
| 1250 | Ga0496118_0000593 | 3300048921 | Bacteria | 59957 |
| 1251 | Ga0496118_0006742 | 3300048921 | Bacteria | 12503 |
| 1252 | Ga0496118_0009293 | 3300048921 | Bacteria | 9967 |
| 1253 | Ga0496119_0000104 | 3300048922 | Bacteria | 121325 |
| 1254 | Ga0496119_0001365 | 3300048922 | Bacteria | 29774 |
| 1255 | Ga0496119_0003128 | 3300048922 | Bacteria | 17428 |
| 1256 | Ga0496119_0003294 | 3300048922 | Bacteria | 16870 |
| 1257 | Ga0496119_0003323 | 3300048922 | Bacteria | 16782 |
| 1258 | Ga0496119_0015916 | 3300048922 | Bacteria | 5757 |
| 1259 | Ga0496119_0018005 | 3300048922 | Bacteria | 5282 |
| 1260 | Ga0496119_0024996 | 3300048922 | Bacteria | 4181 |
| 1261 | Ga0496119_0058054 | 3300048922 | Bacteria | 2334 |
| 1262 | Ga0496120_0000050 | 3300048923 | Bacteria | 187078 |
| 1263 | Ga0496120_0000586 | 3300048923 | Bacteria | 55320 |
| 1264 | Ga0496120_0000622 | 3300048923 | Bacteria | 53364 |
| 1265 | Ga0496120_0001791 | 3300048923 | Bacteria | 24151 |
| 1266 | Ga0496120_0008685 | 3300048923 | Bacteria | 7322 |
| 1267 | Ga0496120_0034461 | 3300048923 | Bacteria | 3032 |
| 1268 | Ga0496121_0000025 | 3300048924 | Bacteria | 453467 |
| 1269 | Ga0496121_0000159 | 3300048924 | Bacteria | 147049 |
| 1270 | Ga0496121_0008036 | 3300048924 | Bacteria | 12575 |
| 1271 | Ga0496121_0008771 | 3300048924 | Bacteria | 11794 |
| 1272 | Ga0496121_0009318 | 3300048924 | Bacteria | 11323 |
| 1273 | Ga0496121_0046631 | 3300048924 | Bacteria | 3707 |
| 1274 | Ga0496121_0062848 | 3300048924 | Bacteria | 3038 |
| 1275 | Ga0496122_0000020 | 3300048925 | Bacteria | 401675 |
| 1276 | Ga0496122_0000032 | 3300048925 | Bacteria | 327099 |
| 1277 | Ga0496122_0000115 | 3300048925 | Bacteria | 183402 |
| 1278 | Ga0496122_0000449 | 3300048925 | Bacteria | 85961 |
| 1279 | Ga0496122_0000522 | 3300048925 | Bacteria | 79377 |
| 1280 | Ga0496122_0009163 | 3300048925 | Bacteria | 10481 |
| 1281 | Ga0496122_0032946 | 3300048925 | Bacteria | 4271 |
| 1282 | Ga0496122_0040836 | 3300048925 | Bacteria | 3680 |
| 1283 | Ga0496122_0049741 | 3300048925 | Bacteria | 3205 |
| 1284 | Ga0496122_0106083 | 3300048925 | Bacteria | 1861 |
| 1285 | Ga0496123_0000003 | 3300048926 | Bacteria | 866556 |
| 1286 | Ga0496123_0000093 | 3300048926 | Bacteria | 179205 |
| 1287 | Ga0496123_0000129 | 3300048926 | Bacteria | 153816 |
| 1288 | Ga0496123_0000251 | 3300048926 | Bacteria | 108664 |
| 1289 | Ga0496123_0000263 | 3300048926 | Bacteria | 105886 |
| 1290 | Ga0496123_0003958 | 3300048926 | Bacteria | 16050 |
| 1291 | Ga0496123_0013793 | 3300048926 | Bacteria | 6746 |
| 1292 | Ga0496123_0020352 | 3300048926 | Bacteria | 5193 |
| 1293 | Ga0496123_0021495 | 3300048926 | Bacteria | 5014 |
| 1294 | Ga0496123_0041591 | 3300048926 | Bacteria | 3183 |
| 1295 | Ga0496124_0000070 | 3300048927 | Bacteria | 220875 |
| 1296 | Ga0496124_0001325 | 3300048927 | Bacteria | 37278 |
| 1297 | Ga0496124_0001543 | 3300048927 | Bacteria | 33363 |
| 1298 | Ga0496124_0006912 | 3300048927 | Bacteria | 12195 |
| 1299 | Ga0496124_0009389 | 3300048927 | Bacteria | 10079 |
| 1300 | Ga0496124_0014874 | 3300048927 | Bacteria | 7496 |
| 1301 | Ga0496124_0023563 | 3300048927 | Bacteria | 5618 |
| 1302 | Ga0496124_0058064 | 3300048927 | Bacteria | 3256 |
| 1303 | Ga0496124_0097865 | 3300048927 | Bacteria | 2382 |
| 1304 | Ga0496124_0109359 | 3300048927 | Bacteria | 2228 |
| 1305 | Ga0496125_0000005 | 3300048928 | Bacteria | 827598 |
| 1306 | Ga0496125_0000041 | 3300048928 | Bacteria | 310158 |
| 1307 | Ga0496125_0001053 | 3300048928 | Bacteria | 42635 |
| 1308 | Ga0496125_0002973 | 3300048928 | Bacteria | 21314 |
| 1309 | Ga0496125_0004896 | 3300048928 | Bacteria | 15178 |
| 1310 | Ga0496125_0005318 | 3300048928 | Bacteria | 14393 |
| 1311 | Ga0496125_0006622 | 3300048928 | Bacteria | 12469 |
| 1312 | Ga0496125_0006849 | 3300048928 | Bacteria | 12218 |
| 1313 | Ga0496125_0008173 | 3300048928 | Bacteria | 11015 |
| 1314 | Ga0496125_0023700 | 3300048928 | Bacteria | 5659 |
| 1315 | Ga0496125_0025264 | 3300048928 | Bacteria | 5443 |
| 1316 | Ga0496125_0025735 | 3300048928 | Bacteria | 5382 |
| 1317 | Ga0496125_0035820 | 3300048928 | Bacteria | 4345 |
| 1318 | Ga0496125_0099525 | 3300048928 | Bacteria | 2147 |
| 1319 | Ga0496126_0000013 | 3300048929 | Bacteria | 690046 |
| 1320 | Ga0496126_0000246 | 3300048929 | Bacteria | 116854 |
| 1321 | Ga0496126_0000335 | 3300048929 | Bacteria | 99038 |
| 1322 | Ga0496126_0000565 | 3300048929 | Bacteria | 70942 |
| 1323 | Ga0496126_0000918 | 3300048929 | Bacteria | 50977 |
| 1324 | Ga0496126_0008904 | 3300048929 | Bacteria | 10747 |
| 1325 | Ga0496126_0012464 | 3300048929 | Bacteria | 8708 |
| 1326 | Ga0496126_0028309 | 3300048929 | Bacteria | 5342 |
| 1327 | Ga0496126_0030560 | 3300048929 | Bacteria | 5100 |
| 1328 | Ga0496126_0030579 | 3300048929 | Bacteria | 5098 |
| 1329 | Ga0501031_0001297 | 3300049568 | Bacteria | 15308 |
| 1330 | Ga0501031_0003815 | 3300049568 | Bacteria | 9696 |
| 1331 | Ga0501031_0006974 | 3300049568 | Bacteria | 7379 |
| 1332 | Ga0501031_0014136 | 3300049568 | Bacteria | 5194 |
| 1333 | Ga0501031_0015152 | 3300049568 | Bacteria | 5006 |
| 1334 | Ga0501031_0040295 | 3300049568 | Bacteria | 3050 |
| 1335 | Ga0501031_0040799 | 3300049568 | Bacteria | 3030 |
| 1336 | Ga0501032_0002102 | 3300049569 | Bacteria | 15707 |
| 1337 | Ga0501032_0008948 | 3300049569 | Bacteria | 7281 |
| 1338 | Ga0501032_0013720 | 3300049569 | Bacteria | 5752 |
| 1339 | Ga0501032_0014495 | 3300049569 | Bacteria | 5582 |
| 1340 | Ga0501032_0047639 | 3300049569 | Bacteria | 2894 |
| 1341 | Ga0501032_0049949 | 3300049569 | Bacteria | 2821 |
| 1342 | Ga0501033_0006828 | 3300049570 | Bacteria | 8908 |
| 1343 | Ga0501033_0007862 | 3300049570 | Bacteria | 8263 |
| 1344 | Ga0501033_0030583 | 3300049570 | Bacteria | 4045 |
| 1345 | Ga0501033_0034771 | 3300049570 | Bacteria | 3778 |
| 1346 | Ga0501033_0040535 | 3300049570 | Bacteria | 3476 |
| 1347 | Ga0501033_0080555 | 3300049570 | Bacteria | 2389 |
| 1348 | Ga0501034_0000015 | 3300049571 | Bacteria | 296163 |
| 1349 | Ga0501034_0000070 | 3300049571 | Bacteria | 180933 |
| 1350 | Ga0501034_0000163 | 3300049571 | Bacteria | 125417 |
| 1351 | Ga0501034_0001887 | 3300049571 | Bacteria | 26543 |
| 1352 | Ga0501034_0018363 | 3300049571 | Bacteria | 7171 |
| 1353 | Ga0501034_0027142 | 3300049571 | Bacteria | 5825 |
| 1354 | Ga0501034_0049750 | 3300049571 | Bacteria | 4229 |
| 1355 | Ga0501034_0127799 | 3300049571 | Bacteria | 2526 |
| 1356 | Ga0501036_0009116 | 3300049572 | Bacteria | 8161 |
| 1357 | Ga0501036_0019557 | 3300049572 | Bacteria | 5685 |
| 1358 | Ga0501036_0025584 | 3300049572 | Bacteria | 4980 |
| 1359 | Ga0501036_0064725 | 3300049572 | Bacteria | 3094 |
| 1360 | Ga0501037_0000625 | 3300049573 | Bacteria | 27416 |
| 1361 | Ga0501037_0000782 | 3300049573 | Bacteria | 23992 |
| 1362 | Ga0501037_0022974 | 3300049573 | Bacteria | 4612 |
| 1363 | Ga0501037_0023453 | 3300049573 | Bacteria | 4562 |
| 1364 | Ga0501037_0029094 | 3300049573 | Bacteria | 4081 |
| 1365 | Ga0501037_0030339 | 3300049573 | Bacteria | 3996 |
| 1366 | Ga0501037_0043544 | 3300049573 | Bacteria | 3298 |
| 1367 | Ga0501038_0001784 | 3300049574 | Bacteria | 19972 |
| 1368 | Ga0501038_0002773 | 3300049574 | Bacteria | 16300 |
| 1369 | Ga0501038_0002881 | 3300049574 | Bacteria | 16046 |
| 1370 | Ga0501038_0007061 | 3300049574 | Bacteria | 10369 |
| 1371 | Ga0501038_0022377 | 3300049574 | Bacteria | 5665 |
| 1372 | Ga0501038_0024154 | 3300049574 | Bacteria | 5425 |
| 1373 | Ga0501038_0028477 | 3300049574 | Bacteria | 4963 |
| 1374 | Ga0501038_0041101 | 3300049574 | Bacteria | 4033 |
| 1375 | Ga0501038_0073731 | 3300049574 | Bacteria | 2889 |
| 1376 | Ga0501038_0107063 | 3300049574 | Bacteria | 2319 |
| 1377 | Ga0501038_0119122 | 3300049574 | Bacteria | 2179 |
| 1378 | Ga0501038_0124322 | 3300049574 | Bacteria | 2124 |
| 1379 | Ga0501038_0128080 | 3300049574 | Bacteria | 2087 |
| 1380 | Ga0501039_0010500 | 3300049575 | Bacteria | 7057 |
| 1381 | Ga0501039_0016742 | 3300049575 | Bacteria | 5617 |
| 1382 | Ga0501039_0026880 | 3300049575 | Bacteria | 4424 |
| 1383 | Ga0501039_0037589 | 3300049575 | Bacteria | 3737 |
| 1384 | Ga0501039_0054778 | 3300049575 | Bacteria | 3087 |
| 1385 | Ga0501039_0096230 | 3300049575 | Bacteria | 2308 |
| 1386 | Ga0501040_0020484 | 3300049576 | Bacteria | 4407 |
| 1387 | Ga0501040_0034489 | 3300049576 | Bacteria | 3427 |
| 1388 | Ga0501040_0039799 | 3300049576 | Bacteria | 3198 |
| 1389 | Ga0501040_0047020 | 3300049576 | Bacteria | 2946 |
| 1390 | Ga0501041_0003618 | 3300049577 | Bacteria | 8885 |
| 1391 | Ga0501041_0023758 | 3300049577 | Bacteria | 3675 |
| 1392 | Ga0501041_0029039 | 3300049577 | Bacteria | 3336 |
| 1393 | Ga0501042_0022632 | 3300049578 | Bacteria | 4391 |
| 1394 | Ga0501042_0043864 | 3300049578 | Bacteria | 3185 |
| 1395 | Ga0501042_0063273 | 3300049578 | Bacteria | 2644 |
| 1396 | Ga0501042_0088366 | 3300049578 | Bacteria | 2223 |
| 1397 | Ga0501043_0005180 | 3300049579 | Bacteria | 10550 |
| 1398 | Ga0501043_0006914 | 3300049579 | Bacteria | 9050 |
| 1399 | Ga0501043_0008585 | 3300049579 | Bacteria | 8053 |
| 1400 | Ga0501043_0010923 | 3300049579 | Bacteria | 7112 |
| 1401 | Ga0501043_0020300 | 3300049579 | Bacteria | 5212 |
| 1402 | Ga0501043_0063922 | 3300049579 | Bacteria | 2890 |
| 1403 | Ga0501043_0131504 | 3300049579 | Bacteria | 1961 |
| 1404 | Ga0501043_0139824 | 3300049579 | Bacteria | 1896 |
| 1405 | Ga0501046_0000280 | 3300049580 | Bacteria | 51719 |
| 1406 | Ga0501046_0000883 | 3300049580 | Bacteria | 29184 |
| 1407 | Ga0501046_0001159 | 3300049580 | Bacteria | 25641 |
| 1408 | Ga0501046_0008738 | 3300049580 | Bacteria | 8798 |
| 1409 | Ga0501046_0055965 | 3300049580 | Bacteria | 3097 |
| 1410 | Ga0501046_0056144 | 3300049580 | Bacteria | 3092 |
| 1411 | Ga0501047_0000005 | 3300049581 | Bacteria | 456524 |
| 1412 | Ga0501047_0000141 | 3300049581 | Bacteria | 88104 |
| 1413 | Ga0501047_0000597 | 3300049581 | Bacteria | 38446 |
| 1414 | Ga0501047_0006639 | 3300049581 | Bacteria | 10878 |
| 1415 | Ga0501047_0007990 | 3300049581 | Bacteria | 9976 |
| 1416 | Ga0501047_0016530 | 3300049581 | Bacteria | 7043 |
| 1417 | Ga0501047_0019762 | 3300049581 | Bacteria | 6465 |
| 1418 | Ga0501047_0027903 | 3300049581 | Bacteria | 5440 |
| 1419 | Ga0501047_0038804 | 3300049581 | Bacteria | 4607 |
| 1420 | Ga0501047_0041053 | 3300049581 | Bacteria | 4471 |
| 1421 | Ga0501047_0055552 | 3300049581 | Bacteria | 3828 |
| 1422 | Ga0501048_0000423 | 3300049582 | Bacteria | 29706 |
| 1423 | Ga0501048_0006060 | 3300049582 | Bacteria | 9206 |
| 1424 | Ga0501048_0008037 | 3300049582 | Bacteria | 7990 |
| 1425 | Ga0501048_0024811 | 3300049582 | Bacteria | 4372 |
| 1426 | Ga0501067_0000245 | 3300049583 | Bacteria | 29979 |
| 1427 | Ga0501067_0002205 | 3300049583 | Bacteria | 10764 |
| 1428 | Ga0501067_0004752 | 3300049583 | Bacteria | 7520 |
| 1429 | Ga0501067_0006662 | 3300049583 | Bacteria | 6409 |
| 1430 | Ga0501067_0023000 | 3300049583 | Bacteria | 3452 |
| 1431 | Ga0501068_0001758 | 3300049584 | Bacteria | 11520 |
| 1432 | Ga0501069_0014852 | 3300049585 | Bacteria | 4170 |
| 1433 | Ga0501069_0016615 | 3300049585 | Bacteria | 3954 |
| 1434 | Ga0501069_0024738 | 3300049585 | Bacteria | 3277 |
| 1435 | Ga0501069_0064902 | 3300049585 | Bacteria | 2041 |
| 1436 | Ga0501070_0000050 | 3300049586 | Bacteria | 103310 |
| 1437 | Ga0501070_0000701 | 3300049586 | Bacteria | 30784 |
| 1438 | Ga0501070_0001113 | 3300049586 | Bacteria | 24139 |
| 1439 | Ga0501070_0002662 | 3300049586 | Bacteria | 15585 |
| 1440 | Ga0501070_0014476 | 3300049586 | Bacteria | 6639 |
| 1441 | Ga0501070_0016434 | 3300049586 | Bacteria | 6218 |
| 1442 | Ga0501070_0024551 | 3300049586 | Bacteria | 5055 |
| 1443 | Ga0501070_0040363 | 3300049586 | Bacteria | 3891 |
| 1444 | Ga0501070_0074806 | 3300049586 | Bacteria | 2804 |
| 1445 | Ga0501070_0079189 | 3300049586 | Bacteria | 2719 |
| 1446 | Ga0501071_0002468 | 3300049587 | Bacteria | 11234 |
| 1447 | Ga0501071_0002715 | 3300049587 | Bacteria | 10846 |
| 1448 | Ga0501071_0011608 | 3300049587 | Bacteria | 5947 |
| 1449 | Ga0501071_0060812 | 3300049587 | Bacteria | 2735 |
| 1450 | Ga0501072_0011940 | 3300049588 | Bacteria | 6633 |
| 1451 | Ga0501072_0020326 | 3300049588 | Bacteria | 5143 |
| 1452 | Ga0501072_0040307 | 3300049588 | Bacteria | 3667 |
| 1453 | Ga0501073_0011920 | 3300049589 | Bacteria | 6347 |
| 1454 | Ga0501073_0014852 | 3300049589 | Bacteria | 5651 |
| 1455 | Ga0501073_0026706 | 3300049589 | Bacteria | 4134 |
| 1456 | Ga0501073_0118326 | 3300049589 | Bacteria | 1836 |
| 1457 | Ga0501074_0002415 | 3300049590 | Bacteria | 13018 |
| 1458 | Ga0501074_0006017 | 3300049590 | Bacteria | 8756 |
| 1459 | Ga0501074_0020563 | 3300049590 | Bacteria | 4797 |
| 1460 | Ga0501074_0050534 | 3300049590 | Bacteria | 3001 |
| 1461 | Ga0501075_0046828 | 3300049591 | Bacteria | 3249 |
| 1462 | Ga0501076_0011709 | 3300049592 | Bacteria | 6547 |
| 1463 | Ga0501076_0029686 | 3300049592 | Bacteria | 4254 |
| 1464 | Ga0501076_0038560 | 3300049592 | Bacteria | 3751 |
| 1465 | Ga0501077_0008581 | 3300049593 | Bacteria | 6335 |
| 1466 | Ga0501077_0071265 | 3300049593 | Bacteria | 2203 |
| 1467 | Ga0501079_0020468 | 3300049741 | Bacteria | 5058 |
| 1468 | Ga0501079_0035356 | 3300049741 | Bacteria | 3845 |
| 1469 | Ga0501079_0037016 | 3300049741 | Bacteria | 3759 |
| 1470 | Ga0501079_0038310 | 3300049741 | Bacteria | 3697 |
| 1471 | Ga0501079_0100595 | 3300049741 | Bacteria | 2241 |
| 1472 | Ga0501080_0000318 | 3300049742 | Bacteria | 36727 |
| 1473 | Ga0501080_0000592 | 3300049742 | Bacteria | 28648 |
| 1474 | Ga0501080_0002592 | 3300049742 | Bacteria | 15826 |
| 1475 | Ga0501080_0014782 | 3300049742 | Bacteria | 7189 |
| 1476 | Ga0501080_0046767 | 3300049742 | Bacteria | 4028 |
| 1477 | Ga0501080_0091581 | 3300049742 | Bacteria | 2824 |
| 1478 | Ga0501080_0133129 | 3300049742 | Bacteria | 2301 |
| 1479 | Ga0501083_0002947 | 3300049744 | Bacteria | 11790 |
| 1480 | Ga0501083_0008405 | 3300049744 | Bacteria | 7298 |
| 1481 | Ga0501083_0026752 | 3300049744 | Bacteria | 3985 |
| 1482 | Ga0501035_0004251 | 3300049822 | Bacteria | 13595 |
| 1483 | Ga0501035_0006710 | 3300049822 | Bacteria | 10757 |
| 1484 | Ga0501035_0008273 | 3300049822 | Bacteria | 9694 |
| 1485 | Ga0501035_0012536 | 3300049822 | Bacteria | 7831 |
| 1486 | Ga0501035_0015452 | 3300049822 | Bacteria | 7041 |
| 1487 | Ga0501035_0023796 | 3300049822 | Bacteria | 5619 |
| 1488 | Ga0501035_0033775 | 3300049822 | Bacteria | 4650 |
| 1489 | Ga0501035_0085250 | 3300049822 | Bacteria | 2785 |
| 1490 | Ga0501044_0003079 | 3300049823 | Bacteria | 18880 |
| 1491 | Ga0501044_0004786 | 3300049823 | Bacteria | 15144 |
| 1492 | Ga0501044_0008754 | 3300049823 | Bacteria | 11072 |
| 1493 | Ga0501044_0009760 | 3300049823 | Bacteria | 10441 |
| 1494 | Ga0501044_0054689 | 3300049823 | Bacteria | 4102 |
| 1495 | Ga0501044_0056557 | 3300049823 | Bacteria | 4028 |
| 1496 | Ga0501044_0108832 | 3300049823 | Bacteria | 2781 |
| 1497 | Ga0501044_0166508 | 3300049823 | Bacteria | 2178 |
| 1498 | nmdc:mga03n38_14040_c1 | 3300050490 | Bacteria | 3061 |
| 1499 | nmdc:mga03n38_2040_c1 | 3300050490 | Bacteria | 6089 |
| 1500 | nmdc:mga00v17_11769_c1 | 3300050491 | Bacteria | 4812 |
| 1501 | nmdc:mga00v17_19006_c1 | 3300050491 | Bacteria | 3915 |
| 1502 | nmdc:mga00v17_4667_c1 | 3300050491 | Bacteria | 7155 |
| 1503 | nmdc:mga0yw44_11425_c1 | 3300050492 | Bacteria | 4584 |
| 1504 | nmdc:mga0yw44_26353_c1 | 3300050492 | Bacteria | 3320 |
| 1505 | nmdc:mga0yw44_29266_c1 | 3300050492 | Bacteria | 3178 |
| 1506 | nmdc:mga0yw44_34279_c1 | 3300050492 | Bacteria | 2973 |
| 1507 | nmdc:mga0yw44_50487_c1 | 3300050492 | Bacteria | 2515 |
| 1508 | nmdc:mga0yw44_9237_c1 | 3300050492 | Bacteria | 4967 |
| 1509 | nmdc:mga06z11_1166_c1 | 3300050494 | Bacteria | 9629 |
| 1510 | nmdc:mga06z11_34918_c1 | 3300050494 | Bacteria | 2471 |
| 1511 | nmdc:mga06z11_4395_c1 | 3300050494 | Bacteria | 5548 |
| 1512 | nmdc:mga04h51_3426_c1 | 3300050495 | Bacteria | 3857 |
| 1513 | nmdc:mga04h51_530_c1 | 3300050495 | Bacteria | 9048 |
| 1514 | nmdc:mga07m45_1731_c1 | 3300050496 | Bacteria | 10054 |
| 1515 | nmdc:mga07m45_28936_c1 | 3300050496 | Bacteria | 3060 |
| 1516 | nmdc:mga05p37_14800_c1 | 3300050507 | Bacteria | 9368 |
| 1517 | nmdc:mga05p37_2661_c1 | 3300050507 | Bacteria | 20811 |
| 1518 | nmdc:mga0qj67_12131_c1 | 3300050509 | Bacteria | 6481 |
| 1519 | nmdc:mga06r32_11849_c1 | 3300050510 | Bacteria | 7853 |
| 1520 | nmdc:mga06r32_1669_c3 | 3300050510 | Bacteria | 9384 |
| 1521 | nmdc:mga06r32_288_c1 | 3300050510 | Bacteria | 41844 |
| 1522 | nmdc:mga08y16_2042_c1 | 3300050511 | Bacteria | 20694 |
| 1523 | nmdc:mga08y16_54408_c1 | 3300050511 | Bacteria | 4182 |
| 1524 | nmdc:mga08y16_83547_c1 | 3300050511 | Bacteria | 3328 |
| 1525 | nmdc:mga0n895_24107_c1 | 3300050512 | Bacteria | 5730 |
| 1526 | nmdc:mga0n895_3611_c1 | 3300050512 | Bacteria | 12507 |
| 1527 | nmdc:mga0rr50_2329_c1 | 3300050513 | Bacteria | 10669 |
| 1528 | nmdc:mga0rr50_9742_c1 | 3300050513 | Bacteria | 6062 |
| 1529 | nmdc:mga08x19_26384_c1 | 3300050514 | Bacteria | 3625 |
| 1530 | nmdc:mga08x19_600_c1 | 3300050514 | Bacteria | 23378 |
| 1531 | nmdc:mga0a205_128026_c1 | 3300050515 | Bacteria | 2439 |
| 1532 | nmdc:mga0a205_228_c1 | 3300050515 | Bacteria | 39737 |
| 1533 | nmdc:mga0sz30_2197_c2 | 3300050516 | Bacteria | 4855 |
| 1534 | Ga0495601_0009778 | 3300053077 | Bacteria | 5672 |
| 1535 | Ga0495601_0015455 | 3300053077 | Bacteria | 4613 |
| 1536 | Ga0495601_0018005 | 3300053077 | Bacteria | 4294 |
| 1537 | Ga0495601_0029992 | 3300053077 | Bacteria | 3376 |
| 1538 | Ga0495601_0040946 | 3300053077 | Bacteria | 2903 |
| 1539 | Ga0495612_0008717 | 3300053078 | Bacteria | 4113 |
| 1540 | Ga0495612_0024377 | 3300053078 | Bacteria | 2428 |
| 1541 | Ga0500635_0000004 | 3300053080 | Bacteria | 210675 |
| 1542 | Ga0500635_0002469 | 3300053080 | Bacteria | 4588 |
| 1543 | Ga0495595_0000246 | 3300053084 | Bacteria | 21386 |
| 1544 | Ga0495595_0032678 | 3300053084 | Bacteria | 2344 |
| 1545 | Ga0495619_0001561 | 3300053085 | Bacteria | 15068 |
| 1546 | Ga0495619_0010924 | 3300053085 | Bacteria | 5715 |
| 1547 | Ga0495619_0019382 | 3300053085 | Bacteria | 4323 |
| 1548 | Ga0495619_0021621 | 3300053085 | Bacteria | 4109 |
| 1549 | Ga0495619_0047803 | 3300053085 | Bacteria | 2818 |
| 1550 | Ga0495619_0055024 | 3300053085 | Bacteria | 2635 |
| 1551 | Ga0500643_000575 | 3300053087 | Bacteria | 25486 |
| 1552 | Ga0500643_009893 | 3300053087 | Bacteria | 3600 |
| 1553 | Ga0500644_0002035 | 3300053088 | Bacteria | 5132 |
| 1554 | Ga0500644_0005730 | 3300053088 | Bacteria | 3146 |
| 1555 | Ga0500651_0000093 | 3300053093 | Bacteria | 55843 |
| 1556 | Ga0500641_0002075 | 3300053096 | Bacteria | 7106 |
| 1557 | Ga0500650_0004010 | 3300053098 | Bacteria | 5239 |
| 1558 | Ga0500556_0000026 | 3300053104 | Bacteria | 166874 |
| 1559 | Ga0500556_0000560 | 3300053104 | Bacteria | 24819 |
| 1560 | Ga0500560_006351 | 3300053107 | Bacteria | 2698 |
| 1561 | Ga0500571_000456 | 3300053110 | Bacteria | 16458 |
| 1562 | Ga0500655_000269 | 3300053133 | Bacteria | 12114 |
| 1563 | Ga0500658_0000312 | 3300053134 | Bacteria | 21747 |
| 1564 | Ga0500658_0000700 | 3300053134 | Bacteria | 13860 |
| 1565 | Ga0500559_0000210 | 3300053136 | Bacteria | 46871 |
| 1566 | Ga0500559_0002339 | 3300053136 | Bacteria | 9915 |
| 1567 | Ga0500559_0003977 | 3300053136 | Bacteria | 7117 |
| 1568 | Ga0500573_0000001 | 3300053140 | Bacteria | 436394 |
| 1569 | Ga0500573_0007564 | 3300053140 | Bacteria | 5933 |
| 1570 | Ga0500573_0008128 | 3300053140 | Bacteria | 5769 |
| 1571 | Ga0500573_0011354 | 3300053140 | Bacteria | 4984 |
| 1572 | Ga0500573_0023039 | 3300053140 | Bacteria | 3575 |
| 1573 | Ga0500573_0064686 | 3300053140 | Bacteria | 2091 |
| 1574 | Ga0500573_0082392 | 3300053140 | Bacteria | 1827 |
| 1575 | Ga0500579_081146 | 3300053143 | Bacteria | 1812 |
| 1576 | Ga0500616_0009763 | 3300053153 | Bacteria | 5795 |
| 1577 | Ga0500620_000151 | 3300053155 | Bacteria | 13944 |
| 1578 | Ga0500634_0061814 | 3300053161 | Bacteria | 1985 |
| 1579 | Ga0501084_0002835 | 3300054114 | Bacteria | 13994 |
| 1580 | Ga0501084_0028165 | 3300054114 | Bacteria | 4694 |
| 1581 | Ga0501084_0135333 | 3300054114 | Bacteria | 2075 |
| 1582 | Ga0501084_0187183 | 3300054114 | Bacteria | 1747 |
| 1583 | Ga0501082_0007249 | 3300060353 | Bacteria | 9565 |
| 1584 | Ga0501082_0016270 | 3300060353 | Bacteria | 6403 |
| 1585 | Ga0501082_0019185 | 3300060353 | Bacteria | 5892 |
| 1586 | Ga0501082_0033651 | 3300060353 | Bacteria | 4421 |
| 1587 | Ga0501082_0045533 | 3300060353 | Bacteria | 3783 |
| 1588 | Ga0466962_0000273 | 3300061719 | Bacteria | 21782 |
| 1589 | Ga0466962_0000868 | 3300061719 | Bacteria | 13694 |
| 1590 | Ga0466962_0003062 | 3300061719 | Bacteria | 7967 |
| 1591 | Ga0466962_0008985 | 3300061719 | Bacteria | 4788 |
| 1592 | Ga0466962_0028361 | 3300061719 | Bacteria | 2682 |
| 1593 | Ga0530510_0017884 | 3300061734 | Bacteria | 5026 |
| 1594 | Ga0530510_0082724 | 3300061734 | Bacteria | 2337 |
| 1595 | Ga0530510_0096693 | 3300061734 | Bacteria | 2158 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0232033 | Ga0466967_0232033_47_1675 | 472 |
| 2 | iso_pu_bacteria | 2901300506 | 2901304104 | 482 |
| 3 | 3300044656 | Ga0466969_0021423 | Ga0466969_0021423_1681_3309 | 491 |
| 4 | 3300044694 | Ga0466963_0035088 | Ga0466963_0035088_137_1909 | 491 |
| 5 | 3300044901 | Ga0466960_0024582 | Ga0466960_0024582_683_2443 | 494 |
| 6 | 3300031731 | Ga0307405_10018242 | Ga0307405_100182423 | 500 |
| 7 | 3300031911 | Ga0307412_10114192 | Ga0307412_101141921 | 501 |
| 8 | 3300037418 | Ga0395900_0005784 | Ga0395900_0005784_8071_9831 | 501 |
| 9 | 3300037466 | Ga0395898_0057804 | Ga0395898_0057804_321_2081 | 501 |
| 10 | 3300048905 | Ga0496102_0054849 | Ga0496102_0054849_949_2718 | 503 |
| 11 | 3300048910 | Ga0496107_0068220 | Ga0496107_0068220_286_2064 | 503 |
| 12 | 3300049585 | Ga0501069_0064902 | Ga0501069_0064902_254_1936 | 503 |
| 13 | 3300045049 | Ga0466959_0021315 | Ga0466959_0021315_1268_3046 | 504 |
| 14 | 3300048903 | Ga0496100_0053971 | Ga0496100_0053971_610_2379 | 504 |
| 15 | 3300048909 | Ga0496106_0046042 | Ga0496106_0046042_1280_3049 | 504 |
| 16 | 3300005981 | Ga0081538_10003762 | Ga0081538_100037625 | 506 |
| 17 | 3300005981 | Ga0081538_10034927 | Ga0081538_100349272 | 510 |
| 18 | 3300046455 | Ga0495603_0078736 | Ga0495603_0078736_12_1619 | 510 |
| 19 | 3300005445 | Ga0070708_100006414 | Ga0070708_1000064143 | 511 |
| 20 | 3300005467 | Ga0070706_100022289 | Ga0070706_1000222896 | 511 |
| 21 | 3300005468 | Ga0070707_100014576 | Ga0070707_1000145766 | 511 |
| 22 | 3300005471 | Ga0070698_100032360 | Ga0070698_1000323604 | 511 |
| 23 | 3300025910 | Ga0207684_10017354 | Ga0207684_100173546 | 511 |
| 24 | 3300025922 | Ga0207646_10009064 | Ga0207646_100090646 | 511 |
| 25 | 3300025922 | Ga0207646_10094101 | Ga0207646_100941011 | 511 |
| 26 | 3300050512 | nmdc:mga0n895_24107_c1 | nmdc:mga0n895_24107_c1_2783_4573 | 511 |
| 27 | 3300050513 | nmdc:mga0rr50_9742_c1 | nmdc:mga0rr50_9742_c1_1452_3242 | 511 |
| 28 | 3300050514 | nmdc:mga08x19_26384_c1 | nmdc:mga08x19_26384_c1_1154_2944 | 511 |
| 29 | 3300050515 | nmdc:mga0a205_128026_c1 | nmdc:mga0a205_128026_c1_57_1847 | 511 |
| 30 | iso_pu_bacteria | 2643221548 | 2643763611 | 511 |
| 31 | 3300021388 | Ga0213875_10000250 | Ga0213875_1000025025 | 512 |
| 32 | 3300037853 | Ga0436364_0287407 | Ga0436364_0287407_79532_81289 | 512 |
| 33 | 3300053077 | Ga0495601_0029992 | Ga0495601_0029992_1148_2935 | 512 |
| 34 | 3300046558 | Ga0495633_0063266 | Ga0495633_0063266_56_1684 | 513 |
| 35 | 3300047445 | Ga0495677_0026424 | Ga0495677_0026424_432_2060 | 513 |
| 36 | 3300025906 | Ga0207699_10017708 | Ga0207699_100177083 | 514 |
| 37 | 3300032002 | Ga0307416_100039439 | Ga0307416_1000394391 | 515 |
| 38 | 3300046809 | Ga0495600_0082472 | Ga0495600_0082472_42_1805 | 515 |
| 39 | 3300031548 | Ga0307408_100016251 | Ga0307408_1000162513 | 516 |
| 40 | 3300031824 | Ga0307413_10014644 | Ga0307413_100146442 | 516 |
| 41 | 3300031852 | Ga0307410_10014413 | Ga0307410_100144132 | 516 |
| 42 | 3300031903 | Ga0307407_10023760 | Ga0307407_100237602 | 516 |
| 43 | 3300031911 | Ga0307412_10016091 | Ga0307412_100160913 | 516 |
| 44 | 3300031995 | Ga0307409_100006212 | Ga0307409_1000062124 | 516 |
| 45 | 3300032002 | Ga0307416_100015457 | Ga0307416_1000154573 | 516 |
| 46 | 3300005435 | Ga0070714_100012884 | Ga0070714_1000128846 | 517 |
| 47 | 3300005981 | Ga0081538_10026557 | Ga0081538_100265573 | 517 |
| 48 | 3300025906 | Ga0207699_10061634 | Ga0207699_100616342 | 517 |
| 49 | 3300025929 | Ga0207664_10042322 | Ga0207664_100423223 | 517 |
| 50 | 3300031548 | Ga0307408_100017107 | Ga0307408_1000171073 | 517 |
| 51 | 3300032126 | Ga0307415_100030264 | Ga0307415_1000302643 | 517 |
| 52 | 3300046642 | Ga0495634_0026200 | Ga0495634_0026200_207_1985 | 517 |
| 53 | 3300049569 | Ga0501032_0002102 | Ga0501032_0002102_7244_9013 | 517 |
| 54 | 3300049571 | Ga0501034_0000015 | Ga0501034_0000015_242002_243771 | 517 |
| 55 | 3300049579 | Ga0501043_0005180 | Ga0501043_0005180_2358_4127 | 517 |
| 56 | 3300053077 | Ga0495601_0040946 | Ga0495601_0040946_23_1783 | 517 |
| 57 | 3300053087 | Ga0500643_009893 | Ga0500643_009893_1218_2948 | 517 |
| 58 | 3300005367 | Ga0070667_100023307 | Ga0070667_1000233075 | 518 |
| 59 | 3300037853 | Ga0436364_0132601 | Ga0436364_0132601_5686_7434 | 518 |
| 60 | 3300039437 | Ga0436365_1506144 | Ga0436365_1506144_239_1987 | 518 |
| 61 | 3300047319 | Ga0495674_0026893 | Ga0495674_0026893_446_2227 | 518 |
| 62 | 3300049586 | Ga0501070_0079189 | Ga0501070_0079189_927_2693 | 518 |
| 63 | 3300005339 | Ga0070660_100005500 | Ga0070660_1000055007 | 519 |
| 64 | 3300005366 | Ga0070659_100018431 | Ga0070659_1000184314 | 519 |
| 65 | 3300005563 | Ga0068855_100130463 | Ga0068855_1001304633 | 519 |
| 66 | 3300025904 | Ga0207647_10012451 | Ga0207647_100124515 | 519 |
| 67 | 3300025919 | Ga0207657_10006095 | Ga0207657_1000609511 | 519 |
| 68 | 3300025928 | Ga0207700_10033204 | Ga0207700_100332041 | 519 |
| 69 | 3300025929 | Ga0207664_10019890 | Ga0207664_100198903 | 519 |
| 70 | 3300046511 | Ga0495608_0019838 | Ga0495608_0019838_111_1889 | 519 |
| 71 | 3300049573 | Ga0501037_0023453 | Ga0501037_0023453_2726_4501 | 519 |
| 72 | 3300053140 | Ga0500573_0082392 | Ga0500573_0082392_172_1794 | 519 |
| 73 | 3300006028 | Ga0070717_10082444 | Ga0070717_100824442 | 520 |
| 74 | 3300006847 | Ga0075431_100062498 | Ga0075431_1000624983 | 520 |
| 75 | 3300011119 | Ga0105246_10000370 | Ga0105246_1000037016 | 520 |
| 76 | 3300025915 | Ga0207693_10014760 | Ga0207693_100147602 | 520 |
| 77 | 3300047315 | Ga0495581_0015229 | Ga0495581_0015229_740_2518 | 520 |
| 78 | 3300050510 | nmdc:mga06r32_1669_c3 | nmdc:mga06r32_1669_c3_7333_9099 | 520 |
| 79 | 3300054114 | Ga0501084_0187183 | Ga0501084_0187183_55_1737 | 520 |
| 80 | 3300005367 | Ga0070667_100095660 | Ga0070667_1000956601 | 521 |
| 81 | 3300005577 | Ga0068857_100008845 | Ga0068857_1000088452 | 521 |
| 82 | 3300009036 | Ga0105244_10011954 | Ga0105244_100119543 | 521 |
| 83 | 3300025303 | Ga0209051_1001619 | Ga0209051_10016192 | 521 |
| 84 | 3300035111 | Ga0373923_0027195 | Ga0373923_0027195_229_2007 | 521 |
| 85 | 3300036401 | Ga0373937_0058487 | Ga0373937_0058487_1476_3254 | 521 |
| 86 | 3300046454 | Ga0495592_0023690 | Ga0495592_0023690_1114_2892 | 521 |
| 87 | 3300046459 | Ga0495629_0029618 | Ga0495629_0029618_1961_3739 | 521 |
| 88 | 3300046476 | Ga0495662_0016589 | Ga0495662_0016589_306_2084 | 521 |
| 89 | 3300046535 | Ga0495586_0015352 | Ga0495586_0015352_187_1965 | 521 |
| 90 | 3300046679 | Ga0495623_0034878 | Ga0495623_0034878_1133_2911 | 521 |
| 91 | 3300046809 | Ga0495600_0047245 | Ga0495600_0047245_315_2093 | 521 |
| 92 | 3300047444 | Ga0495675_0016513 | Ga0495675_0016513_1949_3727 | 521 |
| 93 | 3300047673 | Ga0495593_0009194 | Ga0495593_0009194_1826_3604 | 521 |
| 94 | 3300048089 | Ga0495614_0039984 | Ga0495614_0039984_161_1939 | 521 |
| 95 | 3300049581 | Ga0501047_0000141 | Ga0501047_0000141_59578_61335 | 521 |
| 96 | 3300053078 | Ga0495612_0024377 | Ga0495612_0024377_176_1954 | 521 |
| 97 | 3300053085 | Ga0495619_0047803 | Ga0495619_0047803_376_2160 | 521 |
| 98 | 3300003203 | JGI25406J46586_10008172 | JGI25406J46586_100081723 | 522 |
| 99 | 3300005471 | Ga0070698_100040406 | Ga0070698_1000404065 | 522 |
| 100 | 3300005530 | Ga0070679_100101454 | Ga0070679_1001014544 | 522 |
| 101 | 3300005985 | Ga0081539_10000356 | Ga0081539_1000035666 | 522 |
| 102 | 3300021388 | Ga0213875_10000488 | Ga0213875_1000048816 | 522 |
| 103 | 3300025898 | Ga0207692_10033752 | Ga0207692_100337521 | 522 |
| 104 | 3300026116 | Ga0207674_10002289 | Ga0207674_1000228921 | 522 |
| 105 | 3300026118 | Ga0207675_100037656 | Ga0207675_1000376561 | 522 |
| 106 | 3300037853 | Ga0436364_0370872 | Ga0436364_0370872_325_2091 | 522 |
| 107 | 3300044694 | Ga0466963_0023435 | Ga0466963_0023435_1927_3681 | 522 |
| 108 | 3300045049 | Ga0466959_0027764 | Ga0466959_0027764_79_1845 | 522 |
| 109 | 3300045976 | Ga0466967_0098880 | Ga0466967_0098880_866_2632 | 522 |
| 110 | 3300046473 | Ga0495582_0020589 | Ga0495582_0020589_164_1942 | 522 |
| 111 | 3300046475 | Ga0495639_0015370 | Ga0495639_0015370_1492_3258 | 522 |
| 112 | 3300046513 | Ga0495616_0001315 | Ga0495616_0001315_12268_13998 | 522 |
| 113 | 3300046518 | Ga0495631_0000382 | Ga0495631_0000382_18414_20144 | 522 |
| 114 | 3300046520 | Ga0495637_0011661 | Ga0495637_0011661_1300_3030 | 522 |
| 115 | 3300046674 | Ga0495588_0011567 | Ga0495588_0011567_2384_4069 | 522 |
| 116 | 3300048903 | Ga0496100_0021797 | Ga0496100_0021797_1690_3543 | 522 |
| 117 | 3300048914 | Ga0496111_0017455 | Ga0496111_0017455_56_1831 | 522 |
| 118 | 3300048917 | Ga0496114_0140665 | Ga0496114_0140665_230_2050 | 522 |
| 119 | 3300005468 | Ga0070707_100015820 | Ga0070707_1000158202 | 523 |
| 120 | 3300005471 | Ga0070698_100013176 | Ga0070698_1000131763 | 523 |
| 121 | 3300009148 | Ga0105243_10001051 | Ga0105243_100010515 | 523 |
| 122 | 3300025922 | Ga0207646_10000434 | Ga0207646_1000043456 | 523 |
| 123 | 3300025935 | Ga0207709_10003225 | Ga0207709_100032257 | 523 |
| 124 | 3300031548 | Ga0307408_100006285 | Ga0307408_1000062856 | 523 |
| 125 | 3300031731 | Ga0307405_10052973 | Ga0307405_100529732 | 523 |
| 126 | 3300035086 | Ga0373934_0006884 | Ga0373934_0006884_2253_3998 | 523 |
| 127 | 3300035111 | Ga0373923_0003076 | Ga0373923_0003076_1266_3011 | 523 |
| 128 | 3300035113 | Ga0373936_0008511 | Ga0373936_0008511_955_2700 | 523 |
| 129 | 3300035118 | Ga0373954_0005660 | Ga0373954_0005660_1345_3090 | 523 |
| 130 | 3300035170 | Ga0373943_0000977 | Ga0373943_0000977_7317_9062 | 523 |
| 131 | 3300038443 | Ga0395901_0029932 | Ga0395901_0029932_1701_3515 | 523 |
| 132 | 3300044901 | Ga0466960_0037581 | Ga0466960_0037581_473_2236 | 523 |
| 133 | 3300046459 | Ga0495629_0002738 | Ga0495629_0002738_7278_9023 | 523 |
| 134 | 3300046473 | Ga0495582_0040292 | Ga0495582_0040292_337_2082 | 523 |
| 135 | 3300046475 | Ga0495639_0005355 | Ga0495639_0005355_2825_4570 | 523 |
| 136 | 3300046476 | Ga0495662_0000490 | Ga0495662_0000490_2691_4436 | 523 |
| 137 | 3300046511 | Ga0495608_0053335 | Ga0495608_0053335_465_2210 | 523 |
| 138 | 3300046514 | Ga0495618_0005659 | Ga0495618_0005659_1626_3371 | 523 |
| 139 | 3300046517 | Ga0495630_0019859 | Ga0495630_0019859_1754_3499 | 523 |
| 140 | 3300046522 | Ga0495643_0028846 | Ga0495643_0028846_394_2247 | 523 |
| 141 | 3300046526 | Ga0495666_0022852 | Ga0495666_0022852_267_2012 | 523 |
| 142 | 3300046531 | Ga0495665_0007087 | Ga0495665_0007087_2809_4554 | 523 |
| 143 | 3300046533 | Ga0495640_0045965 | Ga0495640_0045965_117_1862 | 523 |
| 144 | 3300046663 | Ga0495635_0054674 | Ga0495635_0054674_50_1795 | 523 |
| 145 | 3300046674 | Ga0495588_0014089 | Ga0495588_0014089_2154_3812 | 523 |
| 146 | 3300046675 | Ga0495657_0047372 | Ga0495657_0047372_124_1869 | 523 |
| 147 | 3300046678 | Ga0495599_0030269 | Ga0495599_0030269_1314_3059 | 523 |
| 148 | 3300046680 | Ga0495646_0014856 | Ga0495646_0014856_1447_3192 | 523 |
| 149 | 3300046681 | Ga0495647_0000976 | Ga0495647_0000976_5567_7312 | 523 |
| 150 | 3300046690 | Ga0495624_0007537 | Ga0495624_0007537_2957_4702 | 523 |
| 151 | 3300047315 | Ga0495581_0001126 | Ga0495581_0001126_4490_6235 | 523 |
| 152 | 3300047317 | Ga0495604_0025409 | Ga0495604_0025409_174_1919 | 523 |
| 153 | 3300047322 | Ga0495680_0086540 | Ga0495680_0086540_148_1893 | 523 |
| 154 | 3300047471 | Ga0495684_0026486 | Ga0495684_0026486_2135_3880 | 523 |
| 155 | 3300047673 | Ga0495593_0003998 | Ga0495593_0003998_6714_8459 | 523 |
| 156 | 3300053077 | Ga0495601_0009778 | Ga0495601_0009778_1951_3696 | 523 |
| 157 | 3300053078 | Ga0495612_0008717 | Ga0495612_0008717_517_2262 | 523 |
| 158 | 3300053085 | Ga0495619_0001561 | Ga0495619_0001561_4487_6232 | 523 |
| 159 | 3300005539 | Ga0068853_100057556 | Ga0068853_1000575563 | 524 |
| 160 | 3300005548 | Ga0070665_100012763 | Ga0070665_1000127636 | 524 |
| 161 | 3300005563 | Ga0068855_100006136 | Ga0068855_10000613613 | 524 |
| 162 | 3300005563 | Ga0068855_100009451 | Ga0068855_1000094515 | 524 |
| 163 | 3300009093 | Ga0105240_10034274 | Ga0105240_100342743 | 524 |
| 164 | 3300009174 | Ga0105241_10014845 | Ga0105241_100148453 | 524 |
| 165 | 3300009545 | Ga0105237_10014162 | Ga0105237_100141625 | 524 |
| 166 | 3300025254 | Ga0209148_1003188 | Ga0209148_10031883 | 524 |
| 167 | 3300025904 | Ga0207647_10003148 | Ga0207647_100031483 | 524 |
| 168 | 3300025913 | Ga0207695_10001199 | Ga0207695_1000119931 | 524 |
| 169 | 3300025914 | Ga0207671_10000371 | Ga0207671_1000037133 | 524 |
| 170 | 3300025924 | Ga0207694_10006984 | Ga0207694_100069844 | 524 |
| 171 | 3300025949 | Ga0207667_10021635 | Ga0207667_100216353 | 524 |
| 172 | 3300025949 | Ga0207667_10024976 | Ga0207667_100249763 | 524 |
| 173 | 3300026116 | Ga0207674_10112573 | Ga0207674_101125732 | 524 |
| 174 | 3300031616 | Ga0307508_10004145 | Ga0307508_100041455 | 524 |
| 175 | 3300031665 | Ga0316575_10001941 | Ga0316575_100019416 | 524 |
| 176 | 3300031691 | Ga0316579_10013154 | Ga0316579_100131541 | 524 |
| 177 | 3300031728 | Ga0316578_10000364 | Ga0316578_100003643 | 524 |
| 178 | 3300031728 | Ga0316578_10025309 | Ga0316578_100253093 | 524 |
| 179 | 3300032137 | Ga0316585_10012240 | Ga0316585_100122401 | 524 |
| 180 | 3300032137 | Ga0316585_10013757 | Ga0316585_100137571 | 524 |
| 181 | 3300033179 | Ga0307507_10119239 | Ga0307507_101192391 | 524 |
| 182 | 3300035398 | Ga0316574_0000620 | Ga0316574_0000620_12095_13876 | 524 |
| 183 | 3300035398 | Ga0316574_0099693 | Ga0316574_0099693_47_1828 | 524 |
| 184 | 3300036647 | Ga0316582_0005540 | Ga0316582_0005540_1291_3075 | 524 |
| 185 | 3300038443 | Ga0395901_0024722 | Ga0395901_0024722_309_2096 | 524 |
| 186 | 3300041404 | Ga0439436_0007310 | Ga0439436_0007310_231_2084 | 524 |
| 187 | 3300041411 | Ga0439466_0009365 | Ga0439466_0009365_422_2275 | 524 |
| 188 | 3300041413 | Ga0439465_0008468 | Ga0439465_0008468_980_2833 | 524 |
| 189 | 3300042007 | Ga0439449_0004606 | Ga0439449_0004606_2027_3880 | 524 |
| 190 | 3300042014 | Ga0439457_004376 | Ga0439457_004376_1311_3164 | 524 |
| 191 | 3300042435 | Ga0439434_0007901 | Ga0439434_0007901_125_1978 | 524 |
| 192 | 3300044694 | Ga0466963_0036504 | Ga0466963_0036504_926_2677 | 524 |
| 193 | 3300044842 | Ga0466957_0005913 | Ga0466957_0005913_4028_5779 | 524 |
| 194 | 3300044842 | Ga0466957_0044097 | Ga0466957_0044097_905_2671 | 524 |
| 195 | 3300044901 | Ga0466960_0061772 | Ga0466960_0061772_16_1767 | 524 |
| 196 | 3300045836 | Ga0466958_0012190 | Ga0466958_0012190_114_1865 | 524 |
| 197 | 3300045836 | Ga0466958_0014277 | Ga0466958_0014277_141_1907 | 524 |
| 198 | 3300046501 | Ga0495607_0054822 | Ga0495607_0054822_84_1850 | 524 |
| 199 | 3300046615 | Ga0495656_0032591 | Ga0495656_0032591_186_1952 | 524 |
| 200 | 3300046691 | Ga0495670_0022410 | Ga0495670_0022410_684_2450 | 524 |
| 201 | 3300046809 | Ga0495600_0022609 | Ga0495600_0022609_2275_4014 | 524 |
| 202 | 3300046810 | Ga0495660_0002746 | Ga0495660_0002746_1730_3496 | 524 |
| 203 | 3300047318 | Ga0495636_0018142 | Ga0495636_0018142_178_1944 | 524 |
| 204 | 3300047447 | Ga0495685_007407 | Ga0495685_007407_652_2418 | 524 |
| 205 | 3300053143 | Ga0500579_081146 | Ga0500579_081146_14_1780 | 524 |
| 206 | iso_pu_bacteria | 2875391855 | 2875395526 | 524 |
| 207 | 3300006844 | Ga0075428_100000616 | Ga0075428_10000061617 | 525 |
| 208 | 3300006846 | Ga0075430_100009757 | Ga0075430_1000097572 | 525 |
| 209 | 3300006880 | Ga0075429_100006984 | Ga0075429_1000069846 | 525 |
| 210 | 3300011119 | Ga0105246_10076994 | Ga0105246_100769942 | 525 |
| 211 | 3300030521 | Ga0307511_10000751 | Ga0307511_100007519 | 525 |
| 212 | 3300042002 | Ga0439442_000057 | Ga0439442_000057_15046_16830 | 525 |
| 213 | 3300044658 | Ga0466972_0011951 | Ga0466972_0011951_14_1774 | 525 |
| 214 | 3300045976 | Ga0466967_0006810 | Ga0466967_0006810_825_2585 | 525 |
| 215 | 3300048905 | Ga0496102_0146233 | Ga0496102_0146233_31_1809 | 525 |
| 216 | 3300048909 | Ga0496106_0066798 | Ga0496106_0066798_236_2014 | 525 |
| 217 | 3300048911 | Ga0496108_0075342 | Ga0496108_0075342_225_1979 | 525 |
| 218 | 3300048917 | Ga0496114_0068772 | Ga0496114_0068772_862_2640 | 525 |
| 219 | 3300048929 | Ga0496126_0000013 | Ga0496126_0000013_23462_25222 | 525 |
| 220 | 3300005471 | Ga0070698_100006233 | Ga0070698_1000062332 | 526 |
| 221 | 3300006028 | Ga0070717_10052397 | Ga0070717_100523972 | 526 |
| 222 | 3300013105 | Ga0157369_10009270 | Ga0157369_100092706 | 526 |
| 223 | 3300027907 | Ga0207428_10023405 | Ga0207428_100234051 | 526 |
| 224 | 3300028786 | Ga0307517_10038332 | Ga0307517_100383324 | 526 |
| 225 | 3300031251 | Ga0265327_10000019 | Ga0265327_10000019324 | 526 |
| 226 | 3300031251 | Ga0265327_10000183 | Ga0265327_1000018386 | 526 |
| 227 | 3300031911 | Ga0307412_10013117 | Ga0307412_100131171 | 526 |
| 228 | 3300031995 | Ga0307409_100021393 | Ga0307409_1000213933 | 526 |
| 229 | 3300037312 | Ga0395899_0005130 | Ga0395899_0005130_5914_7692 | 526 |
| 230 | 3300037418 | Ga0395900_0016794 | Ga0395900_0016794_814_2592 | 526 |
| 231 | 3300037466 | Ga0395898_0062169 | Ga0395898_0062169_1272_3050 | 526 |
| 232 | 3300038443 | Ga0395901_0012624 | Ga0395901_0012624_19_1788 | 526 |
| 233 | 3300038443 | Ga0395901_0091401 | Ga0395901_0091401_894_2672 | 526 |
| 234 | 3300044656 | Ga0466969_0011020 | Ga0466969_0011020_314_2077 | 526 |
| 235 | 3300044683 | Ga0466965_0047653 | Ga0466965_0047653_110_1897 | 526 |
| 236 | 3300045836 | Ga0466958_0069878 | Ga0466958_0069878_361_2124 | 526 |
| 237 | 3300046463 | Ga0495653_0005594 | Ga0495653_0005594_4366_6216 | 526 |
| 238 | 3300046477 | Ga0495664_0014367 | Ga0495664_0014367_82_1932 | 526 |
| 239 | 3300046516 | Ga0495628_0027189 | Ga0495628_0027189_45_1835 | 526 |
| 240 | 3300046517 | Ga0495630_0091446 | Ga0495630_0091446_378_2228 | 526 |
| 241 | 3300046531 | Ga0495665_0003807 | Ga0495665_0003807_2167_4017 | 526 |
| 242 | 3300046535 | Ga0495586_0008159 | Ga0495586_0008159_489_2339 | 526 |
| 243 | 3300046543 | Ga0495645_0007697 | Ga0495645_0007697_2942_4792 | 526 |
| 244 | 3300046559 | Ga0495667_0003843 | Ga0495667_0003843_4027_5877 | 526 |
| 245 | 3300046809 | Ga0495600_0057700 | Ga0495600_0057700_751_2514 | 526 |
| 246 | 3300047315 | Ga0495581_0004980 | Ga0495581_0004980_3353_5203 | 526 |
| 247 | 3300047317 | Ga0495604_0025499 | Ga0495604_0025499_2368_4131 | 526 |
| 248 | 3300047321 | Ga0495676_0072838 | Ga0495676_0072838_155_1939 | 526 |
| 249 | 3300047444 | Ga0495675_0004430 | Ga0495675_0004430_4232_6082 | 526 |
| 250 | 3300048917 | Ga0496114_0001105 | Ga0496114_0001105_12449_14239 | 526 |
| 251 | 3300048927 | Ga0496124_0006912 | Ga0496124_0006912_4546_6330 | 526 |
| 252 | 3300049578 | Ga0501042_0043864 | Ga0501042_0043864_427_2238 | 526 |
| 253 | 3300050507 | nmdc:mga05p37_14800_c1 | nmdc:mga05p37_14800_c1_5954_7714 | 526 |
| 254 | 3300053096 | Ga0500641_0002075 | Ga0500641_0002075_5209_6981 | 526 |
| 255 | 3300005467 | Ga0070706_100066715 | Ga0070706_1000667153 | 527 |
| 256 | 3300005616 | Ga0068852_100012789 | Ga0068852_1000127898 | 527 |
| 257 | 3300025315 | Ga0207697_10014594 | Ga0207697_100145942 | 527 |
| 258 | 3300025900 | Ga0207710_10011096 | Ga0207710_100110963 | 527 |
| 259 | 3300025910 | Ga0207684_10024597 | Ga0207684_100245971 | 527 |
| 260 | 3300026142 | Ga0207698_10070547 | Ga0207698_100705471 | 527 |
| 261 | 3300038443 | Ga0395901_0012908 | Ga0395901_0012908_6556_8310 | 527 |
| 262 | 3300044656 | Ga0466969_0003937 | Ga0466969_0003937_1834_3621 | 527 |
| 263 | 3300044684 | Ga0466966_0005391 | Ga0466966_0005391_5987_7774 | 527 |
| 264 | 3300044693 | Ga0466961_0070653 | Ga0466961_0070653_159_1946 | 527 |
| 265 | 3300044719 | Ga0466971_0000548 | Ga0466971_0000548_6675_8444 | 527 |
| 266 | 3300044719 | Ga0466971_0008322 | Ga0466971_0008322_750_2537 | 527 |
| 267 | 3300044765 | Ga0466970_0016267 | Ga0466970_0016267_880_2667 | 527 |
| 268 | 3300044765 | Ga0466970_0048458 | Ga0466970_0048458_405_2192 | 527 |
| 269 | 3300045049 | Ga0466959_0001241 | Ga0466959_0001241_9721_11490 | 527 |
| 270 | 3300046462 | Ga0495651_0027748 | Ga0495651_0027748_272_2026 | 527 |
| 271 | 3300046477 | Ga0495664_0060537 | Ga0495664_0060537_451_2211 | 527 |
| 272 | 3300046529 | Ga0495652_0009990 | Ga0495652_0009990_4080_5834 | 527 |
| 273 | 3300046559 | Ga0495667_0044554 | Ga0495667_0044554_151_1905 | 527 |
| 274 | 3300046674 | Ga0495588_0009123 | Ga0495588_0009123_177_1943 | 527 |
| 275 | 3300046675 | Ga0495657_0054015 | Ga0495657_0054015_426_2180 | 527 |
| 276 | 3300047322 | Ga0495680_0051439 | Ga0495680_0051439_953_2707 | 527 |
| 277 | 3300048908 | Ga0496105_0150492 | Ga0496105_0150492_86_1852 | 527 |
| 278 | 3300048918 | Ga0496115_0063077 | Ga0496115_0063077_768_2648 | 527 |
| 279 | 3300049574 | Ga0501038_0028477 | Ga0501038_0028477_359_2137 | 527 |
| 280 | 3300050511 | nmdc:mga08y16_83547_c1 | nmdc:mga08y16_83547_c1_74_1858 | 527 |
| 281 | 3300061719 | Ga0466962_0000273 | Ga0466962_0000273_15937_17706 | 527 |
| 282 | 3300005288 | Ga0065714_10090062 | Ga0065714_100900621 | 528 |
| 283 | 3300005456 | Ga0070678_100038330 | Ga0070678_1000383303 | 528 |
| 284 | 3300006163 | Ga0070715_10001275 | Ga0070715_100012756 | 528 |
| 285 | 3300006353 | Ga0075370_10007332 | Ga0075370_100073323 | 528 |
| 286 | 3300009177 | Ga0105248_10102589 | Ga0105248_101025893 | 528 |
| 287 | 3300021388 | Ga0213875_10005151 | Ga0213875_100051516 | 528 |
| 288 | 3300025315 | Ga0207697_10001781 | Ga0207697_100017816 | 528 |
| 289 | 3300025907 | Ga0207645_10006791 | Ga0207645_100067915 | 528 |
| 290 | 3300025923 | Ga0207681_10022072 | Ga0207681_100220722 | 528 |
| 291 | 3300025929 | Ga0207664_10000869 | Ga0207664_100008696 | 528 |
| 292 | 3300025935 | Ga0207709_10011362 | Ga0207709_100113623 | 528 |
| 293 | 3300025940 | Ga0207691_10004770 | Ga0207691_100047707 | 528 |
| 294 | 3300026116 | Ga0207674_10040825 | Ga0207674_100408251 | 528 |
| 295 | 3300026121 | Ga0207683_10006712 | Ga0207683_100067122 | 528 |
| 296 | 3300031548 | Ga0307408_100019852 | Ga0307408_1000198523 | 528 |
| 297 | 3300031901 | Ga0307406_10015634 | Ga0307406_100156343 | 528 |
| 298 | 3300037853 | Ga0436364_1085870 | Ga0436364_1085870_11063_12829 | 528 |
| 299 | 3300041413 | Ga0439465_0015558 | Ga0439465_0015558_376_2184 | 528 |
| 300 | 3300042015 | Ga0439462_0000292 | Ga0439462_0000292_7340_9148 | 528 |
| 301 | 3300042146 | Ga0450907_000926 | Ga0450907_000926_451_2235 | 528 |
| 302 | 3300045976 | Ga0466967_0000439 | Ga0466967_0000439_4721_6478 | 528 |
| 303 | 3300045976 | Ga0466967_0163906 | Ga0466967_0163906_126_1874 | 528 |
| 304 | 3300046499 | Ga0495594_0039489 | Ga0495594_0039489_317_2071 | 528 |
| 305 | 3300046528 | Ga0495642_0022835 | Ga0495642_0022835_219_2072 | 528 |
| 306 | 3300046533 | Ga0495640_0026089 | Ga0495640_0026089_383_2143 | 528 |
| 307 | 3300047443 | Ga0495687_024164 | Ga0495687_024164_1124_2878 | 528 |
| 308 | 3300048903 | Ga0496100_0045991 | Ga0496100_0045991_507_2360 | 528 |
| 309 | 3300048907 | Ga0496104_0003155 | Ga0496104_0003155_7897_9672 | 528 |
| 310 | 3300048911 | Ga0496108_0011859 | Ga0496108_0011859_2893_4668 | 528 |
| 311 | 3300048912 | Ga0496109_0004982 | Ga0496109_0004982_1746_3521 | 528 |
| 312 | 3300048913 | Ga0496110_0000029 | Ga0496110_0000029_64569_66344 | 528 |
| 313 | 3300048913 | Ga0496110_0074672 | Ga0496110_0074672_364_2217 | 528 |
| 314 | 3300048914 | Ga0496111_0001582 | Ga0496111_0001582_4234_6009 | 528 |
| 315 | 3300048915 | Ga0496112_0087242 | Ga0496112_0087242_1035_2888 | 528 |
| 316 | 3300048916 | Ga0496113_0002367 | Ga0496113_0002367_5594_7369 | 528 |
| 317 | 3300048918 | Ga0496115_0122599 | Ga0496115_0122599_52_1905 | 528 |
| 318 | 3300050491 | nmdc:mga00v17_19006_c1 | nmdc:mga00v17_19006_c1_894_2714 | 528 |
| 319 | 3300053161 | Ga0500634_0061814 | Ga0500634_0061814_218_1972 | 528 |
| 320 | iso_pu_bacteria | 2875391855 | 2875396248 | 528 |
| 321 | iso_pu_bacteria | 2912757875 | 2912762351 | 528 |
| 322 | 3300002773 | JGI25152J39213_1000090 | JGI25152J39213_100009029 | 529 |
| 323 | 3300005347 | Ga0070668_100000752 | Ga0070668_10000075214 | 529 |
| 324 | 3300005578 | Ga0068854_100011506 | Ga0068854_1000115063 | 529 |
| 325 | 3300006175 | Ga0070712_100009384 | Ga0070712_1000093842 | 529 |
| 326 | 3300009551 | Ga0105238_10001962 | Ga0105238_1000196214 | 529 |
| 327 | 3300025258 | Ga0209129_1000201 | Ga0209129_100020116 | 529 |
| 328 | 3300025294 | Ga0209025_1000279 | Ga0209025_100027916 | 529 |
| 329 | 3300025915 | Ga0207693_10020593 | Ga0207693_100205931 | 529 |
| 330 | 3300025939 | Ga0207665_10012322 | Ga0207665_100123222 | 529 |
| 331 | 3300025972 | Ga0207668_10019243 | Ga0207668_100192433 | 529 |
| 332 | 3300035691 | Ga0373931_0017406 | Ga0373931_0017406_33_1817 | 529 |
| 333 | 3300044683 | Ga0466965_0011414 | Ga0466965_0011414_1094_2848 | 529 |
| 334 | 3300045976 | Ga0466967_0027070 | Ga0466967_0027070_2567_4339 | 529 |
| 335 | 3300046674 | Ga0495588_0011498 | Ga0495588_0011498_2298_4094 | 529 |
| 336 | 3300046794 | Ga0495589_0027648 | Ga0495589_0027648_1059_2735 | 529 |
| 337 | 3300048908 | Ga0496105_0013756 | Ga0496105_0013756_2030_3814 | 529 |
| 338 | 3300048918 | Ga0496115_0001767 | Ga0496115_0001767_4064_5848 | 529 |
| 339 | 3300005364 | Ga0070673_100024309 | Ga0070673_1000243092 | 530 |
| 340 | 3300005366 | Ga0070659_100017069 | Ga0070659_1000170693 | 530 |
| 341 | 3300005435 | Ga0070714_100009991 | Ga0070714_1000099914 | 530 |
| 342 | 3300005435 | Ga0070714_100063812 | Ga0070714_1000638122 | 530 |
| 343 | 3300005547 | Ga0070693_100023994 | Ga0070693_1000239942 | 530 |
| 344 | 3300005563 | Ga0068855_100029077 | Ga0068855_1000290775 | 530 |
| 345 | 3300006237 | Ga0097621_100028229 | Ga0097621_1000282292 | 530 |
| 346 | 3300013307 | Ga0157372_10240518 | Ga0157372_102405182 | 530 |
| 347 | 3300025906 | Ga0207699_10061248 | Ga0207699_100612481 | 530 |
| 348 | 3300025929 | Ga0207664_10003140 | Ga0207664_100031408 | 530 |
| 349 | 3300025929 | Ga0207664_10007844 | Ga0207664_100078446 | 530 |
| 350 | 3300025935 | Ga0207709_10036161 | Ga0207709_100361612 | 530 |
| 351 | 3300025942 | Ga0207689_10020565 | Ga0207689_100205653 | 530 |
| 352 | 3300025949 | Ga0207667_10154988 | Ga0207667_101549882 | 530 |
| 353 | 3300026067 | Ga0207678_10026466 | Ga0207678_100264663 | 530 |
| 354 | 3300031727 | Ga0316576_10004581 | Ga0316576_100045816 | 530 |
| 355 | 3300031731 | Ga0307405_10010452 | Ga0307405_100104522 | 530 |
| 356 | 3300035398 | Ga0316574_0006103 | Ga0316574_0006103_3705_5471 | 530 |
| 357 | 3300041404 | Ga0439436_0003722 | Ga0439436_0003722_2319_4127 | 530 |
| 358 | 3300041406 | Ga0439439_0001564 | Ga0439439_0001564_1392_3200 | 530 |
| 359 | 3300041411 | Ga0439466_0016304 | Ga0439466_0016304_859_2667 | 530 |
| 360 | 3300041999 | Ga0439433_0000773 | Ga0439433_0000773_41_1849 | 530 |
| 361 | 3300042002 | Ga0439442_002691 | Ga0439442_002691_1431_3239 | 530 |
| 362 | 3300042006 | Ga0439432_000995 | Ga0439432_000995_3781_5589 | 530 |
| 363 | 3300042007 | Ga0439449_0005656 | Ga0439449_0005656_812_2620 | 530 |
| 364 | 3300042010 | Ga0439452_009170 | Ga0439452_009170_527_2335 | 530 |
| 365 | 3300042014 | Ga0439457_006789 | Ga0439457_006789_799_2607 | 530 |
| 366 | 3300045976 | Ga0466967_0016752 | Ga0466967_0016752_2473_4275 | 530 |
| 367 | 3300047315 | Ga0495581_0016628 | Ga0495581_0016628_2458_4242 | 530 |
| 368 | 3300047315 | Ga0495581_0037166 | Ga0495581_0037166_981_2747 | 530 |
| 369 | 3300048920 | Ga0496117_0046550 | Ga0496117_0046550_47_1813 | 530 |
| 370 | 3300048921 | Ga0496118_0009293 | Ga0496118_0009293_6997_8763 | 530 |
| 371 | 3300049572 | Ga0501036_0019557 | Ga0501036_0019557_3457_5238 | 530 |
| 372 | 3300049573 | Ga0501037_0030339 | Ga0501037_0030339_641_2422 | 530 |
| 373 | 3300049574 | Ga0501038_0041101 | Ga0501038_0041101_1012_2793 | 530 |
| 374 | 3300049576 | Ga0501040_0034489 | Ga0501040_0034489_1049_2830 | 530 |
| 375 | 3300049577 | Ga0501041_0023758 | Ga0501041_0023758_466_2247 | 530 |
| 376 | 3300049587 | Ga0501071_0011608 | Ga0501071_0011608_3070_4851 | 530 |
| 377 | 3300049588 | Ga0501072_0040307 | Ga0501072_0040307_1086_2867 | 530 |
| 378 | 3300049590 | Ga0501074_0020563 | Ga0501074_0020563_2442_4223 | 530 |
| 379 | 3300049592 | Ga0501076_0038560 | Ga0501076_0038560_133_1914 | 530 |
| 380 | 3300049593 | Ga0501077_0008581 | Ga0501077_0008581_3521_5302 | 530 |
| 381 | 3300053140 | Ga0500573_0023039 | Ga0500573_0023039_1781_3535 | 530 |
| 382 | 3300060353 | Ga0501082_0045533 | Ga0501082_0045533_1518_3299 | 530 |
| 383 | 3300005468 | Ga0070707_100013921 | Ga0070707_1000139216 | 531 |
| 384 | 3300005518 | Ga0070699_100005880 | Ga0070699_1000058807 | 531 |
| 385 | 3300005536 | Ga0070697_100008356 | Ga0070697_1000083565 | 531 |
| 386 | 3300005937 | Ga0081455_10000454 | Ga0081455_1000045421 | 531 |
| 387 | 3300025922 | Ga0207646_10017313 | Ga0207646_100173135 | 531 |
| 388 | 3300031852 | Ga0307410_10047928 | Ga0307410_100479282 | 531 |
| 389 | 3300035119 | Ga0373956_0001955 | Ga0373956_0001955_1588_3381 | 531 |
| 390 | 3300035120 | Ga0373957_0000075 | Ga0373957_0000075_7944_9737 | 531 |
| 391 | 3300035172 | Ga0373955_0000013 | Ga0373955_0000013_21628_23421 | 531 |
| 392 | 3300035410 | Ga0373924_0000065 | Ga0373924_0000065_6251_8044 | 531 |
| 393 | 3300035724 | Ga0373933_0009213 | Ga0373933_0009213_510_2303 | 531 |
| 394 | 3300036401 | Ga0373937_0000336 | Ga0373937_0000336_26980_28773 | 531 |
| 395 | 3300044658 | Ga0466972_0015351 | Ga0466972_0015351_917_2710 | 531 |
| 396 | 3300044683 | Ga0466965_0003356 | Ga0466965_0003356_2862_4640 | 531 |
| 397 | 3300044693 | Ga0466961_0044676 | Ga0466961_0044676_1011_2819 | 531 |
| 398 | 3300044694 | Ga0466963_0100299 | Ga0466963_0100299_67_1875 | 531 |
| 399 | 3300044706 | Ga0466964_0005906 | Ga0466964_0005906_2614_4422 | 531 |
| 400 | 3300044719 | Ga0466971_0014172 | Ga0466971_0014172_764_2557 | 531 |
| 401 | 3300044765 | Ga0466970_0008393 | Ga0466970_0008393_2490_4283 | 531 |
| 402 | 3300044842 | Ga0466957_0006505 | Ga0466957_0006505_376_2169 | 531 |
| 403 | 3300044901 | Ga0466960_0005069 | Ga0466960_0005069_293_2077 | 531 |
| 404 | 3300045836 | Ga0466958_0026999 | Ga0466958_0026999_816_2609 | 531 |
| 405 | 3300045976 | Ga0466967_0014660 | Ga0466967_0014660_3027_4820 | 531 |
| 406 | 3300045976 | Ga0466967_0100182 | Ga0466967_0100182_162_1946 | 531 |
| 407 | 3300046454 | Ga0495592_0000094 | Ga0495592_0000094_50029_51822 | 531 |
| 408 | 3300046462 | Ga0495651_0000041 | Ga0495651_0000041_65388_67181 | 531 |
| 409 | 3300046462 | Ga0495651_0078318 | Ga0495651_0078318_534_2279 | 531 |
| 410 | 3300046463 | Ga0495653_0000888 | Ga0495653_0000888_6579_8372 | 531 |
| 411 | 3300046463 | Ga0495653_0057281 | Ga0495653_0057281_848_2593 | 531 |
| 412 | 3300046511 | Ga0495608_0000081 | Ga0495608_0000081_41133_42926 | 531 |
| 413 | 3300046516 | Ga0495628_0000164 | Ga0495628_0000164_26964_28757 | 531 |
| 414 | 3300046529 | Ga0495652_0000289 | Ga0495652_0000289_30938_32731 | 531 |
| 415 | 3300046536 | Ga0495587_0000038 | Ga0495587_0000038_21391_23184 | 531 |
| 416 | 3300046559 | Ga0495667_0000070 | Ga0495667_0000070_26973_28766 | 531 |
| 417 | 3300046675 | Ga0495657_0000192 | Ga0495657_0000192_23066_24859 | 531 |
| 418 | 3300046678 | Ga0495599_0002816 | Ga0495599_0002816_4520_6313 | 531 |
| 419 | 3300046679 | Ga0495623_0000248 | Ga0495623_0000248_26943_28736 | 531 |
| 420 | 3300046680 | Ga0495646_0001725 | Ga0495646_0001725_9397_11190 | 531 |
| 421 | 3300046809 | Ga0495600_0005479 | Ga0495600_0005479_1459_3252 | 531 |
| 422 | 3300047317 | Ga0495604_0000061 | Ga0495604_0000061_26980_28773 | 531 |
| 423 | 3300047322 | Ga0495680_0000099 | Ga0495680_0000099_26980_28773 | 531 |
| 424 | 3300047444 | Ga0495675_0000597 | Ga0495675_0000597_15563_17356 | 531 |
| 425 | 3300048088 | Ga0495602_0000319 | Ga0495602_0000319_15717_17510 | 531 |
| 426 | 3300048905 | Ga0496102_0000121 | Ga0496102_0000121_105434_107203 | 531 |
| 427 | 3300048906 | Ga0496103_0000224 | Ga0496103_0000224_4940_6709 | 531 |
| 428 | 3300048911 | Ga0496108_0063215 | Ga0496108_0063215_1099_2886 | 531 |
| 429 | 3300048912 | Ga0496109_0027940 | Ga0496109_0027940_11_1798 | 531 |
| 430 | 3300048924 | Ga0496121_0062848 | Ga0496121_0062848_525_2294 | 531 |
| 431 | 3300053084 | Ga0495595_0000246 | Ga0495595_0000246_10524_12317 | 531 |
| 432 | iso_pu_bacteria | 2862290372 | 2862294749 | 531 |
| 433 | 3300005434 | Ga0070709_10000118 | Ga0070709_1000011825 | 532 |
| 434 | 3300005435 | Ga0070714_100025037 | Ga0070714_1000250372 | 532 |
| 435 | 3300005436 | Ga0070713_100001150 | Ga0070713_1000011502 | 532 |
| 436 | 3300005437 | Ga0070710_10000216 | Ga0070710_1000021625 | 532 |
| 437 | 3300005439 | Ga0070711_100000161 | Ga0070711_10000016133 | 532 |
| 438 | 3300005455 | Ga0070663_100000324 | Ga0070663_1000003245 | 532 |
| 439 | 3300006028 | Ga0070717_10000504 | Ga0070717_1000050421 | 532 |
| 440 | 3300006173 | Ga0070716_100000491 | Ga0070716_1000004912 | 532 |
| 441 | 3300021388 | Ga0213875_10009992 | Ga0213875_100099923 | 532 |
| 442 | 3300025898 | Ga0207692_10000186 | Ga0207692_100001866 | 532 |
| 443 | 3300025906 | Ga0207699_10000106 | Ga0207699_1000010635 | 532 |
| 444 | 3300025916 | Ga0207663_10000661 | Ga0207663_100006612 | 532 |
| 445 | 3300025928 | Ga0207700_10000053 | Ga0207700_1000005347 | 532 |
| 446 | 3300025929 | Ga0207664_10000949 | Ga0207664_100009496 | 532 |
| 447 | 3300025939 | Ga0207665_10000166 | Ga0207665_1000016627 | 532 |
| 448 | 3300035724 | Ga0373933_0057308 | Ga0373933_0057308_312_2057 | 532 |
| 449 | 3300037068 | Ga0373925_0057053 | Ga0373925_0057053_602_2395 | 532 |
| 450 | 3300037466 | Ga0395898_0114974 | Ga0395898_0114974_123_1907 | 532 |
| 451 | 3300037853 | Ga0436364_0711490 | Ga0436364_0711490_744_2504 | 532 |
| 452 | 3300044901 | Ga0466960_0001455 | Ga0466960_0001455_416_2209 | 532 |
| 453 | 3300047471 | Ga0495684_0027484 | Ga0495684_0027484_1361_3145 | 532 |
| 454 | 3300017792 | Ga0163161_10082328 | Ga0163161_100823282 | 533 |
| 455 | 3300031911 | Ga0307412_10010104 | Ga0307412_100101041 | 533 |
| 456 | 3300035083 | Ga0373926_0000865 | Ga0373926_0000865_5339_7189 | 533 |
| 457 | 3300035692 | Ga0373935_0000348 | Ga0373935_0000348_11698_13548 | 533 |
| 458 | 3300035725 | Ga0373947_0000004 | Ga0373947_0000004_222603_224453 | 533 |
| 459 | 3300037418 | Ga0395900_0059129 | Ga0395900_0059129_806_2587 | 533 |
| 460 | 3300037471 | Ga0395905_0005189 | Ga0395905_0005189_1510_3291 | 533 |
| 461 | 3300038443 | Ga0395901_0048880 | Ga0395901_0048880_1043_2824 | 533 |
| 462 | 3300038443 | Ga0395901_0075774 | Ga0395901_0075774_999_2783 | 533 |
| 463 | 3300041404 | Ga0439436_0005736 | Ga0439436_0005736_825_2615 | 533 |
| 464 | 3300048905 | Ga0496102_0078123 | Ga0496102_0078123_1016_2782 | 533 |
| 465 | 3300005435 | Ga0070714_100081990 | Ga0070714_1000819901 | 534 |
| 466 | 3300025916 | Ga0207663_10050913 | Ga0207663_100509132 | 534 |
| 467 | 3300025928 | Ga0207700_10020110 | Ga0207700_100201102 | 534 |
| 468 | 3300025929 | Ga0207664_10070580 | Ga0207664_100705801 | 534 |
| 469 | 3300026116 | Ga0207674_10118576 | Ga0207674_101185763 | 534 |
| 470 | 3300033179 | Ga0307507_10013353 | Ga0307507_100133535 | 534 |
| 471 | 3300035083 | Ga0373926_0002814 | Ga0373926_0002814_29_1789 | 534 |
| 472 | 3300035089 | Ga0373944_0003068 | Ga0373944_0003068_253_2013 | 534 |
| 473 | 3300035116 | Ga0373945_0000182 | Ga0373945_0000182_14405_16165 | 534 |
| 474 | 3300035170 | Ga0373943_0008756 | Ga0373943_0008756_1123_2883 | 534 |
| 475 | 3300035171 | Ga0373946_0000413 | Ga0373946_0000413_10513_12273 | 534 |
| 476 | 3300035692 | Ga0373935_0004199 | Ga0373935_0004199_391_2151 | 534 |
| 477 | 3300035695 | Ga0373927_0006703 | Ga0373927_0006703_1787_3547 | 534 |
| 478 | 3300037068 | Ga0373925_0034901 | Ga0373925_0034901_1386_3146 | 534 |
| 479 | 3300037466 | Ga0395898_0008019 | Ga0395898_0008019_3788_5536 | 534 |
| 480 | 3300038443 | Ga0395901_0007569 | Ga0395901_0007569_4347_6107 | 534 |
| 481 | 3300044694 | Ga0466963_0029795 | Ga0466963_0029795_1542_3305 | 534 |
| 482 | 3300044735 | Ga0466968_0052709 | Ga0466968_0052709_21_1709 | 534 |
| 483 | 3300045976 | Ga0466967_0065625 | Ga0466967_0065625_633_2402 | 534 |
| 484 | 3300046454 | Ga0495592_0033965 | Ga0495592_0033965_351_2132 | 534 |
| 485 | 3300046477 | Ga0495664_0006585 | Ga0495664_0006585_124_1884 | 534 |
| 486 | 3300046516 | Ga0495628_0011191 | Ga0495628_0011191_672_2453 | 534 |
| 487 | 3300046529 | Ga0495652_0049005 | Ga0495652_0049005_1331_3091 | 534 |
| 488 | 3300047319 | Ga0495674_0010600 | Ga0495674_0010600_4563_6323 | 534 |
| 489 | 3300047321 | Ga0495676_0010245 | Ga0495676_0010245_2389_4149 | 534 |
| 490 | 3300047322 | Ga0495680_0007008 | Ga0495680_0007008_8185_9945 | 534 |
| 491 | iso_pu_bacteria | 2508501122 | 2509112779 | 534 |
| 492 | iso_pu_bacteria | 2524023207 | 2524454397 | 534 |
| 493 | iso_pu_bacteria | 2921257292 | 2921263959 | 534 |
| 494 | iso_pu_bacteria | 2937023124 | 2937028812 | 534 |
| 495 | iso_pu_bacteria | 2957395598 | 2957396403 | 534 |
| 496 | iso_pu_bacteria | 2964615318 | 2964615700 | 534 |
| 497 | iso_pu_bacteria | 2967755722 | 2967762259 | 534 |
| 498 | iso_pu_bacteria | 2970102677 | 2970108639 | 534 |
| 499 | 3300002077 | JGI24744J21845_10000282 | JGI24744J21845_100002823 | 535 |
| 500 | 3300003659 | JGI25404J52841_10000835 | JGI25404J52841_100008351 | 535 |
| 501 | 3300005983 | Ga0081540_1000292 | Ga0081540_100029244 | 535 |
| 502 | 3300035410 | Ga0373924_0002376 | Ga0373924_0002376_3112_4896 | 535 |
| 503 | 3300042014 | Ga0439457_002913 | Ga0439457_002913_3007_4701 | 535 |
| 504 | 3300046517 | Ga0495630_0025052 | Ga0495630_0025052_2362_4146 | 535 |
| 505 | 3300048912 | Ga0496109_0054251 | Ga0496109_0054251_97_1887 | 535 |
| 506 | 3300005467 | Ga0070706_100008575 | Ga0070706_1000085754 | 536 |
| 507 | 3300005471 | Ga0070698_100000621 | Ga0070698_10000062124 | 536 |
| 508 | 3300010375 | Ga0105239_10009208 | Ga0105239_1000920810 | 536 |
| 509 | 3300031731 | Ga0307405_10011740 | Ga0307405_100117403 | 536 |
| 510 | 3300031901 | Ga0307406_10061689 | Ga0307406_100616891 | 536 |
| 511 | 3300031903 | Ga0307407_10002987 | Ga0307407_100029873 | 536 |
| 512 | 3300031911 | Ga0307412_10018006 | Ga0307412_100180064 | 536 |
| 513 | 3300048903 | Ga0496100_0024129 | Ga0496100_0024129_885_2669 | 536 |
| 514 | 3300048908 | Ga0496105_0001578 | Ga0496105_0001578_9474_11258 | 536 |
| 515 | 3300048910 | Ga0496107_0047975 | Ga0496107_0047975_159_1943 | 536 |
| 516 | 3300048918 | Ga0496115_0004766 | Ga0496115_0004766_3759_5543 | 536 |
| 517 | 3300048925 | Ga0496122_0000449 | Ga0496122_0000449_67850_69583 | 536 |
| 518 | 3300048926 | Ga0496123_0000263 | Ga0496123_0000263_36249_37982 | 536 |
| 519 | 3300048927 | Ga0496124_0014874 | Ga0496124_0014874_4300_6033 | 536 |
| 520 | 3300005981 | Ga0081538_10000079 | Ga0081538_1000007927 | 537 |
| 521 | 3300005985 | Ga0081539_10004815 | Ga0081539_1000481510 | 537 |
| 522 | 3300025910 | Ga0207684_10010264 | Ga0207684_100102645 | 537 |
| 523 | 3300035118 | Ga0373954_0007919 | Ga0373954_0007919_2088_3863 | 537 |
| 524 | 3300035120 | Ga0373957_0005287 | Ga0373957_0005287_337_2112 | 537 |
| 525 | 3300045976 | Ga0466967_0056008 | Ga0466967_0056008_946_2697 | 537 |
| 526 | 3300046462 | Ga0495651_0013925 | Ga0495651_0013925_1970_3745 | 537 |
| 527 | 3300046463 | Ga0495653_0061707 | Ga0495653_0061707_367_2142 | 537 |
| 528 | 3300046511 | Ga0495608_0030128 | Ga0495608_0030128_301_2076 | 537 |
| 529 | 3300046516 | Ga0495628_0087074 | Ga0495628_0087074_317_2092 | 537 |
| 530 | 3300047322 | Ga0495680_0020086 | Ga0495680_0020086_428_2203 | 537 |
| 531 | 3300048917 | Ga0496114_0008504 | Ga0496114_0008504_100_1863 | 537 |
| 532 | 3300049580 | Ga0501046_0056144 | Ga0501046_0056144_1260_3032 | 537 |
| 533 | 3300031456 | Ga0307513_10027182 | Ga0307513_100271823 | 538 |
| 534 | 3300035111 | Ga0373923_0007372 | Ga0373923_0007372_1868_3667 | 538 |
| 535 | 3300048913 | Ga0496110_0077499 | Ga0496110_0077499_1044_2828 | 538 |
| 536 | 3300048929 | Ga0496126_0000246 | Ga0496126_0000246_5840_7600 | 538 |
| 537 | iso_pu_bacteria | 2643221627 | 2644155412 | 538 |
| 538 | iso_pu_bacteria | 2847670302 | 2847670569 | 538 |
| 539 | iso_pu_bacteria | 2876392853 | 2876394305 | 538 |
| 540 | iso_pu_bacteria | 2904659560 | 2904661022 | 538 |
| 541 | 3300005341 | Ga0070691_10010169 | Ga0070691_100101692 | 539 |
| 542 | 3300005343 | Ga0070687_100062940 | Ga0070687_1000629401 | 539 |
| 543 | 3300005366 | Ga0070659_100026681 | Ga0070659_1000266814 | 539 |
| 544 | 3300005438 | Ga0070701_10011409 | Ga0070701_100114092 | 539 |
| 545 | 3300005441 | Ga0070700_100023955 | Ga0070700_1000239553 | 539 |
| 546 | 3300005459 | Ga0068867_100021638 | Ga0068867_1000216382 | 539 |
| 547 | 3300005543 | Ga0070672_100017922 | Ga0070672_1000179223 | 539 |
| 548 | 3300005548 | Ga0070665_100007856 | Ga0070665_1000078563 | 539 |
| 549 | 3300005616 | Ga0068852_100023223 | Ga0068852_1000232232 | 539 |
| 550 | 3300009148 | Ga0105243_10008770 | Ga0105243_100087702 | 539 |
| 551 | 3300009177 | Ga0105248_10026802 | Ga0105248_100268023 | 539 |
| 552 | 3300009553 | Ga0105249_10020433 | Ga0105249_100204332 | 539 |
| 553 | 3300013307 | Ga0157372_10024275 | Ga0157372_100242753 | 539 |
| 554 | 3300025939 | Ga0207665_10005581 | Ga0207665_100055819 | 539 |
| 555 | 3300028379 | Ga0268266_10007499 | Ga0268266_100074994 | 539 |
| 556 | 3300031456 | Ga0307513_10170324 | Ga0307513_101703241 | 539 |
| 557 | 3300037312 | Ga0395899_0000958 | Ga0395899_0000958_17627_19390 | 539 |
| 558 | 3300044684 | Ga0466966_0018034 | Ga0466966_0018034_538_2376 | 539 |
| 559 | 3300005843 | Ga0068860_100158790 | Ga0068860_1001587902 | 540 |
| 560 | 3300025935 | Ga0207709_10017782 | Ga0207709_100177822 | 540 |
| 561 | 3300025940 | Ga0207691_10001822 | Ga0207691_100018225 | 540 |
| 562 | 3300026075 | Ga0207708_10000897 | Ga0207708_1000089715 | 540 |
| 563 | 3300026089 | Ga0207648_10001889 | Ga0207648_100018894 | 540 |
| 564 | 3300028381 | Ga0268264_10089662 | Ga0268264_100896623 | 540 |
| 565 | 3300035724 | Ga0373933_0013657 | Ga0373933_0013657_2494_4269 | 540 |
| 566 | 3300047321 | Ga0495676_0051628 | Ga0495676_0051628_749_2509 | 540 |
| 567 | 3300048912 | Ga0496109_0067691 | Ga0496109_0067691_1393_3186 | 540 |
| 568 | 3300048913 | Ga0496110_0007385 | Ga0496110_0007385_2967_4778 | 540 |
| 569 | 3300013102 | Ga0157371_10107012 | Ga0157371_101070122 | 541 |
| 570 | 3300014968 | Ga0157379_10169475 | Ga0157379_101694751 | 541 |
| 571 | 3300026035 | Ga0207703_10127966 | Ga0207703_101279661 | 541 |
| 572 | 3300026078 | Ga0207702_10050966 | Ga0207702_100509662 | 541 |
| 573 | 3300028800 | Ga0265338_10008581 | Ga0265338_100085813 | 541 |
| 574 | 3300046525 | Ga0495663_0015683 | Ga0495663_0015683_27_1670 | 541 |
| 575 | 3300048909 | Ga0496106_0033123 | Ga0496106_0033123_317_2071 | 541 |
| 576 | 3300049573 | Ga0501037_0000625 | Ga0501037_0000625_12035_13810 | 541 |
| 577 | 3300053104 | Ga0500556_0000026 | Ga0500556_0000026_117131_118831 | 541 |
| 578 | 3300005329 | Ga0070683_100009374 | Ga0070683_1000093741 | 542 |
| 579 | 3300005530 | Ga0070679_100057096 | Ga0070679_1000570963 | 542 |
| 580 | 3300005577 | Ga0068857_100163022 | Ga0068857_1001630222 | 542 |
| 581 | 3300009147 | Ga0114129_10069299 | Ga0114129_100692992 | 542 |
| 582 | 3300013105 | Ga0157369_10166995 | Ga0157369_101669951 | 542 |
| 583 | 3300021388 | Ga0213875_10000514 | Ga0213875_1000051411 | 542 |
| 584 | 3300025944 | Ga0207661_10035553 | Ga0207661_100355532 | 542 |
| 585 | 3300037853 | Ga0436364_1379988 | Ga0436364_1379988_12361_14121 | 542 |
| 586 | 3300047471 | Ga0495684_0076083 | Ga0495684_0076083_721_2496 | 542 |
| 587 | 3300048922 | Ga0496119_0024996 | Ga0496119_0024996_1769_3502 | 542 |
| 588 | 3300048924 | Ga0496121_0000159 | Ga0496121_0000159_113438_115171 | 542 |
| 589 | 3300048926 | Ga0496123_0021495 | Ga0496123_0021495_450_2183 | 542 |
| 590 | 3300048928 | Ga0496125_0000005 | Ga0496125_0000005_682481_684214 | 542 |
| 591 | 3300048928 | Ga0496125_0023700 | Ga0496125_0023700_414_2135 | 542 |
| 592 | 3300048929 | Ga0496126_0008904 | Ga0496126_0008904_1334_3067 | 542 |
| 593 | iso_pu_bacteria | 2961114664 | 2961116096 | 542 |
| 594 | iso_pu_bacteria | 2968110612 | 2968112079 | 542 |
| 595 | 3300005339 | Ga0070660_100015206 | Ga0070660_1000152062 | 543 |
| 596 | 3300005535 | Ga0070684_100008587 | Ga0070684_1000085874 | 543 |
| 597 | 3300005535 | Ga0070684_100142538 | Ga0070684_1001425382 | 543 |
| 598 | 3300005618 | Ga0068864_100019057 | Ga0068864_1000190573 | 543 |
| 599 | 3300005842 | Ga0068858_100062383 | Ga0068858_1000623832 | 543 |
| 600 | 3300006880 | Ga0075429_100046081 | Ga0075429_1000460812 | 543 |
| 601 | 3300009098 | Ga0105245_10004429 | Ga0105245_100044295 | 543 |
| 602 | 3300009098 | Ga0105245_10023441 | Ga0105245_100234413 | 543 |
| 603 | 3300009177 | Ga0105248_10072231 | Ga0105248_100722312 | 543 |
| 604 | 3300011119 | Ga0105246_10003548 | Ga0105246_100035483 | 543 |
| 605 | 3300013308 | Ga0157375_10009533 | Ga0157375_100095333 | 543 |
| 606 | 3300014325 | Ga0163163_10023526 | Ga0163163_100235264 | 543 |
| 607 | 3300014968 | Ga0157379_10018022 | Ga0157379_100180223 | 543 |
| 608 | 3300025901 | Ga0207688_10051593 | Ga0207688_100515931 | 543 |
| 609 | 3300025919 | Ga0207657_10031297 | Ga0207657_100312973 | 543 |
| 610 | 3300026116 | Ga0207674_10004262 | Ga0207674_1000426211 | 543 |
| 611 | 3300046516 | Ga0495628_0021126 | Ga0495628_0021126_2154_3965 | 543 |
| 612 | 3300046529 | Ga0495652_0015739 | Ga0495652_0015739_3681_5492 | 543 |
| 613 | 3300046536 | Ga0495587_0000669 | Ga0495587_0000669_8425_10236 | 543 |
| 614 | 3300046616 | Ga0495668_0001747 | Ga0495668_0001747_8107_9870 | 543 |
| 615 | 3300046663 | Ga0495635_0106102 | Ga0495635_0106102_85_1866 | 543 |
| 616 | 3300046675 | Ga0495657_0044179 | Ga0495657_0044179_951_2762 | 543 |
| 617 | 3300047471 | Ga0495684_0018790 | Ga0495684_0018790_2086_3897 | 543 |
| 618 | 3300048088 | Ga0495602_0018424 | Ga0495602_0018424_2569_4380 | 543 |
| 619 | 3300048905 | Ga0496102_0044021 | Ga0496102_0044021_2227_4011 | 543 |
| 620 | 3300048911 | Ga0496108_0097184 | Ga0496108_0097184_660_2423 | 543 |
| 621 | 3300048924 | Ga0496121_0046631 | Ga0496121_0046631_1368_3098 | 543 |
| 622 | 3300049585 | Ga0501069_0014852 | Ga0501069_0014852_294_2078 | 543 |
| 623 | 3300049586 | Ga0501070_0016434 | Ga0501070_0016434_56_1840 | 543 |
| 624 | 3300049742 | Ga0501080_0091581 | Ga0501080_0091581_1026_2810 | 543 |
| 625 | 3300053077 | Ga0495601_0015455 | Ga0495601_0015455_2673_4484 | 543 |
| 626 | 3300053085 | Ga0495619_0019382 | Ga0495619_0019382_2304_4115 | 543 |
| 627 | 3300053134 | Ga0500658_0000312 | Ga0500658_0000312_2888_4618 | 543 |
| 628 | 3300006237 | Ga0097621_100026268 | Ga0097621_1000262683 | 544 |
| 629 | 3300025927 | Ga0207687_10092574 | Ga0207687_100925742 | 544 |
| 630 | 3300026121 | Ga0207683_10010893 | Ga0207683_100108933 | 544 |
| 631 | 3300046501 | Ga0495607_0012834 | Ga0495607_0012834_1861_3660 | 544 |
| 632 | 3300046531 | Ga0495665_0024051 | Ga0495665_0024051_52_1851 | 544 |
| 633 | 3300046543 | Ga0495645_0033523 | Ga0495645_0033523_1080_2879 | 544 |
| 634 | 3300046690 | Ga0495624_0042797 | Ga0495624_0042797_62_1861 | 544 |
| 635 | 3300047323 | Ga0495683_0000534 | Ga0495683_0000534_18101_19900 | 544 |
| 636 | 3300048917 | Ga0496114_0096124 | Ga0496114_0096124_646_2400 | 544 |
| 637 | 3300005339 | Ga0070660_100068251 | Ga0070660_1000682512 | 545 |
| 638 | 3300005436 | Ga0070713_100119942 | Ga0070713_1001199422 | 545 |
| 639 | 3300005617 | Ga0068859_100000049 | Ga0068859_100000049107 | 545 |
| 640 | 3300005844 | Ga0068862_100000200 | Ga0068862_10000020037 | 545 |
| 641 | 3300005985 | Ga0081539_10022964 | Ga0081539_100229643 | 545 |
| 642 | 3300006931 | Ga0097620_100000049 | Ga0097620_10000004917 | 545 |
| 643 | 3300009553 | Ga0105249_10004792 | Ga0105249_100047926 | 545 |
| 644 | 3300014325 | Ga0163163_10027387 | Ga0163163_100273872 | 545 |
| 645 | 3300025921 | Ga0207652_10015342 | Ga0207652_100153425 | 545 |
| 646 | 3300025929 | Ga0207664_10053802 | Ga0207664_100538022 | 545 |
| 647 | 3300025949 | Ga0207667_10188859 | Ga0207667_101888592 | 545 |
| 648 | 3300025961 | Ga0207712_10001330 | Ga0207712_1000133011 | 545 |
| 649 | 3300028380 | Ga0268265_10000041 | Ga0268265_1000004184 | 545 |
| 650 | 3300028573 | Ga0265334_10001270 | Ga0265334_100012706 | 545 |
| 651 | 3300032126 | Ga0307415_100001823 | Ga0307415_1000018234 | 545 |
| 652 | 3300035119 | Ga0373956_0003024 | Ga0373956_0003024_419_2185 | 545 |
| 653 | 3300035692 | Ga0373935_0084097 | Ga0373935_0084097_170_1936 | 545 |
| 654 | 3300044684 | Ga0466966_0014252 | Ga0466966_0014252_2743_4497 | 545 |
| 655 | 3300046536 | Ga0495587_0011319 | Ga0495587_0011319_899_2665 | 545 |
| 656 | 3300049578 | Ga0501042_0022632 | Ga0501042_0022632_980_2731 | 545 |
| 657 | 3300049591 | Ga0501075_0046828 | Ga0501075_0046828_376_2127 | 545 |
| 658 | 3300049592 | Ga0501076_0029686 | Ga0501076_0029686_108_1859 | 545 |
| 659 | 3300049593 | Ga0501077_0071265 | Ga0501077_0071265_162_1913 | 545 |
| 660 | 3300049741 | Ga0501079_0038310 | Ga0501079_0038310_461_2212 | 545 |
| 661 | 3300053136 | Ga0500559_0002339 | Ga0500559_0002339_4118_5818 | 545 |
| 662 | 3300061734 | Ga0530510_0082724 | Ga0530510_0082724_247_1998 | 545 |
| 663 | 3300006038 | Ga0075365_10012704 | Ga0075365_100127042 | 546 |
| 664 | 3300009098 | Ga0105245_10087168 | Ga0105245_100871681 | 546 |
| 665 | 3300020081 | Ga0206354_10551289 | Ga0206354_105512891 | 546 |
| 666 | 3300025906 | Ga0207699_10009598 | Ga0207699_100095982 | 546 |
| 667 | 3300025915 | Ga0207693_10042577 | Ga0207693_100425773 | 546 |
| 668 | 3300025928 | Ga0207700_10034015 | Ga0207700_100340152 | 546 |
| 669 | 3300025929 | Ga0207664_10072195 | Ga0207664_100721952 | 546 |
| 670 | 3300028794 | Ga0307515_10009209 | Ga0307515_1000920920 | 546 |
| 671 | 3300028800 | Ga0265338_10007550 | Ga0265338_1000755012 | 546 |
| 672 | 3300031731 | Ga0307405_10002105 | Ga0307405_100021057 | 546 |
| 673 | 3300031995 | Ga0307409_100031733 | Ga0307409_1000317333 | 546 |
| 674 | 3300032005 | Ga0307411_10042891 | Ga0307411_100428913 | 546 |
| 675 | 3300032126 | Ga0307415_100044246 | Ga0307415_1000442462 | 546 |
| 676 | 3300035410 | Ga0373924_0004378 | Ga0373924_0004378_2209_3975 | 546 |
| 677 | 3300044693 | Ga0466961_0049728 | Ga0466961_0049728_919_2664 | 546 |
| 678 | 3300046463 | Ga0495653_0035328 | Ga0495653_0035328_1171_2937 | 546 |
| 679 | 3300046511 | Ga0495608_0003322 | Ga0495608_0003322_8594_10360 | 546 |
| 680 | 3300046514 | Ga0495618_0010625 | Ga0495618_0010625_1886_3652 | 546 |
| 681 | 3300046543 | Ga0495645_0004299 | Ga0495645_0004299_5703_7445 | 546 |
| 682 | 3300046559 | Ga0495667_0002311 | Ga0495667_0002311_10618_12384 | 546 |
| 683 | 3300046663 | Ga0495635_0022760 | Ga0495635_0022760_1336_3102 | 546 |
| 684 | 3300046680 | Ga0495646_0036489 | Ga0495646_0036489_88_1854 | 546 |
| 685 | 3300046684 | Ga0495669_0021449 | Ga0495669_0021449_353_2107 | 546 |
| 686 | 3300046809 | Ga0495600_0016887 | Ga0495600_0016887_1197_2963 | 546 |
| 687 | 3300048924 | Ga0496121_0009318 | Ga0496121_0009318_2126_3847 | 546 |
| 688 | 3300048928 | Ga0496125_0001053 | Ga0496125_0001053_39549_41312 | 546 |
| 689 | 3300053085 | Ga0495619_0010924 | Ga0495619_0010924_1702_3468 | 546 |
| 690 | 3300014969 | Ga0157376_10013386 | Ga0157376_100133863 | 547 |
| 691 | 3300025944 | Ga0207661_10028912 | Ga0207661_100289122 | 547 |
| 692 | 3300044706 | Ga0466964_0003790 | Ga0466964_0003790_2167_3972 | 547 |
| 693 | 3300044842 | Ga0466957_0002915 | Ga0466957_0002915_3409_5214 | 547 |
| 694 | 3300045836 | Ga0466958_0000784 | Ga0466958_0000784_12074_13879 | 547 |
| 695 | 3300046454 | Ga0495592_0006662 | Ga0495592_0006662_6815_8557 | 547 |
| 696 | 3300046463 | Ga0495653_0001553 | Ga0495653_0001553_12033_13775 | 547 |
| 697 | 3300046471 | Ga0495650_0002733 | Ga0495650_0002733_8074_9834 | 547 |
| 698 | 3300046476 | Ga0495662_0003913 | Ga0495662_0003913_2455_4197 | 547 |
| 699 | 3300046511 | Ga0495608_0050312 | Ga0495608_0050312_855_2597 | 547 |
| 700 | 3300046516 | Ga0495628_0005418 | Ga0495628_0005418_2029_3771 | 547 |
| 701 | 3300046517 | Ga0495630_0004990 | Ga0495630_0004990_4171_5913 | 547 |
| 702 | 3300046526 | Ga0495666_0014640 | Ga0495666_0014640_1302_3044 | 547 |
| 703 | 3300046531 | Ga0495665_0001254 | Ga0495665_0001254_3094_4836 | 547 |
| 704 | 3300046533 | Ga0495640_0041777 | Ga0495640_0041777_1302_3044 | 547 |
| 705 | 3300046535 | Ga0495586_0022466 | Ga0495586_0022466_92_1834 | 547 |
| 706 | 3300046536 | Ga0495587_0003319 | Ga0495587_0003319_5861_7603 | 547 |
| 707 | 3300046543 | Ga0495645_0008837 | Ga0495645_0008837_3091_4833 | 547 |
| 708 | 3300046559 | Ga0495667_0019683 | Ga0495667_0019683_1957_3699 | 547 |
| 709 | 3300046642 | Ga0495634_0012977 | Ga0495634_0012977_441_2183 | 547 |
| 710 | 3300046675 | Ga0495657_0006450 | Ga0495657_0006450_29_1771 | 547 |
| 711 | 3300046678 | Ga0495599_0003579 | Ga0495599_0003579_1505_3247 | 547 |
| 712 | 3300046683 | Ga0495658_0055715 | Ga0495658_0055715_418_2181 | 547 |
| 713 | 3300046689 | Ga0495613_0003778 | Ga0495613_0003778_5886_7628 | 547 |
| 714 | 3300047315 | Ga0495581_0011966 | Ga0495581_0011966_3267_5009 | 547 |
| 715 | 3300047317 | Ga0495604_0000868 | Ga0495604_0000868_7839_9581 | 547 |
| 716 | 3300048910 | Ga0496107_0045741 | Ga0496107_0045741_1037_2800 | 547 |
| 717 | 3300049570 | Ga0501033_0040535 | Ga0501033_0040535_100_1821 | 547 |
| 718 | 3300049571 | Ga0501034_0027142 | Ga0501034_0027142_838_2631 | 547 |
| 719 | 3300049572 | Ga0501036_0064725 | Ga0501036_0064725_988_2781 | 547 |
| 720 | 3300049574 | Ga0501038_0002881 | Ga0501038_0002881_1633_3426 | 547 |
| 721 | 3300049576 | Ga0501040_0020484 | Ga0501040_0020484_2627_4390 | 547 |
| 722 | 3300049581 | Ga0501047_0055552 | Ga0501047_0055552_1633_3426 | 547 |
| 723 | 3300049583 | Ga0501067_0023000 | Ga0501067_0023000_572_2335 | 547 |
| 724 | 3300049822 | Ga0501035_0015452 | Ga0501035_0015452_1329_3122 | 547 |
| 725 | 3300049823 | Ga0501044_0009760 | Ga0501044_0009760_1489_3282 | 547 |
| 726 | 3300053077 | Ga0495601_0018005 | Ga0495601_0018005_101_1843 | 547 |
| 727 | 3300053093 | Ga0500651_0000093 | Ga0500651_0000093_42214_43944 | 547 |
| 728 | 3300053134 | Ga0500658_0000700 | Ga0500658_0000700_2888_4618 | 547 |
| 729 | 3300005327 | Ga0070658_10040342 | Ga0070658_100403423 | 548 |
| 730 | 3300005339 | Ga0070660_100077012 | Ga0070660_1000770121 | 548 |
| 731 | 3300005563 | Ga0068855_100220376 | Ga0068855_1002203761 | 548 |
| 732 | 3300005842 | Ga0068858_100000003 | Ga0068858_10000000333 | 548 |
| 733 | 3300014968 | Ga0157379_10001992 | Ga0157379_100019923 | 548 |
| 734 | 3300025909 | Ga0207705_10000001 | Ga0207705_100000011526 | 548 |
| 735 | 3300025919 | Ga0207657_10035487 | Ga0207657_100354872 | 548 |
| 736 | 3300025932 | Ga0207690_10019543 | Ga0207690_100195432 | 548 |
| 737 | 3300025949 | Ga0207667_10021231 | Ga0207667_100212313 | 548 |
| 738 | 3300026035 | Ga0207703_10000006 | Ga0207703_10000006111 | 548 |
| 739 | 3300028800 | Ga0265338_10013142 | Ga0265338_100131424 | 548 |
| 740 | 3300032002 | Ga0307416_100146689 | Ga0307416_1001466892 | 548 |
| 741 | 3300037418 | Ga0395900_0222184 | Ga0395900_0222184_86_1864 | 548 |
| 742 | 3300041494 | Ga0451837_0657235 | Ga0451837_0657235_1159_2922 | 548 |
| 743 | 3300044693 | Ga0466961_0049372 | Ga0466961_0049372_50_1819 | 548 |
| 744 | 3300045976 | Ga0466967_0016174 | Ga0466967_0016174_2544_4304 | 548 |
| 745 | 3300048904 | Ga0496101_0069423 | Ga0496101_0069423_735_2510 | 548 |
| 746 | 3300048905 | Ga0496102_0003371 | Ga0496102_0003371_3249_4997 | 548 |
| 747 | 3300048905 | Ga0496102_0016668 | Ga0496102_0016668_561_2294 | 548 |
| 748 | 3300048905 | Ga0496102_0045926 | Ga0496102_0045926_821_2596 | 548 |
| 749 | 3300048924 | Ga0496121_0008036 | Ga0496121_0008036_10594_12372 | 548 |
| 750 | 3300049586 | Ga0501070_0074806 | Ga0501070_0074806_234_2030 | 548 |
| 751 | 3300050494 | nmdc:mga06z11_1166_c1 | nmdc:mga06z11_1166_c1_7397_9172 | 548 |
| 752 | 3300050495 | nmdc:mga04h51_530_c1 | nmdc:mga04h51_530_c1_4578_6353 | 548 |
| 753 | 3300003578 | Ga0006562J51391_1053958 | Ga0006562J51391_10539582 | 549 |
| 754 | 3300005471 | Ga0070698_100001158 | Ga0070698_10000115820 | 549 |
| 755 | 3300006042 | Ga0075368_10004038 | Ga0075368_100040383 | 549 |
| 756 | 3300006048 | Ga0075363_100012544 | Ga0075363_1000125443 | 549 |
| 757 | 3300006846 | Ga0075430_100021990 | Ga0075430_1000219904 | 549 |
| 758 | 3300006847 | Ga0075431_100022382 | Ga0075431_1000223827 | 549 |
| 759 | 3300006852 | Ga0075433_10038687 | Ga0075433_100386871 | 549 |
| 760 | 3300006880 | Ga0075429_100100345 | Ga0075429_1001003452 | 549 |
| 761 | 3300009094 | Ga0111539_10020703 | Ga0111539_100207032 | 549 |
| 762 | 3300009147 | Ga0114129_10037355 | Ga0114129_100373552 | 549 |
| 763 | 3300009177 | Ga0105248_10000108 | Ga0105248_1000010824 | 549 |
| 764 | 3300025922 | Ga0207646_10046390 | Ga0207646_100463903 | 549 |
| 765 | 3300025927 | Ga0207687_10042757 | Ga0207687_100427571 | 549 |
| 766 | 3300025941 | Ga0207711_10000593 | Ga0207711_1000059320 | 549 |
| 767 | 3300027907 | Ga0207428_10021600 | Ga0207428_100216004 | 549 |
| 768 | 3300028563 | Ga0265319_1003061 | Ga0265319_10030615 | 549 |
| 769 | 3300028573 | Ga0265334_10000091 | Ga0265334_1000009130 | 549 |
| 770 | 3300028653 | Ga0265323_10005541 | Ga0265323_100055413 | 549 |
| 771 | 3300028800 | Ga0265338_10000233 | Ga0265338_1000023341 | 549 |
| 772 | 3300031240 | Ga0265320_10004172 | Ga0265320_100041726 | 549 |
| 773 | 3300031247 | Ga0265340_10007133 | Ga0265340_100071335 | 549 |
| 774 | 3300031249 | Ga0265339_10022542 | Ga0265339_100225423 | 549 |
| 775 | 3300031595 | Ga0265313_10016922 | Ga0265313_100169223 | 549 |
| 776 | 3300031711 | Ga0265314_10004372 | Ga0265314_100043724 | 549 |
| 777 | 3300044842 | Ga0466957_0002004 | Ga0466957_0002004_2643_4394 | 549 |
| 778 | 3300045836 | Ga0466958_0002002 | Ga0466958_0002002_566_2317 | 549 |
| 779 | 3300045976 | Ga0466967_0000237 | Ga0466967_0000237_7127_8878 | 549 |
| 780 | 3300048903 | Ga0496100_0009015 | Ga0496100_0009015_2478_4262 | 549 |
| 781 | 3300048903 | Ga0496100_0013346 | Ga0496100_0013346_1800_3584 | 549 |
| 782 | 3300048904 | Ga0496101_0018337 | Ga0496101_0018337_368_2152 | 549 |
| 783 | 3300048905 | Ga0496102_0013458 | Ga0496102_0013458_1492_3276 | 549 |
| 784 | 3300048907 | Ga0496104_0026269 | Ga0496104_0026269_565_2349 | 549 |
| 785 | 3300048907 | Ga0496104_0042691 | Ga0496104_0042691_521_2317 | 549 |
| 786 | 3300048908 | Ga0496105_0002299 | Ga0496105_0002299_3241_5025 | 549 |
| 787 | 3300048911 | Ga0496108_0011795 | Ga0496108_0011795_1650_3446 | 549 |
| 788 | 3300048912 | Ga0496109_0007565 | Ga0496109_0007565_3428_5224 | 549 |
| 789 | 3300048913 | Ga0496110_0006086 | Ga0496110_0006086_2680_4476 | 549 |
| 790 | 3300048913 | Ga0496110_0136298 | Ga0496110_0136298_58_1842 | 549 |
| 791 | 3300048917 | Ga0496114_0008469 | Ga0496114_0008469_3565_5349 | 549 |
| 792 | 3300050492 | nmdc:mga0yw44_26353_c1 | nmdc:mga0yw44_26353_c1_1213_2982 | 549 |
| 793 | 3300050492 | nmdc:mga0yw44_34279_c1 | nmdc:mga0yw44_34279_c1_269_2041 | 549 |
| 794 | 3300050494 | nmdc:mga06z11_4395_c1 | nmdc:mga06z11_4395_c1_427_2247 | 549 |
| 795 | 3300050507 | nmdc:mga05p37_2661_c1 | nmdc:mga05p37_2661_c1_13426_15186 | 549 |
| 796 | 3300050509 | nmdc:mga0qj67_12131_c1 | nmdc:mga0qj67_12131_c1_2605_4365 | 549 |
| 797 | 3300050510 | nmdc:mga06r32_288_c1 | nmdc:mga06r32_288_c1_37197_38957 | 549 |
| 798 | 3300050511 | nmdc:mga08y16_54408_c1 | nmdc:mga08y16_54408_c1_742_2502 | 549 |
| 799 | 3300053088 | Ga0500644_0005730 | Ga0500644_0005730_136_1917 | 549 |
| 800 | iso_pu_bacteria | 8053945823 | 8053948065 | 549 |
| 801 | 3300001989 | JGI24739J22299_10003636 | JGI24739J22299_100036363 | 550 |
| 802 | 3300005329 | Ga0070683_100026289 | Ga0070683_1000262893 | 550 |
| 803 | 3300005467 | Ga0070706_100001268 | Ga0070706_10000126812 | 550 |
| 804 | 3300005614 | Ga0068856_100036826 | Ga0068856_1000368264 | 550 |
| 805 | 3300005616 | Ga0068852_100064681 | Ga0068852_1000646813 | 550 |
| 806 | 3300005616 | Ga0068852_100126261 | Ga0068852_1001262612 | 550 |
| 807 | 3300005843 | Ga0068860_100000286 | Ga0068860_10000028618 | 550 |
| 808 | 3300006038 | Ga0075365_10014987 | Ga0075365_100149873 | 550 |
| 809 | 3300006048 | Ga0075363_100000523 | Ga0075363_1000005236 | 550 |
| 810 | 3300006051 | Ga0075364_10003312 | Ga0075364_100033122 | 550 |
| 811 | 3300006178 | Ga0075367_10034800 | Ga0075367_100348002 | 550 |
| 812 | 3300006353 | Ga0075370_10015790 | Ga0075370_100157902 | 550 |
| 813 | 3300009093 | Ga0105240_10037482 | Ga0105240_100374825 | 550 |
| 814 | 3300009147 | Ga0114129_10032099 | Ga0114129_100320995 | 550 |
| 815 | 3300009553 | Ga0105249_10095806 | Ga0105249_100958062 | 550 |
| 816 | 3300010375 | Ga0105239_10036954 | Ga0105239_100369545 | 550 |
| 817 | 3300025910 | Ga0207684_10003330 | Ga0207684_1000333011 | 550 |
| 818 | 3300025913 | Ga0207695_10034932 | Ga0207695_100349323 | 550 |
| 819 | 3300025920 | Ga0207649_10043813 | Ga0207649_100438131 | 550 |
| 820 | 3300025933 | Ga0207706_10091931 | Ga0207706_100919312 | 550 |
| 821 | 3300026078 | Ga0207702_10016001 | Ga0207702_100160015 | 550 |
| 822 | 3300026142 | Ga0207698_10134565 | Ga0207698_101345652 | 550 |
| 823 | 3300028379 | Ga0268266_10135855 | Ga0268266_101358552 | 550 |
| 824 | 3300028381 | Ga0268264_10000246 | Ga0268264_1000024617 | 550 |
| 825 | 3300031901 | Ga0307406_10040519 | Ga0307406_100405192 | 550 |
| 826 | 3300036401 | Ga0373937_0070358 | Ga0373937_0070358_1320_3110 | 550 |
| 827 | 3300044684 | Ga0466966_0027234 | Ga0466966_0027234_1813_3576 | 550 |
| 828 | 3300044765 | Ga0466970_0000767 | Ga0466970_0000767_2231_4033 | 550 |
| 829 | 3300045049 | Ga0466959_0047755 | Ga0466959_0047755_1175_2938 | 550 |
| 830 | 3300045976 | Ga0466967_0009642 | Ga0466967_0009642_3550_5304 | 550 |
| 831 | 3300045976 | Ga0466967_0137789 | Ga0466967_0137789_396_2156 | 550 |
| 832 | 3300046462 | Ga0495651_0002692 | Ga0495651_0002692_1899_3689 | 550 |
| 833 | 3300046463 | Ga0495653_0009782 | Ga0495653_0009782_4431_6221 | 550 |
| 834 | 3300046529 | Ga0495652_0014752 | Ga0495652_0014752_668_2458 | 550 |
| 835 | 3300046536 | Ga0495587_0055243 | Ga0495587_0055243_439_2229 | 550 |
| 836 | 3300046559 | Ga0495667_0004000 | Ga0495667_0004000_1521_3311 | 550 |
| 837 | 3300047317 | Ga0495604_0037243 | Ga0495604_0037243_1580_3370 | 550 |
| 838 | 3300047319 | Ga0495674_0049212 | Ga0495674_0049212_1782_3572 | 550 |
| 839 | 3300047320 | Ga0495672_0009497 | Ga0495672_0009497_2595_4364 | 550 |
| 840 | 3300047322 | Ga0495680_0002145 | Ga0495680_0002145_7025_8815 | 550 |
| 841 | 3300047471 | Ga0495684_0074495 | Ga0495684_0074495_642_2432 | 550 |
| 842 | 3300048921 | Ga0496118_0006742 | Ga0496118_0006742_7445_9175 | 550 |
| 843 | 3300048922 | Ga0496119_0000104 | Ga0496119_0000104_21160_22920 | 550 |
| 844 | 3300048923 | Ga0496120_0008685 | Ga0496120_0008685_2590_4350 | 550 |
| 845 | 3300048929 | Ga0496126_0028309 | Ga0496126_0028309_1382_3133 | 550 |
| 846 | 3300049822 | Ga0501035_0085250 | Ga0501035_0085250_459_2219 | 550 |
| 847 | 3300050490 | nmdc:mga03n38_2040_c1 | nmdc:mga03n38_2040_c1_3826_5673 | 550 |
| 848 | 3300050491 | nmdc:mga00v17_11769_c1 | nmdc:mga00v17_11769_c1_222_2009 | 550 |
| 849 | 3300050491 | nmdc:mga00v17_4667_c1 | nmdc:mga00v17_4667_c1_2910_4757 | 550 |
| 850 | 3300050492 | nmdc:mga0yw44_50487_c1 | nmdc:mga0yw44_50487_c1_132_1916 | 550 |
| 851 | 3300050494 | nmdc:mga06z11_34918_c1 | nmdc:mga06z11_34918_c1_279_2126 | 550 |
| 852 | 3300050496 | nmdc:mga07m45_28936_c1 | nmdc:mga07m45_28936_c1_131_1978 | 550 |
| 853 | 3300053084 | Ga0495595_0032678 | Ga0495595_0032678_476_2266 | 550 |
| 854 | 3300053085 | Ga0495619_0021621 | Ga0495619_0021621_706_2496 | 550 |
| 855 | 3300053088 | Ga0500644_0002035 | Ga0500644_0002035_1838_3661 | 550 |
| 856 | 3300003578 | Ga0006562J51391_1099265 | Ga0006562J51391_10992652 | 551 |
| 857 | 3300003578 | Ga0006562J51391_1099266 | Ga0006562J51391_10992661 | 551 |
| 858 | 3300003761 | Ga0055535_1000522 | Ga0055535_100052226 | 551 |
| 859 | 3300003762 | Ga0055542_1000003 | Ga0055542_100000381 | 551 |
| 860 | 3300003771 | Ga0055526_1014173 | Ga0055526_10141732 | 551 |
| 861 | 3300003775 | Ga0055524_1013525 | Ga0055524_10135252 | 551 |
| 862 | 3300003781 | Ga0055536_1001522 | Ga0055536_10015224 | 551 |
| 863 | 3300003784 | Ga0055534_1006353 | Ga0055534_10063532 | 551 |
| 864 | 3300003792 | Ga0055540_1001603 | Ga0055540_10016039 | 551 |
| 865 | 3300005347 | Ga0070668_100075630 | Ga0070668_1000756302 | 551 |
| 866 | 3300009101 | Ga0105247_10000016 | Ga0105247_10000016113 | 551 |
| 867 | 3300009101 | Ga0105247_10001447 | Ga0105247_100014477 | 551 |
| 868 | 3300009177 | Ga0105248_10000890 | Ga0105248_1000089016 | 551 |
| 869 | 3300013102 | Ga0157371_10114335 | Ga0157371_101143352 | 551 |
| 870 | 3300013306 | Ga0163162_10096158 | Ga0163162_100961583 | 551 |
| 871 | 3300025208 | Ga0209436_104146 | Ga0209436_1041462 | 551 |
| 872 | 3300025228 | Ga0209672_101287 | Ga0209672_1012873 | 551 |
| 873 | 3300025229 | Ga0209147_100657 | Ga0209147_1006579 | 551 |
| 874 | 3300025242 | Ga0209258_100015 | Ga0209258_100015200 | 551 |
| 875 | 3300025254 | Ga0209148_1000028 | Ga0209148_1000028468 | 551 |
| 876 | 3300025263 | Ga0209565_1003093 | Ga0209565_10030932 | 551 |
| 877 | 3300025273 | Ga0209673_1001483 | Ga0209673_100148316 | 551 |
| 878 | 3300025284 | Ga0209130_1004840 | Ga0209130_10048403 | 551 |
| 879 | 3300025291 | Ga0209675_1005987 | Ga0209675_10059872 | 551 |
| 880 | 3300025292 | Ga0209676_1000209 | Ga0209676_100020938 | 551 |
| 881 | 3300025295 | Ga0209564_1004997 | Ga0209564_10049974 | 551 |
| 882 | 3300025299 | Ga0209256_1000304 | Ga0209256_100030420 | 551 |
| 883 | 3300025302 | Ga0207426_1000130 | Ga0207426_1000130192 | 551 |
| 884 | 3300025303 | Ga0209051_1000156 | Ga0209051_100015675 | 551 |
| 885 | 3300025321 | Ga0207656_10026211 | Ga0207656_100262112 | 551 |
| 886 | 3300025900 | Ga0207710_10000017 | Ga0207710_10000017221 | 551 |
| 887 | 3300025900 | Ga0207710_10000062 | Ga0207710_1000006228 | 551 |
| 888 | 3300025941 | Ga0207711_10001430 | Ga0207711_100014303 | 551 |
| 889 | 3300030521 | Ga0307511_10008735 | Ga0307511_1000873512 | 551 |
| 890 | 3300031507 | Ga0307509_10188955 | Ga0307509_101889551 | 551 |
| 891 | 3300031730 | Ga0307516_10093837 | Ga0307516_100938371 | 551 |
| 892 | 3300037418 | Ga0395900_0060860 | Ga0395900_0060860_2024_3808 | 551 |
| 893 | 3300037466 | Ga0395898_0108430 | Ga0395898_0108430_838_2622 | 551 |
| 894 | 3300038735 | Ga0400485_06792 | Ga0400485_06792_8606_10405 | 551 |
| 895 | 3300038742 | Ga0400486_28029 | Ga0400486_28029_18257_20056 | 551 |
| 896 | 3300039437 | Ga0436365_0033839 | Ga0436365_0033839_4036_5796 | 551 |
| 897 | 3300044901 | Ga0466960_0010726 | Ga0466960_0010726_1428_3158 | 551 |
| 898 | 3300045976 | Ga0466967_0133703 | Ga0466967_0133703_354_2186 | 551 |
| 899 | 3300046455 | Ga0495603_0004938 | Ga0495603_0004938_5316_7088 | 551 |
| 900 | 3300047315 | Ga0495581_0085038 | Ga0495581_0085038_28_1800 | 551 |
| 901 | 3300047443 | Ga0495687_023466 | Ga0495687_023466_1133_2905 | 551 |
| 902 | 3300048922 | Ga0496119_0003294 | Ga0496119_0003294_592_2376 | 551 |
| 903 | 3300048923 | Ga0496120_0000050 | Ga0496120_0000050_139329_141113 | 551 |
| 904 | 3300049568 | Ga0501031_0014136 | Ga0501031_0014136_86_1876 | 551 |
| 905 | 3300049572 | Ga0501036_0025584 | Ga0501036_0025584_290_2080 | 551 |
| 906 | 3300049573 | Ga0501037_0029094 | Ga0501037_0029094_121_1911 | 551 |
| 907 | 3300049574 | Ga0501038_0073731 | Ga0501038_0073731_810_2546 | 551 |
| 908 | 3300049574 | Ga0501038_0128080 | Ga0501038_0128080_235_2025 | 551 |
| 909 | 3300049575 | Ga0501039_0096230 | Ga0501039_0096230_241_2031 | 551 |
| 910 | 3300049577 | Ga0501041_0029039 | Ga0501041_0029039_564_2354 | 551 |
| 911 | 3300049579 | Ga0501043_0010923 | Ga0501043_0010923_4865_6601 | 551 |
| 912 | 3300049583 | Ga0501067_0004752 | Ga0501067_0004752_3230_5008 | 551 |
| 913 | 3300049587 | Ga0501071_0002715 | Ga0501071_0002715_2509_4299 | 551 |
| 914 | 3300049589 | Ga0501073_0118326 | Ga0501073_0118326_68_1804 | 551 |
| 915 | 3300049590 | Ga0501074_0050534 | Ga0501074_0050534_1077_2867 | 551 |
| 916 | 3300049741 | Ga0501079_0037016 | Ga0501079_0037016_1279_3057 | 551 |
| 917 | 3300049741 | Ga0501079_0100595 | Ga0501079_0100595_317_2107 | 551 |
| 918 | 3300049742 | Ga0501080_0002592 | Ga0501080_0002592_2079_3857 | 551 |
| 919 | 3300049742 | Ga0501080_0133129 | Ga0501080_0133129_197_1987 | 551 |
| 920 | 3300049822 | Ga0501035_0033775 | Ga0501035_0033775_2793_4583 | 551 |
| 921 | 3300049823 | Ga0501044_0108832 | Ga0501044_0108832_316_2052 | 551 |
| 922 | 3300050492 | nmdc:mga0yw44_29266_c1 | nmdc:mga0yw44_29266_c1_822_2618 | 551 |
| 923 | 3300050492 | nmdc:mga0yw44_9237_c1 | nmdc:mga0yw44_9237_c1_2043_3809 | 551 |
| 924 | 3300053087 | Ga0500643_000575 | Ga0500643_000575_1342_3093 | 551 |
| 925 | 3300060353 | Ga0501082_0016270 | Ga0501082_0016270_2551_4329 | 551 |
| 926 | 3300060353 | Ga0501082_0033651 | Ga0501082_0033651_2554_4344 | 551 |
| 927 | 3300061734 | Ga0530510_0096693 | Ga0530510_0096693_178_1968 | 551 |
| 928 | iso_pu_bacteria | 2891395885 | 2891401705 | 551 |
| 929 | 3300003781 | Ga0055536_1002089 | Ga0055536_10020893 | 552 |
| 930 | 3300003791 | Ga0055530_10000773 | Ga0055530_100007737 | 552 |
| 931 | 3300003794 | Ga0055531_10016147 | Ga0055531_100161472 | 552 |
| 932 | 3300005327 | Ga0070658_10001484 | Ga0070658_1000148418 | 552 |
| 933 | 3300005841 | Ga0068863_100000604 | Ga0068863_1000006043 | 552 |
| 934 | 3300005842 | Ga0068858_100013685 | Ga0068858_1000136855 | 552 |
| 935 | 3300013104 | Ga0157370_10027475 | Ga0157370_100274754 | 552 |
| 936 | 3300013308 | Ga0157375_10113808 | Ga0157375_101138082 | 552 |
| 937 | 3300020069 | Ga0197907_10217434 | Ga0197907_102174342 | 552 |
| 938 | 3300020080 | Ga0206350_10893355 | Ga0206350_108933552 | 552 |
| 939 | 3300025245 | Ga0207425_1011324 | Ga0207425_10113242 | 552 |
| 940 | 3300025263 | Ga0209565_1002407 | Ga0209565_10024076 | 552 |
| 941 | 3300025292 | Ga0209676_1000074 | Ga0209676_1000074269 | 552 |
| 942 | 3300025298 | Ga0209050_1000015 | Ga0209050_1000015201 | 552 |
| 943 | 3300025303 | Ga0209051_1000010 | Ga0209051_1000010201 | 552 |
| 944 | 3300025304 | Ga0209257_1000026 | Ga0209257_1000026476 | 552 |
| 945 | 3300025909 | Ga0207705_10070691 | Ga0207705_100706912 | 552 |
| 946 | 3300026041 | Ga0207639_10096701 | Ga0207639_100967012 | 552 |
| 947 | 3300026088 | Ga0207641_10000357 | Ga0207641_1000035733 | 552 |
| 948 | 3300028556 | Ga0265337_1000031 | Ga0265337_100003114 | 552 |
| 949 | 3300031238 | Ga0265332_10000006 | Ga0265332_10000006264 | 552 |
| 950 | 3300031239 | Ga0265328_10013552 | Ga0265328_100135522 | 552 |
| 951 | 3300031903 | Ga0307407_10010042 | Ga0307407_100100423 | 552 |
| 952 | 3300044765 | Ga0466970_0021539 | Ga0466970_0021539_1048_2853 | 552 |
| 953 | 3300045976 | Ga0466967_0172165 | Ga0466967_0172165_14_1810 | 552 |
| 954 | 3300046457 | Ga0495590_0000227 | Ga0495590_0000227_20073_21848 | 552 |
| 955 | 3300046459 | Ga0495629_0042180 | Ga0495629_0042180_1095_2870 | 552 |
| 956 | 3300047317 | Ga0495604_0055044 | Ga0495604_0055044_210_1973 | 552 |
| 957 | 3300048908 | Ga0496105_0062127 | Ga0496105_0062127_467_2326 | 552 |
| 958 | 3300048919 | Ga0496116_0000192 | Ga0496116_0000192_68735_70504 | 552 |
| 959 | 3300048920 | Ga0496117_0005959 | Ga0496117_0005959_9899_11668 | 552 |
| 960 | 3300048920 | Ga0496117_0010513 | Ga0496117_0010513_6632_8362 | 552 |
| 961 | 3300048921 | Ga0496118_0000593 | Ga0496118_0000593_31079_32848 | 552 |
| 962 | 3300048922 | Ga0496119_0058054 | Ga0496119_0058054_216_1985 | 552 |
| 963 | 3300048924 | Ga0496121_0008771 | Ga0496121_0008771_3077_4816 | 552 |
| 964 | 3300048925 | Ga0496122_0000115 | Ga0496122_0000115_48049_49788 | 552 |
| 965 | 3300048925 | Ga0496122_0049741 | Ga0496122_0049741_49_1827 | 552 |
| 966 | 3300048926 | Ga0496123_0000129 | Ga0496123_0000129_11802_13541 | 552 |
| 967 | 3300048928 | Ga0496125_0025264 | Ga0496125_0025264_2520_4259 | 552 |
| 968 | 3300049568 | Ga0501031_0015152 | Ga0501031_0015152_2686_4446 | 552 |
| 969 | 3300049569 | Ga0501032_0008948 | Ga0501032_0008948_2267_4027 | 552 |
| 970 | 3300049569 | Ga0501032_0047639 | Ga0501032_0047639_479_2236 | 552 |
| 971 | 3300049574 | Ga0501038_0001784 | Ga0501038_0001784_4513_6273 | 552 |
| 972 | 3300049575 | Ga0501039_0026880 | Ga0501039_0026880_1730_3490 | 552 |
| 973 | 3300049581 | Ga0501047_0007990 | Ga0501047_0007990_4721_6481 | 552 |
| 974 | 3300049582 | Ga0501048_0000423 | Ga0501048_0000423_13683_15443 | 552 |
| 975 | 3300049586 | Ga0501070_0014476 | Ga0501070_0014476_3406_5166 | 552 |
| 976 | 3300049822 | Ga0501035_0008273 | Ga0501035_0008273_5744_7504 | 552 |
| 977 | 3300049823 | Ga0501044_0056557 | Ga0501044_0056557_795_2555 | 552 |
| 978 | 3300053080 | Ga0500635_0000004 | Ga0500635_0000004_82378_84141 | 552 |
| 979 | 3300053104 | Ga0500556_0000560 | Ga0500556_0000560_2600_4384 | 552 |
| 980 | iso_pu_bacteria | 2873314349 | 2873321972 | 552 |
| 981 | iso_pu_bacteria | 2895427314 | 2895428900 | 552 |
| 982 | iso_pu_bacteria | 2984568884 | 2984570295 | 552 |
| 983 | 3300005437 | Ga0070710_10047928 | Ga0070710_100479282 | 553 |
| 984 | 3300005439 | Ga0070711_100073680 | Ga0070711_1000736802 | 553 |
| 985 | 3300005937 | Ga0081455_10015373 | Ga0081455_100153732 | 553 |
| 986 | 3300009177 | Ga0105248_10014121 | Ga0105248_100141212 | 553 |
| 987 | 3300025898 | Ga0207692_10024588 | Ga0207692_100245882 | 553 |
| 988 | 3300025916 | Ga0207663_10063777 | Ga0207663_100637772 | 553 |
| 989 | 3300025939 | Ga0207665_10003060 | Ga0207665_100030603 | 553 |
| 990 | 3300025941 | Ga0207711_10018109 | Ga0207711_100181092 | 553 |
| 991 | 3300030733 | Ga0314311_1181306 | Ga0314311_11813061 | 553 |
| 992 | 3300031616 | Ga0307508_10005673 | Ga0307508_1000567310 | 553 |
| 993 | 3300037466 | Ga0395898_0099706 | Ga0395898_0099706_670_2445 | 553 |
| 994 | 3300038443 | Ga0395901_0004916 | Ga0395901_0004916_8930_10705 | 553 |
| 995 | 3300044658 | Ga0466972_0002348 | Ga0466972_0002348_4267_6033 | 553 |
| 996 | 3300044842 | Ga0466957_0003511 | Ga0466957_0003511_4285_6051 | 553 |
| 997 | 3300044842 | Ga0466957_0051141 | Ga0466957_0051141_222_2024 | 553 |
| 998 | 3300045049 | Ga0466959_0003447 | Ga0466959_0003447_2698_4464 | 553 |
| 999 | 3300045976 | Ga0466967_0010619 | Ga0466967_0010619_3433_5247 | 553 |
| 1000 | 3300046683 | Ga0495658_0072858 | Ga0495658_0072858_185_1945 | 553 |
| 1001 | 3300048914 | Ga0496111_0023458 | Ga0496111_0023458_1289_3043 | 553 |
| 1002 | 3300048915 | Ga0496112_0084481 | Ga0496112_0084481_1192_2946 | 553 |
| 1003 | 3300048920 | Ga0496117_0003700 | Ga0496117_0003700_5585_7363 | 553 |
| 1004 | 3300048921 | Ga0496118_0000240 | Ga0496118_0000240_51255_53033 | 553 |
| 1005 | 3300048927 | Ga0496124_0000070 | Ga0496124_0000070_97952_99730 | 553 |
| 1006 | 3300049744 | Ga0501083_0026752 | Ga0501083_0026752_125_1903 | 553 |
| 1007 | iso_pu_bacteria | 2862382967 | 2862388201 | 553 |
| 1008 | 3300001989 | JGI24739J22299_10023236 | JGI24739J22299_100232362 | 554 |
| 1009 | 3300001990 | JGI24737J22298_10002216 | JGI24737J22298_100022168 | 554 |
| 1010 | 3300002773 | JGI25152J39213_1003304 | JGI25152J39213_10033043 | 554 |
| 1011 | 3300002987 | JGI25159J45721_1007018 | JGI25159J45721_10070182 | 554 |
| 1012 | 3300003187 | JGI25151J46595_10007031 | JGI25151J46595_100070313 | 554 |
| 1013 | 3300003215 | JGI25153J46596_10007089 | JGI25153J46596_100070893 | 554 |
| 1014 | 3300003354 | JGI25160J50197_1010761 | JGI25160J50197_10107612 | 554 |
| 1015 | 3300003374 | JGI25161J50226_1002092 | JGI25161J50226_10020924 | 554 |
| 1016 | 3300003771 | Ga0055526_1014242 | Ga0055526_10142422 | 554 |
| 1017 | 3300003773 | Ga0055537_1006217 | Ga0055537_10062172 | 554 |
| 1018 | 3300003775 | Ga0055524_1013538 | Ga0055524_10135382 | 554 |
| 1019 | 3300003784 | Ga0055534_1007404 | Ga0055534_10074041 | 554 |
| 1020 | 3300003794 | Ga0055531_10017628 | Ga0055531_100176282 | 554 |
| 1021 | 3300004625 | Ga0055543_1001840 | Ga0055543_10018403 | 554 |
| 1022 | 3300005262 | Ga0065165_1007043 | Ga0065165_10070433 | 554 |
| 1023 | 3300005548 | Ga0070665_100016627 | Ga0070665_1000166275 | 554 |
| 1024 | 3300006847 | Ga0075431_100004927 | Ga0075431_1000049272 | 554 |
| 1025 | 3300011119 | Ga0105246_10011718 | Ga0105246_100117183 | 554 |
| 1026 | 3300025245 | Ga0207425_1000229 | Ga0207425_100022919 | 554 |
| 1027 | 3300025258 | Ga0209129_1000049 | Ga0209129_1000049204 | 554 |
| 1028 | 3300025263 | Ga0209565_1001437 | Ga0209565_10014373 | 554 |
| 1029 | 3300025272 | Ga0209455_1002176 | Ga0209455_10021764 | 554 |
| 1030 | 3300025273 | Ga0209673_1005158 | Ga0209673_10051583 | 554 |
| 1031 | 3300025284 | Ga0209130_1000974 | Ga0209130_100097420 | 554 |
| 1032 | 3300025291 | Ga0209675_1002160 | Ga0209675_10021603 | 554 |
| 1033 | 3300025294 | Ga0209025_1001092 | Ga0209025_10010923 | 554 |
| 1034 | 3300025295 | Ga0209564_1005012 | Ga0209564_10050123 | 554 |
| 1035 | 3300025297 | Ga0209758_1000496 | Ga0209758_100049646 | 554 |
| 1036 | 3300025299 | Ga0209256_1000264 | Ga0209256_100026420 | 554 |
| 1037 | 3300025302 | Ga0207426_1000108 | Ga0207426_1000108210 | 554 |
| 1038 | 3300025304 | Ga0209257_1003207 | Ga0209257_10032072 | 554 |
| 1039 | 3300037853 | Ga0436364_0220436 | Ga0436364_0220436_162_1949 | 554 |
| 1040 | 3300044658 | Ga0466972_0016390 | Ga0466972_0016390_1184_2947 | 554 |
| 1041 | 3300045976 | Ga0466967_0015286 | Ga0466967_0015286_1052_2839 | 554 |
| 1042 | 3300049569 | Ga0501032_0014495 | Ga0501032_0014495_2502_4472 | 554 |
| 1043 | 3300049570 | Ga0501033_0080555 | Ga0501033_0080555_272_2227 | 554 |
| 1044 | 3300049573 | Ga0501037_0043544 | Ga0501037_0043544_145_2100 | 554 |
| 1045 | 3300049574 | Ga0501038_0007061 | Ga0501038_0007061_228_2183 | 554 |
| 1046 | 3300049575 | Ga0501039_0010500 | Ga0501039_0010500_1411_3381 | 554 |
| 1047 | 3300049576 | Ga0501040_0047020 | Ga0501040_0047020_279_2048 | 554 |
| 1048 | 3300049579 | Ga0501043_0020300 | Ga0501043_0020300_2663_4633 | 554 |
| 1049 | 3300049580 | Ga0501046_0000280 | Ga0501046_0000280_49270_51240 | 554 |
| 1050 | 3300049586 | Ga0501070_0024551 | Ga0501070_0024551_1765_3735 | 554 |
| 1051 | 3300049587 | Ga0501071_0060812 | Ga0501071_0060812_548_2317 | 554 |
| 1052 | 3300049742 | Ga0501080_0046767 | Ga0501080_0046767_164_2134 | 554 |
| 1053 | 3300050510 | nmdc:mga06r32_11849_c1 | nmdc:mga06r32_11849_c1_4982_6754 | 554 |
| 1054 | 3300053110 | Ga0500571_000456 | Ga0500571_000456_3440_5170 | 554 |
| 1055 | iso_pu_bacteria | 2643221587 | 2643941768 | 554 |
| 1056 | iso_pu_bacteria | 2643221670 | 2644385806 | 554 |
| 1057 | iso_pu_bacteria | 2643221677 | 2644428851 | 554 |
| 1058 | iso_pu_bacteria | 2856741275 | 2856745239 | 554 |
| 1059 | iso_pu_bacteria | 2884693830 | 2884695077 | 554 |
| 1060 | iso_pu_bacteria | 2891562705 | 2891567149 | 554 |
| 1061 | iso_pu_bacteria | 2895442618 | 2895446239 | 554 |
| 1062 | iso_pu_bacteria | 2918501144 | 2918506048 | 554 |
| 1063 | iso_pu_bacteria | 8048356638 | 8048360616 | 554 |
| 1064 | iso_pu_bacteria | 8048369669 | 8048375241 | 554 |
| 1065 | iso_pu_bacteria | 8048379754 | 8048382964 | 554 |
| 1066 | 3300005366 | Ga0070659_100000513 | Ga0070659_10000051329 | 555 |
| 1067 | 3300005937 | Ga0081455_10033912 | Ga0081455_100339123 | 555 |
| 1068 | 3300013105 | Ga0157369_10179529 | Ga0157369_101795292 | 555 |
| 1069 | 3300025922 | Ga0207646_10045671 | Ga0207646_100456714 | 555 |
| 1070 | 3300025932 | Ga0207690_10000189 | Ga0207690_100001894 | 555 |
| 1071 | 3300028379 | Ga0268266_10005786 | Ga0268266_100057867 | 555 |
| 1072 | 3300044656 | Ga0466969_0003237 | Ga0466969_0003237_1135_2907 | 555 |
| 1073 | 3300044658 | Ga0466972_0008717 | Ga0466972_0008717_3144_4916 | 555 |
| 1074 | 3300044693 | Ga0466961_0011269 | Ga0466961_0011269_2323_4095 | 555 |
| 1075 | 3300044719 | Ga0466971_0019127 | Ga0466971_0019127_1196_2968 | 555 |
| 1076 | 3300044735 | Ga0466968_0020101 | Ga0466968_0020101_423_2195 | 555 |
| 1077 | 3300045049 | Ga0466959_0046007 | Ga0466959_0046007_1214_2986 | 555 |
| 1078 | 3300045976 | Ga0466967_0117740 | Ga0466967_0117740_78_1880 | 555 |
| 1079 | 3300045976 | Ga0466967_0144086 | Ga0466967_0144086_11_1816 | 555 |
| 1080 | 3300048905 | Ga0496102_0116897 | Ga0496102_0116897_675_2465 | 555 |
| 1081 | 3300048919 | Ga0496116_0001646 | Ga0496116_0001646_19167_20906 | 555 |
| 1082 | 3300048928 | Ga0496125_0008173 | Ga0496125_0008173_968_2692 | 555 |
| 1083 | 3300049570 | Ga0501033_0006828 | Ga0501033_0006828_2928_4709 | 555 |
| 1084 | 3300053133 | Ga0500655_000269 | Ga0500655_000269_1822_3552 | 555 |
| 1085 | 3300061719 | Ga0466962_0028361 | Ga0466962_0028361_220_1992 | 555 |
| 1086 | iso_pu_bacteria | 2582581312 | 2585296142 | 555 |
| 1087 | iso_pu_bacteria | 2616644941 | 2616903016 | 555 |
| 1088 | iso_pu_bacteria | 2643221578 | 2643903166 | 555 |
| 1089 | iso_pu_bacteria | 2643221673 | 2644404323 | 555 |
| 1090 | iso_pu_bacteria | 2643221682 | 2644461953 | 555 |
| 1091 | iso_pu_bacteria | 2808606982 | 2811844863 | 555 |
| 1092 | iso_pu_bacteria | 2818991463 | 2819695030 | 555 |
| 1093 | iso_pu_bacteria | 2862178590 | 2862185099 | 555 |
| 1094 | iso_pu_bacteria | 2862574272 | 2862577937 | 555 |
| 1095 | iso_pu_bacteria | 2867369537 | 2867373416 | 555 |
| 1096 | iso_pu_bacteria | 2891554331 | 2891554782 | 555 |
| 1097 | iso_pu_bacteria | 2946045630 | 2946048353 | 555 |
| 1098 | iso_pu_bacteria | 2966598605 | 2966601257 | 555 |
| 1099 | iso_pu_bacteria | 8025530807 | 8025532407 | 555 |
| 1100 | iso_pu_bacteria | 8056060235 | 8056065213 | 555 |
| 1101 | iso_pu_bacteria | 8056667051 | 8056670735 | 555 |
| 1102 | 3300005327 | Ga0070658_10016932 | Ga0070658_100169324 | 556 |
| 1103 | 3300005435 | Ga0070714_100008719 | Ga0070714_1000087192 | 556 |
| 1104 | 3300005436 | Ga0070713_100010863 | Ga0070713_1000108632 | 556 |
| 1105 | 3300005445 | Ga0070708_100051587 | Ga0070708_1000515873 | 556 |
| 1106 | 3300005577 | Ga0068857_100040492 | Ga0068857_1000404922 | 556 |
| 1107 | 3300005616 | Ga0068852_100002359 | Ga0068852_10000235911 | 556 |
| 1108 | 3300005834 | Ga0068851_10000001 | Ga0068851_10000001218 | 556 |
| 1109 | 3300006058 | Ga0075432_10000101 | Ga0075432_1000010110 | 556 |
| 1110 | 3300006852 | Ga0075433_10000832 | Ga0075433_100008328 | 556 |
| 1111 | 3300006871 | Ga0075434_100000238 | Ga0075434_10000023826 | 556 |
| 1112 | 3300006914 | Ga0075436_100002267 | Ga0075436_1000022677 | 556 |
| 1113 | 3300007076 | Ga0075435_100003528 | Ga0075435_1000035286 | 556 |
| 1114 | 3300009093 | Ga0105240_10000538 | Ga0105240_1000053814 | 556 |
| 1115 | 3300009094 | Ga0111539_10000095 | Ga0111539_100000957 | 556 |
| 1116 | 3300009174 | Ga0105241_10000768 | Ga0105241_100007686 | 556 |
| 1117 | 3300009545 | Ga0105237_10001702 | Ga0105237_100017027 | 556 |
| 1118 | 3300025254 | Ga0209148_1003774 | Ga0209148_10037743 | 556 |
| 1119 | 3300025321 | Ga0207656_10000002 | Ga0207656_10000002709 | 556 |
| 1120 | 3300025911 | Ga0207654_10000001 | Ga0207654_100000011171 | 556 |
| 1121 | 3300025913 | Ga0207695_10012810 | Ga0207695_100128107 | 556 |
| 1122 | 3300025914 | Ga0207671_10000002 | Ga0207671_100000021003 | 556 |
| 1123 | 3300025924 | Ga0207694_10000022 | Ga0207694_10000022171 | 556 |
| 1124 | 3300026116 | Ga0207674_10002541 | Ga0207674_100025412 | 556 |
| 1125 | 3300026142 | Ga0207698_10000881 | Ga0207698_1000088110 | 556 |
| 1126 | 3300027907 | Ga0207428_10000102 | Ga0207428_100001029 | 556 |
| 1127 | 3300037466 | Ga0395898_0000098 | Ga0395898_0000098_38731_40494 | 556 |
| 1128 | 3300045976 | Ga0466967_0067148 | Ga0466967_0067148_124_1890 | 556 |
| 1129 | 3300046542 | Ga0495597_0001209 | Ga0495597_0001209_801_2540 | 556 |
| 1130 | 3300048915 | Ga0496112_0184865 | Ga0496112_0184865_182_1948 | 556 |
| 1131 | 3300048920 | Ga0496117_0053468 | Ga0496117_0053468_444_2219 | 556 |
| 1132 | 3300048922 | Ga0496119_0003128 | Ga0496119_0003128_11373_13148 | 556 |
| 1133 | 3300048923 | Ga0496120_0000586 | Ga0496120_0000586_1760_3535 | 556 |
| 1134 | 3300050511 | nmdc:mga08y16_2042_c1 | nmdc:mga08y16_2042_c1_5965_7728 | 556 |
| 1135 | 3300050512 | nmdc:mga0n895_3611_c1 | nmdc:mga0n895_3611_c1_5556_7319 | 556 |
| 1136 | 3300050513 | nmdc:mga0rr50_2329_c1 | nmdc:mga0rr50_2329_c1_5007_6770 | 556 |
| 1137 | 3300050514 | nmdc:mga08x19_600_c1 | nmdc:mga08x19_600_c1_16356_18119 | 556 |
| 1138 | 3300050515 | nmdc:mga0a205_228_c1 | nmdc:mga0a205_228_c1_29817_31580 | 556 |
| 1139 | 3300053140 | Ga0500573_0000001 | Ga0500573_0000001_44868_46601 | 556 |
| 1140 | 3300053155 | Ga0500620_000151 | Ga0500620_000151_9266_11041 | 556 |
| 1141 | iso_pu_bacteria | 2515154155 | 2515856666 | 556 |
| 1142 | iso_pu_bacteria | 2758568522 | 2760304081 | 556 |
| 1143 | iso_pu_bacteria | 2791355406 | 2793981519 | 556 |
| 1144 | iso_pu_bacteria | 2862574272 | 2862581524 | 556 |
| 1145 | iso_pu_bacteria | 2990088156 | 2990088500 | 556 |
| 1146 | iso_pu_bacteria | 2995726249 | 2995726635 | 556 |
| 1147 | iso_pu_bacteria | 8002811521 | 8002813514 | 556 |
| 1148 | iso_pu_bacteria | 8047893842 | 8047903365 | 556 |
| 1149 | iso_pu_bacteria | 8048356638 | 8048360295 | 556 |
| 1150 | iso_pu_bacteria | 8048356638 | 8048365956 | 556 |
| 1151 | iso_pu_bacteria | 8048369669 | 8048375586 | 556 |
| 1152 | iso_pu_bacteria | 8048369669 | 8048379195 | 556 |
| 1153 | iso_pu_bacteria | 8048379754 | 8048382619 | 556 |
| 1154 | iso_pu_bacteria | 8048379754 | 8048388301 | 556 |
| 1155 | iso_pu_bacteria | 8053945823 | 8053952477 | 556 |
| 1156 | iso_pu_bacteria | 8055034563 | 8055037231 | 556 |
| 1157 | iso_pu_bacteria | 8055037949 | 8055039442 | 556 |
| 1158 | 3300005366 | Ga0070659_100004357 | Ga0070659_1000043573 | 557 |
| 1159 | 3300005466 | Ga0070685_10001210 | Ga0070685_1000121010 | 557 |
| 1160 | 3300005563 | Ga0068855_100002245 | Ga0068855_1000022454 | 557 |
| 1161 | 3300005563 | Ga0068855_100020286 | Ga0068855_1000202868 | 557 |
| 1162 | 3300005842 | Ga0068858_100000048 | Ga0068858_100000048112 | 557 |
| 1163 | 3300006048 | Ga0075363_100007222 | Ga0075363_1000072222 | 557 |
| 1164 | 3300013105 | Ga0157369_10073150 | Ga0157369_100731502 | 557 |
| 1165 | 3300025913 | Ga0207695_10000983 | Ga0207695_1000098339 | 557 |
| 1166 | 3300025949 | Ga0207667_10014198 | Ga0207667_100141982 | 557 |
| 1167 | 3300026035 | Ga0207703_10000064 | Ga0207703_10000064111 | 557 |
| 1168 | 3300026078 | Ga0207702_10038950 | Ga0207702_100389504 | 557 |
| 1169 | 3300033180 | Ga0307510_10027928 | Ga0307510_100279281 | 557 |
| 1170 | 3300037068 | Ga0373925_0000008 | Ga0373925_0000008_101578_103344 | 557 |
| 1171 | 3300038741 | Ga0400488_30705 | Ga0400488_30705_9471_11270 | 557 |
| 1172 | 3300044693 | Ga0466961_0029108 | Ga0466961_0029108_1390_3204 | 557 |
| 1173 | 3300044694 | Ga0466963_0000859 | Ga0466963_0000859_11907_13646 | 557 |
| 1174 | 3300044719 | Ga0466971_0000394 | Ga0466971_0000394_46_1785 | 557 |
| 1175 | 3300044719 | Ga0466971_0025072 | Ga0466971_0025072_348_2162 | 557 |
| 1176 | 3300044842 | Ga0466957_0008538 | Ga0466957_0008538_4016_5755 | 557 |
| 1177 | 3300045836 | Ga0466958_0009851 | Ga0466958_0009851_90_1829 | 557 |
| 1178 | 3300046463 | Ga0495653_0016023 | Ga0495653_0016023_4250_6037 | 557 |
| 1179 | 3300048917 | Ga0496114_0002027 | Ga0496114_0002027_11095_12882 | 557 |
| 1180 | 3300048918 | Ga0496115_0017134 | Ga0496115_0017134_3563_5350 | 557 |
| 1181 | 3300049568 | Ga0501031_0040295 | Ga0501031_0040295_1111_2892 | 557 |
| 1182 | 3300050490 | nmdc:mga03n38_14040_c1 | nmdc:mga03n38_14040_c1_530_2305 | 557 |
| 1183 | 3300061719 | Ga0466962_0003062 | Ga0466962_0003062_2899_4713 | 557 |
| 1184 | iso_pu_bacteria | 2554235005 | 2554256574 | 557 |
| 1185 | iso_pu_bacteria | 2643221681 | 2644456122 | 557 |
| 1186 | iso_pu_bacteria | 2767802112 | 2768643757 | 557 |
| 1187 | iso_pu_bacteria | 2773857762 | 2774391850 | 557 |
| 1188 | iso_pu_bacteria | 2862705112 | 2862710424 | 557 |
| 1189 | iso_pu_bacteria | 2867475112 | 2867475507 | 557 |
| 1190 | iso_pu_bacteria | 2935390628 | 2935391758 | 557 |
| 1191 | iso_pu_bacteria | 2990044586 | 2990044998 | 557 |
| 1192 | iso_pu_bacteria | 2990059506 | 2990059839 | 557 |
| 1193 | iso_pu_bacteria | 2997451912 | 2997458054 | 557 |
| 1194 | iso_pu_bacteria | 3001889506 | 3001892069 | 557 |
| 1195 | iso_pu_bacteria | 3006425503 | 3006429678 | 557 |
| 1196 | iso_pu_bacteria | 3006486233 | 3006492054 | 557 |
| 1197 | iso_pu_bacteria | 8008485437 | 8008491402 | 557 |
| 1198 | iso_pu_bacteria | 8008558824 | 8008567137 | 557 |
| 1199 | iso_pu_bacteria | 8025524527 | 8025530732 | 557 |
| 1200 | iso_pu_bacteria | 8033684223 | 8033688137 | 557 |
| 1201 | iso_pu_bacteria | 8053945823 | 8053948892 | 557 |
| 1202 | iso_pu_bacteria | 8054160619 | 8054166858 | 557 |
| 1203 | iso_pu_bacteria | 8056447290 | 8056450305 | 557 |
| 1204 | 3300026116 | Ga0207674_10027562 | Ga0207674_100275623 | 558 |
| 1205 | 3300028786 | Ga0307517_10014055 | Ga0307517_100140554 | 558 |
| 1206 | 3300028794 | Ga0307515_10011010 | Ga0307515_1001101015 | 558 |
| 1207 | 3300028800 | Ga0265338_10008722 | Ga0265338_100087227 | 558 |
| 1208 | 3300031241 | Ga0265325_10008286 | Ga0265325_100082862 | 558 |
| 1209 | 3300031241 | Ga0265325_10041176 | Ga0265325_100411762 | 558 |
| 1210 | 3300031247 | Ga0265340_10028204 | Ga0265340_100282042 | 558 |
| 1211 | 3300031711 | Ga0265314_10026176 | Ga0265314_100261763 | 558 |
| 1212 | 3300031712 | Ga0265342_10007083 | Ga0265342_100070837 | 558 |
| 1213 | 3300044656 | Ga0466969_0013550 | Ga0466969_0013550_774_2555 | 558 |
| 1214 | 3300044684 | Ga0466966_0084442 | Ga0466966_0084442_161_1909 | 558 |
| 1215 | 3300044765 | Ga0466970_0000683 | Ga0466970_0000683_14703_16472 | 558 |
| 1216 | 3300045976 | Ga0466967_0071568 | Ga0466967_0071568_247_1995 | 558 |
| 1217 | 3300046459 | Ga0495629_0022598 | Ga0495629_0022598_739_2511 | 558 |
| 1218 | 3300046462 | Ga0495651_0017144 | Ga0495651_0017144_1057_2829 | 558 |
| 1219 | 3300046642 | Ga0495634_0001770 | Ga0495634_0001770_9769_11541 | 558 |
| 1220 | 3300046660 | Ga0495625_0027105 | Ga0495625_0027105_464_2236 | 558 |
| 1221 | 3300046674 | Ga0495588_0027976 | Ga0495588_0027976_197_1969 | 558 |
| 1222 | 3300046675 | Ga0495657_0001890 | Ga0495657_0001890_15979_17751 | 558 |
| 1223 | 3300046680 | Ga0495646_0000278 | Ga0495646_0000278_59_1831 | 558 |
| 1224 | 3300046683 | Ga0495658_0048348 | Ga0495658_0048348_564_2336 | 558 |
| 1225 | 3300046689 | Ga0495613_0006602 | Ga0495613_0006602_6867_8639 | 558 |
| 1226 | 3300046692 | Ga0495671_0008689 | Ga0495671_0008689_41_1813 | 558 |
| 1227 | 3300046809 | Ga0495600_0029739 | Ga0495600_0029739_698_2470 | 558 |
| 1228 | 3300047319 | Ga0495674_0044498 | Ga0495674_0044498_30_1802 | 558 |
| 1229 | 3300047447 | Ga0495685_009033 | Ga0495685_009033_1311_3062 | 558 |
| 1230 | 3300047470 | Ga0495681_0007141 | Ga0495681_0007141_5358_7130 | 558 |
| 1231 | 3300048088 | Ga0495602_0017318 | Ga0495602_0017318_40_1812 | 558 |
| 1232 | 3300048906 | Ga0496103_0024195 | Ga0496103_0024195_727_2460 | 558 |
| 1233 | 3300048911 | Ga0496108_0043405 | Ga0496108_0043405_960_2750 | 558 |
| 1234 | 3300049569 | Ga0501032_0013720 | Ga0501032_0013720_2255_4012 | 558 |
| 1235 | 3300049579 | Ga0501043_0006914 | Ga0501043_0006914_38_1795 | 558 |
| 1236 | 3300049581 | Ga0501047_0027903 | Ga0501047_0027903_2610_4367 | 558 |
| 1237 | 3300049585 | Ga0501069_0024738 | Ga0501069_0024738_197_1969 | 558 |
| 1238 | 3300049586 | Ga0501070_0000050 | Ga0501070_0000050_39146_40909 | 558 |
| 1239 | 3300053085 | Ga0495619_0055024 | Ga0495619_0055024_41_1813 | 558 |
| 1240 | 3300053107 | Ga0500560_006351 | Ga0500560_006351_884_2656 | 558 |
| 1241 | iso_pu_bacteria | 2527291627 | 2528202551 | 558 |
| 1242 | iso_pu_bacteria | 2527291629 | 2528212492 | 558 |
| 1243 | iso_pu_bacteria | 2546825537 | 2546947130 | 558 |
| 1244 | iso_pu_bacteria | 2547132111 | 2547410804 | 558 |
| 1245 | iso_pu_bacteria | 2554235227 | 2555229562 | 558 |
| 1246 | iso_pu_bacteria | 2576861822 | 2579747368 | 558 |
| 1247 | iso_pu_bacteria | 2582581313 | 2585306101 | 558 |
| 1248 | iso_pu_bacteria | 2582581314 | 2585316125 | 558 |
| 1249 | iso_pu_bacteria | 2622736605 | 2623502089 | 558 |
| 1250 | iso_pu_bacteria | 2643221647 | 2644261317 | 558 |
| 1251 | iso_pu_bacteria | 2643221678 | 2644439583 | 558 |
| 1252 | iso_pu_bacteria | 2643221714 | 2644633069 | 558 |
| 1253 | iso_pu_bacteria | 2643221961 | 2645720608 | 558 |
| 1254 | iso_pu_bacteria | 2643221962 | 2645723627 | 558 |
| 1255 | iso_pu_bacteria | 2654587600 | 2655031583 | 558 |
| 1256 | iso_pu_bacteria | 2675903058 | 2676473536 | 558 |
| 1257 | iso_pu_bacteria | 2684623036 | 2686541371 | 558 |
| 1258 | iso_pu_bacteria | 2710264753 | 2710602197 | 558 |
| 1259 | iso_pu_bacteria | 2773857762 | 2774394418 | 558 |
| 1260 | iso_pu_bacteria | 2773857924 | 2774868238 | 558 |
| 1261 | iso_pu_bacteria | 2784132148 | 2784589963 | 558 |
| 1262 | iso_pu_bacteria | 2784746768 | 2785371048 | 558 |
| 1263 | iso_pu_bacteria | 2786546132 | 2786672245 | 558 |
| 1264 | iso_pu_bacteria | 2808606357 | 2808829886 | 558 |
| 1265 | iso_pu_bacteria | 2808606359 | 2808843593 | 558 |
| 1266 | iso_pu_bacteria | 2808606375 | 2808913154 | 558 |
| 1267 | iso_pu_bacteria | 2808606448 | 2809233644 | 558 |
| 1268 | iso_pu_bacteria | 2808606448 | 2809234489 | 558 |
| 1269 | iso_pu_bacteria | 2811994879 | 2812356453 | 558 |
| 1270 | iso_pu_bacteria | 2811994917 | 2812479196 | 558 |
| 1271 | iso_pu_bacteria | 2827628540 | 2827632049 | 558 |
| 1272 | iso_pu_bacteria | 2852635781 | 2852640226 | 558 |
| 1273 | iso_pu_bacteria | 2862281513 | 2862287261 | 558 |
| 1274 | iso_pu_bacteria | 2863404153 | 2863411314 | 558 |
| 1275 | iso_pu_bacteria | 2867428634 | 2867433936 | 558 |
| 1276 | iso_pu_bacteria | 2870622029 | 2870624649 | 558 |
| 1277 | iso_pu_bacteria | 2873151551 | 2873154489 | 558 |
| 1278 | iso_pu_bacteria | 2877676314 | 2877679532 | 558 |
| 1279 | iso_pu_bacteria | 2891968417 | 2891972818 | 558 |
| 1280 | iso_pu_bacteria | 2904535858 | 2904538643 | 558 |
| 1281 | iso_pu_bacteria | 2912715099 | 2912718164 | 558 |
| 1282 | iso_pu_bacteria | 2912723979 | 2912730566 | 558 |
| 1283 | iso_pu_bacteria | 2919468124 | 2919470463 | 558 |
| 1284 | iso_pu_bacteria | 2939657138 | 2939660218 | 558 |
| 1285 | iso_pu_bacteria | 2946064051 | 2946069408 | 558 |
| 1286 | iso_pu_bacteria | 2946072368 | 2946077325 | 558 |
| 1287 | iso_pu_bacteria | 2947224130 | 2947227507 | 558 |
| 1288 | iso_pu_bacteria | 2954002825 | 2954005000 | 558 |
| 1289 | iso_pu_bacteria | 2954380949 | 2954384432 | 558 |
| 1290 | iso_pu_bacteria | 2954673503 | 2954678521 | 558 |
| 1291 | iso_pu_bacteria | 2954682443 | 2954685634 | 558 |
| 1292 | iso_pu_bacteria | 2954691527 | 2954695293 | 558 |
| 1293 | iso_pu_bacteria | 2954691527 | 2954696920 | 558 |
| 1294 | iso_pu_bacteria | 2954701450 | 2954705215 | 558 |
| 1295 | iso_pu_bacteria | 2954701450 | 2954710484 | 558 |
| 1296 | iso_pu_bacteria | 2954711539 | 2954714731 | 558 |
| 1297 | iso_pu_bacteria | 2954721474 | 2954724677 | 558 |
| 1298 | iso_pu_bacteria | 2954731030 | 2954737143 | 558 |
| 1299 | iso_pu_bacteria | 2954740390 | 2954743600 | 558 |
| 1300 | iso_pu_bacteria | 2954749733 | 2954755994 | 558 |
| 1301 | iso_pu_bacteria | 2954759201 | 2954762552 | 558 |
| 1302 | iso_pu_bacteria | 3002998708 | 3003001456 | 558 |
| 1303 | iso_pu_bacteria | 3006393351 | 3006397248 | 558 |
| 1304 | iso_pu_bacteria | 3006493962 | 3006496832 | 558 |
| 1305 | iso_pu_bacteria | 3006493962 | 3006496868 | 558 |
| 1306 | iso_pu_bacteria | 637000116 | 637878031 | 558 |
| 1307 | iso_pu_bacteria | 8008574985 | 8008577570 | 558 |
| 1308 | iso_pu_bacteria | 8023623736 | 8023625803 | 558 |
| 1309 | iso_pu_bacteria | 8025413630 | 8025415451 | 558 |
| 1310 | iso_pu_bacteria | 8048406513 | 8048406896 | 558 |
| 1311 | iso_pu_bacteria | 8054609563 | 8054610631 | 558 |
| 1312 | iso_pu_bacteria | 8056829672 | 8056837384 | 558 |
| 1313 | 3300005937 | Ga0081455_10000683 | Ga0081455_100006834 | 559 |
| 1314 | 3300032002 | Ga0307416_100120896 | Ga0307416_1001208961 | 559 |
| 1315 | 3300037312 | Ga0395899_0001686 | Ga0395899_0001686_11075_12814 | 559 |
| 1316 | 3300042993 | Ga0439440_0003562 | Ga0439440_0003562_411_2159 | 559 |
| 1317 | 3300044735 | Ga0466968_0002141 | Ga0466968_0002141_679_2415 | 559 |
| 1318 | 3300046455 | Ga0495603_0001010 | Ga0495603_0001010_2040_3794 | 559 |
| 1319 | 3300046455 | Ga0495603_0006758 | Ga0495603_0006758_1693_3447 | 559 |
| 1320 | 3300046459 | Ga0495629_0004235 | Ga0495629_0004235_72_1826 | 559 |
| 1321 | 3300046492 | Ga0495585_0025941 | Ga0495585_0025941_1201_2955 | 559 |
| 1322 | 3300046499 | Ga0495594_0004245 | Ga0495594_0004245_717_2471 | 559 |
| 1323 | 3300046538 | Ga0495609_0049091 | Ga0495609_0049091_75_1829 | 559 |
| 1324 | 3300046557 | Ga0495622_0003240 | Ga0495622_0003240_4886_6640 | 559 |
| 1325 | 3300046689 | Ga0495613_0034771 | Ga0495613_0034771_1935_3689 | 559 |
| 1326 | 3300047318 | Ga0495636_0016968 | Ga0495636_0016968_952_2706 | 559 |
| 1327 | 3300047321 | Ga0495676_0050630 | Ga0495676_0050630_812_2566 | 559 |
| 1328 | 3300047323 | Ga0495683_0028087 | Ga0495683_0028087_21_1775 | 559 |
| 1329 | 3300047447 | Ga0495685_004937 | Ga0495685_004937_1553_3307 | 559 |
| 1330 | 3300048089 | Ga0495614_0012492 | Ga0495614_0012492_1925_3679 | 559 |
| 1331 | 3300049568 | Ga0501031_0006974 | Ga0501031_0006974_4927_6699 | 559 |
| 1332 | 3300049570 | Ga0501033_0030583 | Ga0501033_0030583_1782_3554 | 559 |
| 1333 | 3300049571 | Ga0501034_0000070 | Ga0501034_0000070_109352_111097 | 559 |
| 1334 | 3300049573 | Ga0501037_0022974 | Ga0501037_0022974_515_2287 | 559 |
| 1335 | 3300049574 | Ga0501038_0022377 | Ga0501038_0022377_3402_5174 | 559 |
| 1336 | 3300049575 | Ga0501039_0054778 | Ga0501039_0054778_492_2264 | 559 |
| 1337 | 3300049577 | Ga0501041_0003618 | Ga0501041_0003618_2255_4027 | 559 |
| 1338 | 3300049578 | Ga0501042_0063273 | Ga0501042_0063273_701_2461 | 559 |
| 1339 | 3300049579 | Ga0501043_0008585 | Ga0501043_0008585_4520_6292 | 559 |
| 1340 | 3300049580 | Ga0501046_0000883 | Ga0501046_0000883_10380_12320 | 559 |
| 1341 | 3300049580 | Ga0501046_0008738 | Ga0501046_0008738_4781_6553 | 559 |
| 1342 | 3300049581 | Ga0501047_0000005 | Ga0501047_0000005_212477_214237 | 559 |
| 1343 | 3300049581 | Ga0501047_0016530 | Ga0501047_0016530_752_2524 | 559 |
| 1344 | 3300049582 | Ga0501048_0008037 | Ga0501048_0008037_4585_6357 | 559 |
| 1345 | 3300049583 | Ga0501067_0006662 | Ga0501067_0006662_53_1825 | 559 |
| 1346 | 3300049584 | Ga0501068_0001758 | Ga0501068_0001758_4871_6643 | 559 |
| 1347 | 3300049587 | Ga0501071_0002468 | Ga0501071_0002468_4669_6441 | 559 |
| 1348 | 3300049588 | Ga0501072_0011940 | Ga0501072_0011940_4805_6577 | 559 |
| 1349 | 3300049592 | Ga0501076_0011709 | Ga0501076_0011709_4303_6075 | 559 |
| 1350 | 3300049741 | Ga0501079_0020468 | Ga0501079_0020468_563_2335 | 559 |
| 1351 | 3300049742 | Ga0501080_0014782 | Ga0501080_0014782_4520_6292 | 559 |
| 1352 | 3300049744 | Ga0501083_0002947 | Ga0501083_0002947_4714_6486 | 559 |
| 1353 | 3300049822 | Ga0501035_0023796 | Ga0501035_0023796_2295_4067 | 559 |
| 1354 | 3300049823 | Ga0501044_0008754 | Ga0501044_0008754_4781_6553 | 559 |
| 1355 | 3300049823 | Ga0501044_0166508 | Ga0501044_0166508_299_2059 | 559 |
| 1356 | 3300054114 | Ga0501084_0028165 | Ga0501084_0028165_294_2066 | 559 |
| 1357 | 3300060353 | Ga0501082_0019185 | Ga0501082_0019185_3162_4934 | 559 |
| 1358 | 3300061734 | Ga0530510_0017884 | Ga0530510_0017884_2454_4226 | 559 |
| 1359 | iso_pu_bacteria | 2547132424 | 2548693334 | 559 |
| 1360 | iso_pu_bacteria | 2579778521 | 2579853673 | 559 |
| 1361 | iso_pu_bacteria | 2619618881 | 2619854241 | 559 |
| 1362 | iso_pu_bacteria | 2619619003 | 2620349960 | 559 |
| 1363 | iso_pu_bacteria | 2626541554 | 2626636031 | 559 |
| 1364 | iso_pu_bacteria | 2643221601 | 2644014298 | 559 |
| 1365 | iso_pu_bacteria | 2643221617 | 2644098716 | 559 |
| 1366 | iso_pu_bacteria | 2643221620 | 2644116077 | 559 |
| 1367 | iso_pu_bacteria | 2643221631 | 2644175735 | 559 |
| 1368 | iso_pu_bacteria | 2739367898 | 2740167324 | 559 |
| 1369 | iso_pu_bacteria | 2786546132 | 2786674480 | 559 |
| 1370 | iso_pu_bacteria | 2808606439 | 2809194726 | 559 |
| 1371 | iso_pu_bacteria | 2811994874 | 2812330811 | 559 |
| 1372 | iso_pu_bacteria | 2811994878 | 2812352242 | 559 |
| 1373 | iso_pu_bacteria | 2811994878 | 2812353038 | 559 |
| 1374 | iso_pu_bacteria | 2818991472 | 2819742450 | 559 |
| 1375 | iso_pu_bacteria | 2831935698 | 2831940468 | 559 |
| 1376 | iso_pu_bacteria | 2852643534 | 2852646323 | 559 |
| 1377 | iso_pu_bacteria | 2857733635 | 2857736015 | 559 |
| 1378 | iso_pu_bacteria | 2912715099 | 2912720244 | 559 |
| 1379 | iso_pu_bacteria | 2946024296 | 2946025056 | 559 |
| 1380 | iso_pu_bacteria | 2954673503 | 2954680924 | 559 |
| 1381 | iso_pu_bacteria | 2954682443 | 2954683233 | 559 |
| 1382 | iso_pu_bacteria | 2995463766 | 2995467719 | 559 |
| 1383 | iso_pu_bacteria | 3006321560 | 3006324121 | 559 |
| 1384 | iso_pu_bacteria | 8048127548 | 8048128197 | 559 |
| 1385 | iso_pu_bacteria | 8054609563 | 8054613990 | 559 |
| 1386 | iso_pu_bacteria | 8054913762 | 8054917093 | 559 |
| 1387 | iso_pu_bacteria | 8054920844 | 8054922205 | 559 |
| 1388 | 3300003578 | Ga0006562J51391_1094765 | Ga0006562J51391_10947654 | 560 |
| 1389 | 3300005937 | Ga0081455_10001546 | Ga0081455_1000154620 | 560 |
| 1390 | 3300025898 | Ga0207692_10004777 | Ga0207692_100047772 | 560 |
| 1391 | 3300031548 | Ga0307408_100003857 | Ga0307408_1000038572 | 560 |
| 1392 | 3300031911 | Ga0307412_10002071 | Ga0307412_100020717 | 560 |
| 1393 | 3300046452 | Ga0495617_019271 | Ga0495617_019271_226_1983 | 560 |
| 1394 | 3300046462 | Ga0495651_0077856 | Ga0495651_0077856_63_1895 | 560 |
| 1395 | 3300046529 | Ga0495652_0023514 | Ga0495652_0023514_3584_5416 | 560 |
| 1396 | 3300046533 | Ga0495640_0005210 | Ga0495640_0005210_4907_6739 | 560 |
| 1397 | 3300046642 | Ga0495634_0016111 | Ga0495634_0016111_1281_3113 | 560 |
| 1398 | 3300046660 | Ga0495625_0082704 | Ga0495625_0082704_224_1981 | 560 |
| 1399 | 3300046675 | Ga0495657_0084082 | Ga0495657_0084082_45_1877 | 560 |
| 1400 | 3300046689 | Ga0495613_0063948 | Ga0495613_0063948_786_2618 | 560 |
| 1401 | 3300047321 | Ga0495676_0104458 | Ga0495676_0104458_44_1876 | 560 |
| 1402 | 3300048903 | Ga0496100_0008684 | Ga0496100_0008684_1651_3414 | 560 |
| 1403 | 3300048904 | Ga0496101_0036802 | Ga0496101_0036802_240_2003 | 560 |
| 1404 | 3300048905 | Ga0496102_0055400 | Ga0496102_0055400_1606_3369 | 560 |
| 1405 | 3300048907 | Ga0496104_0072403 | Ga0496104_0072403_366_2129 | 560 |
| 1406 | 3300048908 | Ga0496105_0080500 | Ga0496105_0080500_41_1804 | 560 |
| 1407 | 3300048929 | Ga0496126_0000335 | Ga0496126_0000335_12979_14703 | 560 |
| 1408 | 3300053098 | Ga0500650_0004010 | Ga0500650_0004010_932_2680 | 560 |
| 1409 | 3300053140 | Ga0500573_0007564 | Ga0500573_0007564_872_2623 | 560 |
| 1410 | 3300053140 | Ga0500573_0008128 | Ga0500573_0008128_3288_5039 | 560 |
| 1411 | 3300053140 | Ga0500573_0011354 | Ga0500573_0011354_1620_3371 | 560 |
| 1412 | 3300053140 | Ga0500573_0064686 | Ga0500573_0064686_83_1831 | 560 |
| 1413 | iso_pu_bacteria | 2643221641 | 2644231576 | 560 |
| 1414 | iso_pu_bacteria | 2643221697 | 2644538373 | 560 |
| 1415 | iso_pu_bacteria | 2751185734 | 2753074263 | 560 |
| 1416 | iso_pu_bacteria | 2808606439 | 2809197344 | 560 |
| 1417 | iso_pu_bacteria | 2811994882 | 2812375641 | 560 |
| 1418 | iso_pu_bacteria | 2818991462 | 2819691967 | 560 |
| 1419 | iso_pu_bacteria | 2818991469 | 2819729710 | 560 |
| 1420 | iso_pu_bacteria | 2867507094 | 2867509454 | 560 |
| 1421 | iso_pu_bacteria | 2868088558 | 2868092775 | 560 |
| 1422 | iso_pu_bacteria | 2883821847 | 2883823304 | 560 |
| 1423 | iso_pu_bacteria | 2919446982 | 2919447702 | 560 |
| 1424 | iso_pu_bacteria | 2984592036 | 2984595644 | 560 |
| 1425 | iso_pu_bacteria | 8003830390 | 8003835677 | 560 |
| 1426 | iso_pu_bacteria | 8055157932 | 8055160020 | 560 |
| 1427 | 3300005937 | Ga0081455_10000144 | Ga0081455_1000014436 | 561 |
| 1428 | 3300014326 | Ga0157380_10123417 | Ga0157380_101234172 | 561 |
| 1429 | 3300025302 | Ga0207426_1006087 | Ga0207426_10060872 | 561 |
| 1430 | 3300025302 | Ga0207426_1006196 | Ga0207426_10061962 | 561 |
| 1431 | 3300031649 | Ga0307514_10001437 | Ga0307514_100014374 | 561 |
| 1432 | 3300031731 | Ga0307405_10032042 | Ga0307405_100320422 | 561 |
| 1433 | 3300031852 | Ga0307410_10025312 | Ga0307410_100253122 | 561 |
| 1434 | 3300031901 | Ga0307406_10033406 | Ga0307406_100334063 | 561 |
| 1435 | 3300031903 | Ga0307407_10003910 | Ga0307407_100039103 | 561 |
| 1436 | 3300032002 | Ga0307416_100028502 | Ga0307416_1000285022 | 561 |
| 1437 | 3300032126 | Ga0307415_100000050 | Ga0307415_10000005046 | 561 |
| 1438 | 3300042876 | Ga0451577_0008355 | Ga0451577_0008355_2612_4345 | 561 |
| 1439 | 3300044712 | Ga0453684_0028691 | Ga0453684_0028691_2054_3787 | 561 |
| 1440 | 3300046455 | Ga0495603_0000669 | Ga0495603_0000669_6959_8731 | 561 |
| 1441 | 3300046648 | Ga0495611_0006045 | Ga0495611_0006045_42_1817 | 561 |
| 1442 | 3300047321 | Ga0495676_0065324 | Ga0495676_0065324_168_1940 | 561 |
| 1443 | 3300048912 | Ga0496109_0027727 | Ga0496109_0027727_1472_3262 | 561 |
| 1444 | 3300048913 | Ga0496110_0042296 | Ga0496110_0042296_1396_3186 | 561 |
| 1445 | 3300048920 | Ga0496117_0004915 | Ga0496117_0004915_9574_11298 | 561 |
| 1446 | 3300053136 | Ga0500559_0000210 | Ga0500559_0000210_31190_32944 | 561 |
| 1447 | iso_pu_bacteria | 2508501039 | 2508670519 | 561 |
| 1448 | iso_pu_bacteria | 2517572101 | 2517762642 | 561 |
| 1449 | iso_pu_bacteria | 2643221567 | 2643852826 | 561 |
| 1450 | iso_pu_bacteria | 2643221624 | 2644135335 | 561 |
| 1451 | iso_pu_bacteria | 2643221649 | 2644277620 | 561 |
| 1452 | iso_pu_bacteria | 2643221711 | 2644611244 | 561 |
| 1453 | iso_pu_bacteria | 2675902999 | 2676199361 | 561 |
| 1454 | iso_pu_bacteria | 2687453737 | 2689962538 | 561 |
| 1455 | iso_pu_bacteria | 2773857921 | 2774843939 | 561 |
| 1456 | iso_pu_bacteria | 2784132109 | 2784472802 | 561 |
| 1457 | iso_pu_bacteria | 2808606365 | 2808875268 | 561 |
| 1458 | iso_pu_bacteria | 2818991318 | 2819424508 | 561 |
| 1459 | iso_pu_bacteria | 2818991458 | 2819668100 | 561 |
| 1460 | iso_pu_bacteria | 2857481737 | 2857485659 | 561 |
| 1461 | iso_pu_bacteria | 2870721527 | 2870727316 | 561 |
| 1462 | iso_pu_bacteria | 2946041624 | 2946044820 | 561 |
| 1463 | iso_pu_bacteria | 8002775197 | 8002779898 | 561 |
| 1464 | iso_pu_bacteria | 8002784119 | 8002788642 | 561 |
| 1465 | iso_pu_bacteria | 8004212874 | 8004213530 | 561 |
| 1466 | 3300003578 | Ga0006562J51391_1101838 | Ga0006562J51391_11018382 | 562 |
| 1467 | 3300005329 | Ga0070683_100020474 | Ga0070683_1000204742 | 562 |
| 1468 | 3300005337 | Ga0070682_100007546 | Ga0070682_1000075462 | 562 |
| 1469 | 3300005338 | Ga0068868_100121629 | Ga0068868_1001216291 | 562 |
| 1470 | 3300005366 | Ga0070659_100047517 | Ga0070659_1000475172 | 562 |
| 1471 | 3300005441 | Ga0070700_100061722 | Ga0070700_1000617221 | 562 |
| 1472 | 3300005539 | Ga0068853_100052939 | Ga0068853_1000529393 | 562 |
| 1473 | 3300005616 | Ga0068852_100093836 | Ga0068852_1000938362 | 562 |
| 1474 | 3300005718 | Ga0068866_10016443 | Ga0068866_100164432 | 562 |
| 1475 | 3300005719 | Ga0068861_100016118 | Ga0068861_1000161184 | 562 |
| 1476 | 3300005937 | Ga0081455_10005669 | Ga0081455_100056694 | 562 |
| 1477 | 3300006881 | Ga0068865_100015082 | Ga0068865_1000150823 | 562 |
| 1478 | 3300009098 | Ga0105245_10161910 | Ga0105245_101619102 | 562 |
| 1479 | 3300009148 | Ga0105243_10011876 | Ga0105243_100118762 | 562 |
| 1480 | 3300009148 | Ga0105243_10022266 | Ga0105243_100222664 | 562 |
| 1481 | 3300009551 | Ga0105238_10037448 | Ga0105238_100374484 | 562 |
| 1482 | 3300009553 | Ga0105249_10022400 | Ga0105249_100224004 | 562 |
| 1483 | 3300010375 | Ga0105239_10030862 | Ga0105239_100308624 | 562 |
| 1484 | 3300013306 | Ga0163162_10180635 | Ga0163162_101806352 | 562 |
| 1485 | 3300014497 | Ga0182008_10000566 | Ga0182008_1000056615 | 562 |
| 1486 | 3300014497 | Ga0182008_10001782 | Ga0182008_100017827 | 562 |
| 1487 | 3300014497 | Ga0182008_10012848 | Ga0182008_100128482 | 562 |
| 1488 | 3300015262 | Ga0182007_10001078 | Ga0182007_100010789 | 562 |
| 1489 | 3300015688 | Ga0183367_1002 | Ga0183367_1002505 | 562 |
| 1490 | 3300025297 | Ga0209758_1006882 | Ga0209758_10068827 | 562 |
| 1491 | 3300025901 | Ga0207688_10048179 | Ga0207688_100481792 | 562 |
| 1492 | 3300025927 | Ga0207687_10043672 | Ga0207687_100436721 | 562 |
| 1493 | 3300025935 | Ga0207709_10036449 | Ga0207709_100364491 | 562 |
| 1494 | 3300025944 | Ga0207661_10029768 | Ga0207661_100297682 | 562 |
| 1495 | 3300025961 | Ga0207712_10024793 | Ga0207712_100247933 | 562 |
| 1496 | 3300026041 | Ga0207639_10058457 | Ga0207639_100584571 | 562 |
| 1497 | 3300026075 | Ga0207708_10019229 | Ga0207708_100192294 | 562 |
| 1498 | 3300026118 | Ga0207675_100017737 | Ga0207675_1000177375 | 562 |
| 1499 | 3300026142 | Ga0207698_10062208 | Ga0207698_100622082 | 562 |
| 1500 | 3300027866 | Ga0209813_10003346 | Ga0209813_100033462 | 562 |
| 1501 | 3300028794 | Ga0307515_10068065 | Ga0307515_100680652 | 562 |
| 1502 | 3300028794 | Ga0307515_10075891 | Ga0307515_100758912 | 562 |
| 1503 | 3300030522 | Ga0307512_10007694 | Ga0307512_100076949 | 562 |
| 1504 | 3300031456 | Ga0307513_10014769 | Ga0307513_100147693 | 562 |
| 1505 | 3300031649 | Ga0307514_10004905 | Ga0307514_100049055 | 562 |
| 1506 | 3300031649 | Ga0307514_10019860 | Ga0307514_100198603 | 562 |
| 1507 | 3300031649 | Ga0307514_10026254 | Ga0307514_100262542 | 562 |
| 1508 | 3300032002 | Ga0307416_100010993 | Ga0307416_1000109934 | 562 |
| 1509 | 3300033180 | Ga0307510_10088495 | Ga0307510_100884952 | 562 |
| 1510 | 3300038443 | Ga0395901_0048675 | Ga0395901_0048675_1136_2905 | 562 |
| 1511 | 3300041404 | Ga0439436_0001748 | Ga0439436_0001748_1689_3461 | 562 |
| 1512 | 3300041999 | Ga0439433_0004729 | Ga0439433_0004729_560_2332 | 562 |
| 1513 | 3300042005 | Ga0439448_0004385 | Ga0439448_0004385_67_1839 | 562 |
| 1514 | 3300042014 | Ga0439457_000316 | Ga0439457_000316_1637_3409 | 562 |
| 1515 | 3300042131 | Ga0450894_000053 | Ga0450894_000053_1652_3448 | 562 |
| 1516 | 3300042135 | Ga0450899_001598 | Ga0450899_001598_640_2436 | 562 |
| 1517 | 3300044656 | Ga0466969_0027170 | Ga0466969_0027170_115_1887 | 562 |
| 1518 | 3300044683 | Ga0466965_0001118 | Ga0466965_0001118_6556_8328 | 562 |
| 1519 | 3300044684 | Ga0466966_0002982 | Ga0466966_0002982_3977_5749 | 562 |
| 1520 | 3300044684 | Ga0466966_0082728 | Ga0466966_0082728_91_1863 | 562 |
| 1521 | 3300044693 | Ga0466961_0003814 | Ga0466961_0003814_3977_5749 | 562 |
| 1522 | 3300044694 | Ga0466963_0000177 | Ga0466963_0000177_5610_7382 | 562 |
| 1523 | 3300044694 | Ga0466963_0001380 | Ga0466963_0001380_8069_9841 | 562 |
| 1524 | 3300044719 | Ga0466971_0001709 | Ga0466971_0001709_2854_4626 | 562 |
| 1525 | 3300044719 | Ga0466971_0005419 | Ga0466971_0005419_2467_4239 | 562 |
| 1526 | 3300044765 | Ga0466970_0000599 | Ga0466970_0000599_9087_10859 | 562 |
| 1527 | 3300044842 | Ga0466957_0000564 | Ga0466957_0000564_441_2213 | 562 |
| 1528 | 3300045049 | Ga0466959_0003694 | Ga0466959_0003694_3830_5602 | 562 |
| 1529 | 3300046455 | Ga0495603_0002872 | Ga0495603_0002872_302_2074 | 562 |
| 1530 | 3300046462 | Ga0495651_0020354 | Ga0495651_0020354_654_2429 | 562 |
| 1531 | 3300046472 | Ga0495580_0004763 | Ga0495580_0004763_5809_7542 | 562 |
| 1532 | 3300046475 | Ga0495639_0014844 | Ga0495639_0014844_722_2494 | 562 |
| 1533 | 3300046476 | Ga0495662_0051892 | Ga0495662_0051892_195_1967 | 562 |
| 1534 | 3300046515 | Ga0495620_0009619 | Ga0495620_0009619_46_1818 | 562 |
| 1535 | 3300046528 | Ga0495642_0042216 | Ga0495642_0042216_34_1806 | 562 |
| 1536 | 3300046543 | Ga0495645_0054733 | Ga0495645_0054733_249_2021 | 562 |
| 1537 | 3300046674 | Ga0495588_0023001 | Ga0495588_0023001_118_1890 | 562 |
| 1538 | 3300046679 | Ga0495623_0002383 | Ga0495623_0002383_10692_12464 | 562 |
| 1539 | 3300046794 | Ga0495589_0029548 | Ga0495589_0029548_980_2752 | 562 |
| 1540 | 3300047318 | Ga0495636_0005765 | Ga0495636_0005765_2000_3772 | 562 |
| 1541 | 3300047318 | Ga0495636_0021053 | Ga0495636_0021053_45_1817 | 562 |
| 1542 | 3300047447 | Ga0495685_009324 | Ga0495685_009324_753_2525 | 562 |
| 1543 | 3300047472 | Ga0495686_0018267 | Ga0495686_0018267_2814_4586 | 562 |
| 1544 | 3300048089 | Ga0495614_0022327 | Ga0495614_0022327_603_2378 | 562 |
| 1545 | 3300048912 | Ga0496109_0047585 | Ga0496109_0047585_764_2551 | 562 |
| 1546 | 3300048912 | Ga0496109_0054036 | Ga0496109_0054036_1189_2961 | 562 |
| 1547 | 3300048913 | Ga0496110_0070365 | Ga0496110_0070365_539_2341 | 562 |
| 1548 | 3300048925 | Ga0496122_0000032 | Ga0496122_0000032_78328_80052 | 562 |
| 1549 | 3300048925 | Ga0496122_0009163 | Ga0496122_0009163_578_2338 | 562 |
| 1550 | 3300048926 | Ga0496123_0000093 | Ga0496123_0000093_165629_167353 | 562 |
| 1551 | 3300048927 | Ga0496124_0109359 | Ga0496124_0109359_408_2168 | 562 |
| 1552 | 3300048928 | Ga0496125_0000041 | Ga0496125_0000041_125493_127217 | 562 |
| 1553 | 3300049568 | Ga0501031_0001297 | Ga0501031_0001297_6504_8252 | 562 |
| 1554 | 3300049568 | Ga0501031_0040799 | Ga0501031_0040799_199_1971 | 562 |
| 1555 | 3300049570 | Ga0501033_0007862 | Ga0501033_0007862_734_2482 | 562 |
| 1556 | 3300049571 | Ga0501034_0018363 | Ga0501034_0018363_2299_4047 | 562 |
| 1557 | 3300049572 | Ga0501036_0009116 | Ga0501036_0009116_1621_3369 | 562 |
| 1558 | 3300049573 | Ga0501037_0000782 | Ga0501037_0000782_18603_20351 | 562 |
| 1559 | 3300049574 | Ga0501038_0002773 | Ga0501038_0002773_14472_16244 | 562 |
| 1560 | 3300049574 | Ga0501038_0024154 | Ga0501038_0024154_2403_4151 | 562 |
| 1561 | 3300049575 | Ga0501039_0016742 | Ga0501039_0016742_2343_4091 | 562 |
| 1562 | 3300049576 | Ga0501040_0039799 | Ga0501040_0039799_957_2705 | 562 |
| 1563 | 3300049579 | Ga0501043_0139824 | Ga0501043_0139824_24_1796 | 562 |
| 1564 | 3300049580 | Ga0501046_0001159 | Ga0501046_0001159_2098_3846 | 562 |
| 1565 | 3300049581 | Ga0501047_0038804 | Ga0501047_0038804_2787_4559 | 562 |
| 1566 | 3300049581 | Ga0501047_0041053 | Ga0501047_0041053_1069_2817 | 562 |
| 1567 | 3300049582 | Ga0501048_0006060 | Ga0501048_0006060_4714_6462 | 562 |
| 1568 | 3300049583 | Ga0501067_0000245 | Ga0501067_0000245_15555_17339 | 562 |
| 1569 | 3300049583 | Ga0501067_0002205 | Ga0501067_0002205_7891_9639 | 562 |
| 1570 | 3300049585 | Ga0501069_0016615 | Ga0501069_0016615_1489_3237 | 562 |
| 1571 | 3300049586 | Ga0501070_0001113 | Ga0501070_0001113_1927_3675 | 562 |
| 1572 | 3300049586 | Ga0501070_0002662 | Ga0501070_0002662_2908_4692 | 562 |
| 1573 | 3300049589 | Ga0501073_0014852 | Ga0501073_0014852_1601_3385 | 562 |
| 1574 | 3300049589 | Ga0501073_0026706 | Ga0501073_0026706_167_1915 | 562 |
| 1575 | 3300049590 | Ga0501074_0002415 | Ga0501074_0002415_5735_7519 | 562 |
| 1576 | 3300049590 | Ga0501074_0006017 | Ga0501074_0006017_2323_4071 | 562 |
| 1577 | 3300049741 | Ga0501079_0035356 | Ga0501079_0035356_111_1895 | 562 |
| 1578 | 3300049742 | Ga0501080_0000318 | Ga0501080_0000318_22952_24736 | 562 |
| 1579 | 3300049744 | Ga0501083_0008405 | Ga0501083_0008405_4538_6286 | 562 |
| 1580 | 3300049822 | Ga0501035_0006710 | Ga0501035_0006710_1069_2817 | 562 |
| 1581 | 3300049822 | Ga0501035_0012536 | Ga0501035_0012536_4374_6146 | 562 |
| 1582 | 3300049823 | Ga0501044_0004786 | Ga0501044_0004786_87_1859 | 562 |
| 1583 | 3300049823 | Ga0501044_0054689 | Ga0501044_0054689_983_2755 | 562 |
| 1584 | 3300050495 | nmdc:mga04h51_3426_c1 | nmdc:mga04h51_3426_c1_555_2327 | 562 |
| 1585 | 3300053136 | Ga0500559_0003977 | Ga0500559_0003977_4899_6668 | 562 |
| 1586 | 3300054114 | Ga0501084_0002835 | Ga0501084_0002835_2341_4089 | 562 |
| 1587 | 3300060353 | Ga0501082_0007249 | Ga0501082_0007249_2803_4587 | 562 |
| 1588 | 3300061719 | Ga0466962_0000868 | Ga0466962_0000868_5463_7235 | 562 |
| 1589 | 3300061719 | Ga0466962_0008985 | Ga0466962_0008985_213_1985 | 562 |
| 1590 | iso_pu_bacteria | 2554235227 | 2555229715 | 562 |
| 1591 | iso_pu_bacteria | 2558860280 | 2559428997 | 562 |
| 1592 | iso_pu_bacteria | 2585428157 | 2588106818 | 562 |
| 1593 | iso_pu_bacteria | 2643221542 | 2643735071 | 562 |
| 1594 | iso_pu_bacteria | 2643221546 | 2643753099 | 562 |
| 1595 | iso_pu_bacteria | 2643221553 | 2643786709 | 562 |
| 1596 | iso_pu_bacteria | 2643221561 | 2643824100 | 562 |
| 1597 | iso_pu_bacteria | 2643221566 | 2643846420 | 562 |
| 1598 | iso_pu_bacteria | 2643221575 | 2643888436 | 562 |
| 1599 | iso_pu_bacteria | 2643221576 | 2643892448 | 562 |
| 1600 | iso_pu_bacteria | 2643221590 | 2643961500 | 562 |
| 1601 | iso_pu_bacteria | 2643221597 | 2643996544 | 562 |
| 1602 | iso_pu_bacteria | 2643221604 | 2644032432 | 562 |
| 1603 | iso_pu_bacteria | 2643221615 | 2644090496 | 562 |
| 1604 | iso_pu_bacteria | 2643221616 | 2644095010 | 562 |
| 1605 | iso_pu_bacteria | 2643221630 | 2644173233 | 562 |
| 1606 | iso_pu_bacteria | 2643221632 | 2644181003 | 562 |
| 1607 | iso_pu_bacteria | 2643221657 | 2644323376 | 562 |
| 1608 | iso_pu_bacteria | 2643221696 | 2644533406 | 562 |
| 1609 | iso_pu_bacteria | 2643221724 | 2644681390 | 562 |
| 1610 | iso_pu_bacteria | 2654587600 | 2655031739 | 562 |
| 1611 | iso_pu_bacteria | 2728369380 | 2730230177 | 562 |
| 1612 | iso_pu_bacteria | 2738541305 | 2738870615 | 562 |
| 1613 | iso_pu_bacteria | 2747842429 | 2747951633 | 562 |
| 1614 | iso_pu_bacteria | 2773857763 | 2774400328 | 562 |
| 1615 | iso_pu_bacteria | 2808606368 | 2808884980 | 562 |
| 1616 | iso_pu_bacteria | 2811994872 | 2812322363 | 562 |
| 1617 | iso_pu_bacteria | 2821268502 | 2821269283 | 562 |
| 1618 | iso_pu_bacteria | 2833709550 | 2833710190 | 562 |
| 1619 | iso_pu_bacteria | 2844841374 | 2844841491 | 562 |
| 1620 | iso_pu_bacteria | 2852632344 | 2852632979 | 562 |
| 1621 | iso_pu_bacteria | 2852646457 | 2852649529 | 562 |
| 1622 | iso_pu_bacteria | 2852663356 | 2852665614 | 562 |
| 1623 | iso_pu_bacteria | 2855386786 | 2855389117 | 562 |
| 1624 | iso_pu_bacteria | 2857720070 | 2857722273 | 562 |
| 1625 | iso_pu_bacteria | 2857723135 | 2857725021 | 562 |
| 1626 | iso_pu_bacteria | 2857729791 | 2857732145 | 562 |
| 1627 | iso_pu_bacteria | 2862993130 | 2862994689 | 562 |
| 1628 | iso_pu_bacteria | 2866552031 | 2866555021 | 562 |
| 1629 | iso_pu_bacteria | 2870628048 | 2870629653 | 562 |
| 1630 | iso_pu_bacteria | 2884763398 | 2884764391 | 562 |
| 1631 | iso_pu_bacteria | 2893684298 | 2893685025 | 562 |
| 1632 | iso_pu_bacteria | 2904509784 | 2904510120 | 562 |
| 1633 | iso_pu_bacteria | 2906799679 | 2906801962 | 562 |
| 1634 | iso_pu_bacteria | 2908678064 | 2908678658 | 562 |
| 1635 | iso_pu_bacteria | 2919069694 | 2919071009 | 562 |
| 1636 | iso_pu_bacteria | 2919395869 | 2919396749 | 562 |
| 1637 | iso_pu_bacteria | 2919523602 | 2919527192 | 562 |
| 1638 | iso_pu_bacteria | 2928090899 | 2928091118 | 562 |
| 1639 | iso_pu_bacteria | 2928121344 | 2928124957 | 562 |
| 1640 | iso_pu_bacteria | 2928153084 | 2928154912 | 562 |
| 1641 | iso_pu_bacteria | 2946033335 | 2946036928 | 562 |
| 1642 | iso_pu_bacteria | 2946080515 | 2946084553 | 562 |
| 1643 | iso_pu_bacteria | 2966921586 | 2966921901 | 562 |
| 1644 | iso_pu_bacteria | 2977228692 | 2977230557 | 562 |
| 1645 | iso_pu_bacteria | 2977264416 | 2977265824 | 562 |
| 1646 | iso_pu_bacteria | 2984542743 | 2984542855 | 562 |
| 1647 | iso_pu_bacteria | 2984576629 | 2984579840 | 562 |
| 1648 | iso_pu_bacteria | 2984580707 | 2984582122 | 562 |
| 1649 | iso_pu_bacteria | 2990256926 | 2990257446 | 562 |
| 1650 | iso_pu_bacteria | 8004182704 | 8004185708 | 562 |
| 1651 | iso_pu_bacteria | 8045830549 | 8045832813 | 562 |
| 1652 | iso_pu_bacteria | 8047710418 | 8047719840 | 562 |
| 1653 | iso_pu_bacteria | 8056037122 | 8056040794 | 562 |
| 1654 | 3300005327 | Ga0070658_10010283 | Ga0070658_100102834 | 563 |
| 1655 | 3300005543 | Ga0070672_100012309 | Ga0070672_1000123093 | 563 |
| 1656 | 3300005616 | Ga0068852_100003937 | Ga0068852_1000039373 | 563 |
| 1657 | 3300005937 | Ga0081455_10000960 | Ga0081455_1000096014 | 563 |
| 1658 | 3300005937 | Ga0081455_10007554 | Ga0081455_100075546 | 563 |
| 1659 | 3300005937 | Ga0081455_10017647 | Ga0081455_100176474 | 563 |
| 1660 | 3300005981 | Ga0081538_10000350 | Ga0081538_1000035010 | 563 |
| 1661 | 3300014325 | Ga0163163_10094123 | Ga0163163_100941232 | 563 |
| 1662 | 3300025940 | Ga0207691_10076862 | Ga0207691_100768623 | 563 |
| 1663 | 3300025941 | Ga0207711_10004915 | Ga0207711_100049156 | 563 |
| 1664 | 3300026142 | Ga0207698_10000744 | Ga0207698_100007444 | 563 |
| 1665 | 3300031456 | Ga0307513_10140542 | Ga0307513_101405422 | 563 |
| 1666 | 3300031548 | Ga0307408_100005598 | Ga0307408_1000055984 | 563 |
| 1667 | 3300031548 | Ga0307408_100007559 | Ga0307408_1000075594 | 563 |
| 1668 | 3300031548 | Ga0307408_100019305 | Ga0307408_1000193052 | 563 |
| 1669 | 3300031665 | Ga0316575_10000018 | Ga0316575_1000001829 | 563 |
| 1670 | 3300031731 | Ga0307405_10001845 | Ga0307405_100018453 | 563 |
| 1671 | 3300031731 | Ga0307405_10015727 | Ga0307405_100157273 | 563 |
| 1672 | 3300031824 | Ga0307413_10001911 | Ga0307413_100019116 | 563 |
| 1673 | 3300031852 | Ga0307410_10000323 | Ga0307410_1000032310 | 563 |
| 1674 | 3300031852 | Ga0307410_10048087 | Ga0307410_100480871 | 563 |
| 1675 | 3300031901 | Ga0307406_10001419 | Ga0307406_100014196 | 563 |
| 1676 | 3300031901 | Ga0307406_10004754 | Ga0307406_100047544 | 563 |
| 1677 | 3300031903 | Ga0307407_10015535 | Ga0307407_100155353 | 563 |
| 1678 | 3300031903 | Ga0307407_10028232 | Ga0307407_100282322 | 563 |
| 1679 | 3300031911 | Ga0307412_10005539 | Ga0307412_100055395 | 563 |
| 1680 | 3300031911 | Ga0307412_10008137 | Ga0307412_100081374 | 563 |
| 1681 | 3300031995 | Ga0307409_100002136 | Ga0307409_1000021367 | 563 |
| 1682 | 3300031995 | Ga0307409_100002325 | Ga0307409_1000023254 | 563 |
| 1683 | 3300031995 | Ga0307409_100036390 | Ga0307409_1000363903 | 563 |
| 1684 | 3300032002 | Ga0307416_100000046 | Ga0307416_10000004612 | 563 |
| 1685 | 3300032002 | Ga0307416_100015813 | Ga0307416_1000158133 | 563 |
| 1686 | 3300032002 | Ga0307416_100028464 | Ga0307416_1000284643 | 563 |
| 1687 | 3300032005 | Ga0307411_10000436 | Ga0307411_1000043611 | 563 |
| 1688 | 3300037853 | Ga0436364_0214533 | Ga0436364_0214533_6002_7774 | 563 |
| 1689 | 3300044693 | Ga0466961_0027590 | Ga0466961_0027590_443_2197 | 563 |
| 1690 | 3300044765 | Ga0466970_0026285 | Ga0466970_0026285_291_2066 | 563 |
| 1691 | 3300044842 | Ga0466957_0092920 | Ga0466957_0092920_81_1856 | 563 |
| 1692 | 3300045836 | Ga0466958_0010462 | Ga0466958_0010462_1373_3127 | 563 |
| 1693 | 3300046476 | Ga0495662_0018560 | Ga0495662_0018560_988_2763 | 563 |
| 1694 | 3300046675 | Ga0495657_0005519 | Ga0495657_0005519_7617_9392 | 563 |
| 1695 | 3300046689 | Ga0495613_0028816 | Ga0495613_0028816_1439_3214 | 563 |
| 1696 | 3300048924 | Ga0496121_0000025 | Ga0496121_0000025_276210_277982 | 563 |
| 1697 | 3300048925 | Ga0496122_0032946 | Ga0496122_0032946_1811_3604 | 563 |
| 1698 | 3300048926 | Ga0496123_0013793 | Ga0496123_0013793_616_2409 | 563 |
| 1699 | 3300048929 | Ga0496126_0000565 | Ga0496126_0000565_66410_68170 | 563 |
| 1700 | 3300049569 | Ga0501032_0049949 | Ga0501032_0049949_430_2202 | 563 |
| 1701 | 3300049570 | Ga0501033_0034771 | Ga0501033_0034771_466_2307 | 563 |
| 1702 | 3300049571 | Ga0501034_0001887 | Ga0501034_0001887_23945_25708 | 563 |
| 1703 | 3300049571 | Ga0501034_0127799 | Ga0501034_0127799_598_2358 | 563 |
| 1704 | 3300049574 | Ga0501038_0107063 | Ga0501038_0107063_352_2127 | 563 |
| 1705 | 3300049574 | Ga0501038_0119122 | Ga0501038_0119122_39_1880 | 563 |
| 1706 | 3300049575 | Ga0501039_0037589 | Ga0501039_0037589_368_2143 | 563 |
| 1707 | 3300049578 | Ga0501042_0088366 | Ga0501042_0088366_23_1864 | 563 |
| 1708 | 3300049579 | Ga0501043_0063922 | Ga0501043_0063922_822_2594 | 563 |
| 1709 | 3300049579 | Ga0501043_0131504 | Ga0501043_0131504_141_1937 | 563 |
| 1710 | 3300049580 | Ga0501046_0055965 | Ga0501046_0055965_717_2558 | 563 |
| 1711 | 3300049581 | Ga0501047_0000597 | Ga0501047_0000597_29283_31055 | 563 |
| 1712 | 3300049581 | Ga0501047_0006639 | Ga0501047_0006639_1568_3328 | 563 |
| 1713 | 3300049581 | Ga0501047_0019762 | Ga0501047_0019762_2234_4009 | 563 |
| 1714 | 3300049582 | Ga0501048_0024811 | Ga0501048_0024811_1182_3023 | 563 |
| 1715 | 3300049586 | Ga0501070_0040363 | Ga0501070_0040363_1708_3483 | 563 |
| 1716 | 3300049588 | Ga0501072_0020326 | Ga0501072_0020326_811_2571 | 563 |
| 1717 | 3300049589 | Ga0501073_0011920 | Ga0501073_0011920_1240_3000 | 563 |
| 1718 | 3300049742 | Ga0501080_0000592 | Ga0501080_0000592_2074_3834 | 563 |
| 1719 | 3300049822 | Ga0501035_0004251 | Ga0501035_0004251_4264_6036 | 563 |
| 1720 | 3300049823 | Ga0501044_0003079 | Ga0501044_0003079_4995_6767 | 563 |
| 1721 | 3300053080 | Ga0500635_0002469 | Ga0500635_0002469_782_2557 | 563 |
| 1722 | 3300054114 | Ga0501084_0135333 | Ga0501084_0135333_137_1978 | 563 |
| 1723 | iso_pu_bacteria | 2643221635 | 2644197110 | 563 |
| 1724 | iso_pu_bacteria | 2791354901 | 2791917229 | 563 |
| 1725 | iso_pu_bacteria | 2808606447 | 2809226760 | 563 |
| 1726 | iso_pu_bacteria | 2863067949 | 2863073318 | 563 |
| 1727 | iso_pu_bacteria | 8056207758 | 8056209609 | 563 |
| 1728 | iso_pu_bacteria | 8057345674 | 8057345818 | 563 |
| 1729 | 3300002067 | JGI24735J21928_10007117 | JGI24735J21928_100071171 | 564 |
| 1730 | 3300003214 | JGI25165J46597_1000044 | JGI25165J46597_1000044197 | 564 |
| 1731 | 3300003578 | Ga0006562J51391_1022179 | Ga0006562J51391_10221791 | 564 |
| 1732 | 3300003578 | Ga0006562J51391_1059279 | Ga0006562J51391_10592793 | 564 |
| 1733 | 3300003752 | Ga0055539_1000027 | Ga0055539_1000027210 | 564 |
| 1734 | 3300003756 | Ga0055533_1000020 | Ga0055533_1000020210 | 564 |
| 1735 | 3300003759 | Ga0055525_1000151 | Ga0055525_100015178 | 564 |
| 1736 | 3300003760 | Ga0055527_1000005 | Ga0055527_1000005472 | 564 |
| 1737 | 3300003762 | Ga0055542_1000006 | Ga0055542_1000006472 | 564 |
| 1738 | 3300003763 | Ga0055529_1000400 | Ga0055529_100040025 | 564 |
| 1739 | 3300003841 | Ga0055541_1000508 | Ga0055541_10005087 | 564 |
| 1740 | 3300006051 | Ga0075364_10004093 | Ga0075364_100040934 | 564 |
| 1741 | 3300006946 | Ga0079104_1000016 | Ga0079104_1000016225 | 564 |
| 1742 | 3300009036 | Ga0105244_10054775 | Ga0105244_100547751 | 564 |
| 1743 | 3300009092 | Ga0105250_10009500 | Ga0105250_100095002 | 564 |
| 1744 | 3300009148 | Ga0105243_10085039 | Ga0105243_100850391 | 564 |
| 1745 | 3300013105 | Ga0157369_10092031 | Ga0157369_100920313 | 564 |
| 1746 | 3300013250 | Ga0171462_1001 | Ga0171462_1001362 | 564 |
| 1747 | 3300015262 | Ga0182007_10009441 | Ga0182007_100094414 | 564 |
| 1748 | 3300020082 | Ga0206353_10548390 | Ga0206353_105483905 | 564 |
| 1749 | 3300025225 | Ga0209566_100043 | Ga0209566_100043121 | 564 |
| 1750 | 3300025226 | Ga0209674_100001 | Ga0209674_1000013689 | 564 |
| 1751 | 3300025228 | Ga0209672_100003 | Ga0209672_100003814 | 564 |
| 1752 | 3300025229 | Ga0209147_100285 | Ga0209147_10028517 | 564 |
| 1753 | 3300025230 | Ga0209563_100001 | Ga0209563_1000013689 | 564 |
| 1754 | 3300025230 | Ga0209563_100222 | Ga0209563_1002226 | 564 |
| 1755 | 3300025231 | Ga0207427_100077 | Ga0207427_10007730 | 564 |
| 1756 | 3300025233 | Ga0209437_101291 | Ga0209437_1012915 | 564 |
| 1757 | 3300025242 | Ga0209258_102017 | Ga0209258_1020173 | 564 |
| 1758 | 3300025246 | Ga0209646_1000209 | Ga0209646_100020917 | 564 |
| 1759 | 3300025253 | Ga0209677_100001 | Ga0209677_1000013689 | 564 |
| 1760 | 3300025253 | Ga0209677_100723 | Ga0209677_1007233 | 564 |
| 1761 | 3300025254 | Ga0209148_1000004 | Ga0209148_10000041109 | 564 |
| 1762 | 3300025261 | Ga0209233_1000014 | Ga0209233_1000014196 | 564 |
| 1763 | 3300025272 | Ga0209455_1000046 | Ga0209455_1000046128 | 564 |
| 1764 | 3300025934 | Ga0207686_10012807 | Ga0207686_100128074 | 564 |
| 1765 | 3300025935 | Ga0207709_10001930 | Ga0207709_100019301 | 564 |
| 1766 | 3300025935 | Ga0207709_10016612 | Ga0207709_100166122 | 564 |
| 1767 | 3300027111 | Ga0209281_1000017 | Ga0209281_1000017235 | 564 |
| 1768 | 3300031901 | Ga0307406_10000126 | Ga0307406_100001263 | 564 |
| 1769 | 3300031901 | Ga0307406_10002924 | Ga0307406_100029246 | 564 |
| 1770 | 3300031911 | Ga0307412_10064512 | Ga0307412_100645122 | 564 |
| 1771 | 3300044658 | Ga0466972_0038856 | Ga0466972_0038856_124_1887 | 564 |
| 1772 | 3300044765 | Ga0466970_0036219 | Ga0466970_0036219_544_2307 | 564 |
| 1773 | 3300048916 | Ga0496113_0022948 | Ga0496113_0022948_536_2293 | 564 |
| 1774 | 3300048920 | Ga0496117_0000028 | Ga0496117_0000028_92892_94658 | 564 |
| 1775 | 3300048920 | Ga0496117_0000827 | Ga0496117_0000827_46091_47857 | 564 |
| 1776 | 3300048920 | Ga0496117_0001658 | Ga0496117_0001658_25132_26898 | 564 |
| 1777 | 3300048920 | Ga0496117_0013171 | Ga0496117_0013171_2604_4367 | 564 |
| 1778 | 3300048922 | Ga0496119_0001365 | Ga0496119_0001365_15616_17382 | 564 |
| 1779 | 3300048922 | Ga0496119_0003323 | Ga0496119_0003323_4075_5841 | 564 |
| 1780 | 3300048922 | Ga0496119_0015916 | Ga0496119_0015916_667_2433 | 564 |
| 1781 | 3300048922 | Ga0496119_0018005 | Ga0496119_0018005_1714_3480 | 564 |
| 1782 | 3300048923 | Ga0496120_0000622 | Ga0496120_0000622_32941_34707 | 564 |
| 1783 | 3300048923 | Ga0496120_0001791 | Ga0496120_0001791_12323_14089 | 564 |
| 1784 | 3300048923 | Ga0496120_0034461 | Ga0496120_0034461_325_2091 | 564 |
| 1785 | 3300048925 | Ga0496122_0000020 | Ga0496122_0000020_297405_299171 | 564 |
| 1786 | 3300048925 | Ga0496122_0000522 | Ga0496122_0000522_12638_14404 | 564 |
| 1787 | 3300048925 | Ga0496122_0106083 | Ga0496122_0106083_56_1822 | 564 |
| 1788 | 3300048926 | Ga0496123_0000003 | Ga0496123_0000003_512529_514295 | 564 |
| 1789 | 3300048926 | Ga0496123_0000251 | Ga0496123_0000251_100953_102719 | 564 |
| 1790 | 3300048926 | Ga0496123_0003958 | Ga0496123_0003958_3983_5749 | 564 |
| 1791 | 3300048927 | Ga0496124_0001543 | Ga0496124_0001543_1034_2800 | 564 |
| 1792 | 3300048927 | Ga0496124_0009389 | Ga0496124_0009389_5933_7699 | 564 |
| 1793 | 3300048927 | Ga0496124_0023563 | Ga0496124_0023563_1509_3275 | 564 |
| 1794 | 3300048928 | Ga0496125_0004896 | Ga0496125_0004896_3112_4878 | 564 |
| 1795 | 3300048928 | Ga0496125_0006622 | Ga0496125_0006622_3329_5095 | 564 |
| 1796 | 3300048928 | Ga0496125_0006849 | Ga0496125_0006849_165_1931 | 564 |
| 1797 | 3300048928 | Ga0496125_0025735 | Ga0496125_0025735_3152_4918 | 564 |
| 1798 | 3300048928 | Ga0496125_0099525 | Ga0496125_0099525_193_1959 | 564 |
| 1799 | 3300048929 | Ga0496126_0012464 | Ga0496126_0012464_5357_7123 | 564 |
| 1800 | 3300048929 | Ga0496126_0030560 | Ga0496126_0030560_56_1822 | 564 |
| 1801 | 3300048929 | Ga0496126_0030579 | Ga0496126_0030579_2972_4738 | 564 |
| 1802 | 3300049571 | Ga0501034_0049750 | Ga0501034_0049750_1770_3539 | 564 |
| 1803 | 3300049574 | Ga0501038_0124322 | Ga0501038_0124322_56_1825 | 564 |
| 1804 | 3300049586 | Ga0501070_0000701 | Ga0501070_0000701_22411_24177 | 564 |
| 1805 | 3300050492 | nmdc:mga0yw44_11425_c1 | nmdc:mga0yw44_11425_c1_2248_4014 | 564 |
| 1806 | iso_pu_bacteria | 2643221549 | 2643768205 | 564 |
| 1807 | iso_pu_bacteria | 2643221619 | 2644111634 | 564 |
| 1808 | iso_pu_bacteria | 2721755702 | 2723642958 | 564 |
| 1809 | iso_pu_bacteria | 2738541272 | 2738693100 | 564 |
| 1810 | iso_pu_bacteria | 2738543027 | 2739323326 | 564 |
| 1811 | iso_pu_bacteria | 2773857759 | 2774383597 | 564 |
| 1812 | iso_pu_bacteria | 2795385472 | 2795796384 | 564 |
| 1813 | iso_pu_bacteria | 2808606306 | 2808631853 | 564 |
| 1814 | iso_pu_bacteria | 2808606371 | 2808895753 | 564 |
| 1815 | iso_pu_bacteria | 2808606372 | 2808902945 | 564 |
| 1816 | iso_pu_bacteria | 2808606700 | 2810363359 | 564 |
| 1817 | iso_pu_bacteria | 2816332119 | 2816423748 | 564 |
| 1818 | iso_pu_bacteria | 2816332305 | 2817509613 | 564 |
| 1819 | iso_pu_bacteria | 2857632687 | 2857635073 | 564 |
| 1820 | iso_pu_bacteria | 2870804320 | 2870806122 | 564 |
| 1821 | iso_pu_bacteria | 2905926851 | 2905929718 | 564 |
| 1822 | iso_pu_bacteria | 2919443155 | 2919443517 | 564 |
| 1823 | iso_pu_bacteria | 2920879853 | 2920883593 | 564 |
| 1824 | iso_pu_bacteria | 2928104781 | 2928105931 | 564 |
| 1825 | iso_pu_bacteria | 2935409751 | 2935412268 | 564 |
| 1826 | iso_pu_bacteria | 2946059875 | 2946063499 | 564 |
| 1827 | iso_pu_bacteria | 8056579771 | 8056580801 | 564 |
| 1828 | 3300006846 | Ga0075430_100079552 | Ga0075430_1000795521 | 565 |
| 1829 | 3300006880 | Ga0075429_100081459 | Ga0075429_1000814593 | 565 |
| 1830 | 3300009176 | Ga0105242_10001582 | Ga0105242_100015828 | 565 |
| 1831 | 3300025935 | Ga0207709_10004881 | Ga0207709_100048816 | 565 |
| 1832 | 3300025945 | Ga0207679_10078159 | Ga0207679_100781592 | 565 |
| 1833 | 3300031852 | Ga0307410_10017434 | Ga0307410_100174343 | 565 |
| 1834 | 3300032126 | Ga0307415_100031243 | Ga0307415_1000312433 | 565 |
| 1835 | 3300044683 | Ga0466965_0028398 | Ga0466965_0028398_474_2240 | 565 |
| 1836 | 3300048904 | Ga0496101_0006147 | Ga0496101_0006147_831_2600 | 565 |
| 1837 | 3300048905 | Ga0496102_0011485 | Ga0496102_0011485_5700_7469 | 565 |
| 1838 | 3300048906 | Ga0496103_0009243 | Ga0496103_0009243_3920_5689 | 565 |
| 1839 | 3300048907 | Ga0496104_0092129 | Ga0496104_0092129_198_1967 | 565 |
| 1840 | 3300048910 | Ga0496107_0028614 | Ga0496107_0028614_72_1841 | 565 |
| 1841 | 3300048912 | Ga0496109_0051803 | Ga0496109_0051803_342_2111 | 565 |
| 1842 | 3300048915 | Ga0496112_0081252 | Ga0496112_0081252_357_2126 | 565 |
| 1843 | 3300048918 | Ga0496115_0034135 | Ga0496115_0034135_683_2452 | 565 |
| 1844 | 3300048918 | Ga0496115_0047192 | Ga0496115_0047192_1362_3131 | 565 |
| 1845 | 3300048920 | Ga0496117_0000084 | Ga0496117_0000084_212229_214022 | 565 |
| 1846 | 3300048920 | Ga0496117_0009224 | Ga0496117_0009224_244_1974 | 565 |
| 1847 | 3300048927 | Ga0496124_0058064 | Ga0496124_0058064_272_2002 | 565 |
| 1848 | 3300048928 | Ga0496125_0035820 | Ga0496125_0035820_2250_3980 | 565 |
| 1849 | 3300050496 | nmdc:mga07m45_1731_c1 | nmdc:mga07m45_1731_c1_3932_5662 | 565 |
| 1850 | iso_pu_bacteria | 2738543005 | 2739202970 | 565 |
| 1851 | iso_pu_bacteria | 2738543011 | 2739236528 | 565 |
| 1852 | iso_pu_bacteria | 2751185788 | 2753302607 | 565 |
| 1853 | iso_pu_bacteria | 2775506735 | 2775656341 | 565 |
| 1854 | iso_pu_bacteria | 2808606357 | 2808830542 | 565 |
| 1855 | iso_pu_bacteria | 2808606360 | 2808851737 | 565 |
| 1856 | iso_pu_bacteria | 2811994871 | 2812321902 | 565 |
| 1857 | iso_pu_bacteria | 2844849076 | 2844852090 | 565 |
| 1858 | iso_pu_bacteria | 2857479173 | 2857480526 | 565 |
| 1859 | iso_pu_bacteria | 2866612099 | 2866618838 | 565 |
| 1860 | iso_pu_bacteria | 2889300758 | 2889306014 | 565 |
| 1861 | iso_pu_bacteria | 2899370129 | 2899375115 | 565 |
| 1862 | iso_pu_bacteria | 2904501621 | 2904503902 | 565 |
| 1863 | iso_pu_bacteria | 2908674828 | 2908676868 | 565 |
| 1864 | iso_pu_bacteria | 2909074476 | 2909076942 | 565 |
| 1865 | iso_pu_bacteria | 2919039151 | 2919039551 | 565 |
| 1866 | iso_pu_bacteria | 2919042368 | 2919042950 | 565 |
| 1867 | iso_pu_bacteria | 2928142448 | 2928142809 | 565 |
| 1868 | iso_pu_bacteria | 2928500415 | 2928502010 | 565 |
| 1869 | iso_pu_bacteria | 2939598168 | 2939599858 | 565 |
| 1870 | iso_pu_bacteria | 2939743619 | 2939744151 | 565 |
| 1871 | iso_pu_bacteria | 2945916053 | 2945919772 | 565 |
| 1872 | iso_pu_bacteria | 2953998280 | 2954001138 | 565 |
| 1873 | iso_pu_bacteria | 8004021418 | 8004023959 | 565 |
| 1874 | iso_pu_bacteria | 8004025490 | 8004028795 | 565 |
| 1875 | 3300006186 | Ga0075369_10001262 | Ga0075369_100012626 | 566 |
| 1876 | 3300011119 | Ga0105246_10051663 | Ga0105246_100516631 | 566 |
| 1877 | 3300026118 | Ga0207675_100021530 | Ga0207675_1000215304 | 566 |
| 1878 | 3300050516 | nmdc:mga0sz30_2197_c2 | nmdc:mga0sz30_2197_c2_327_2102 | 566 |
| 1879 | iso_pu_bacteria | 2565956761 | 2566991958 | 566 |
| 1880 | iso_pu_bacteria | 2582580736 | 2583152394 | 566 |
| 1881 | iso_pu_bacteria | 2738541308 | 2738887266 | 566 |
| 1882 | iso_pu_bacteria | 2744054611 | 2744956940 | 566 |
| 1883 | iso_pu_bacteria | 2808606370 | 2808894804 | 566 |
| 1884 | iso_pu_bacteria | 2899359706 | 2899366776 | 566 |
| 1885 | iso_pu_bacteria | 2917736166 | 2917737593 | 566 |
| 1886 | iso_pu_bacteria | 2922554459 | 2922559371 | 566 |
| 1887 | iso_pu_bacteria | 2932398195 | 2932398332 | 566 |
| 1888 | iso_pu_bacteria | 2945920336 | 2945924326 | 566 |
| 1889 | iso_pu_bacteria | 2945941187 | 2945943956 | 566 |
| 1890 | iso_pu_bacteria | 2946037020 | 2946039910 | 566 |
| 1891 | iso_pu_bacteria | 3007872151 | 3007873750 | 566 |
| 1892 | iso_pu_bacteria | 8003314358 | 8003323314 | 566 |
| 1893 | iso_pu_bacteria | 2523231044 | 2523385719 | 567 |
| 1894 | iso_pu_bacteria | 2585427649 | 2586064271 | 567 |
| 1895 | iso_pu_bacteria | 2643221683 | 2644466496 | 567 |
| 1896 | iso_pu_bacteria | 2643221692 | 2644515145 | 567 |
| 1897 | iso_pu_bacteria | 2738541277 | 2738721888 | 567 |
| 1898 | iso_pu_bacteria | 2738543019 | 2739282252 | 567 |
| 1899 | iso_pu_bacteria | 2808606522 | 2809586479 | 567 |
| 1900 | iso_pu_bacteria | 2857479173 | 2857479858 | 567 |
| 1901 | iso_pu_bacteria | 2857632687 | 2857634456 | 567 |
| 1902 | iso_pu_bacteria | 2857740372 | 2857740404 | 567 |
| 1903 | iso_pu_bacteria | 2870801768 | 2870803133 | 567 |
| 1904 | iso_pu_bacteria | 2870804320 | 2870805188 | 567 |
| 1905 | iso_pu_bacteria | 2891373044 | 2891376019 | 567 |
| 1906 | iso_pu_bacteria | 2904497146 | 2904499473 | 567 |
| 1907 | iso_pu_bacteria | 2904776348 | 2904778564 | 567 |
| 1908 | iso_pu_bacteria | 2919059106 | 2919060631 | 567 |
| 1909 | iso_pu_bacteria | 2919538618 | 2919538861 | 567 |
| 1910 | iso_pu_bacteria | 2932422444 | 2932422830 | 567 |
| 1911 | iso_pu_bacteria | 2933418574 | 2933418953 | 567 |
| 1912 | iso_pu_bacteria | 2939647034 | 2939648099 | 567 |
| 1913 | 3300003781 | Ga0055536_1003520 | Ga0055536_10035203 | 568 |
| 1914 | 3300003792 | Ga0055540_1002446 | Ga0055540_10024463 | 568 |
| 1915 | 3300003794 | Ga0055531_10001546 | Ga0055531_1000154613 | 568 |
| 1916 | 3300005367 | Ga0070667_100034330 | Ga0070667_1000343302 | 568 |
| 1917 | 3300025292 | Ga0209676_1000961 | Ga0209676_100096117 | 568 |
| 1918 | 3300025298 | Ga0209050_1000884 | Ga0209050_100088418 | 568 |
| 1919 | 3300025303 | Ga0209051_1000830 | Ga0209051_100083014 | 568 |
| 1920 | 3300025304 | Ga0209257_1000172 | Ga0209257_100017218 | 568 |
| 1921 | 3300025893 | Ga0207682_10025978 | Ga0207682_100259782 | 568 |
| 1922 | 3300025986 | Ga0207658_10061919 | Ga0207658_100619192 | 568 |
| 1923 | 3300046558 | Ga0495633_0000657 | Ga0495633_0000657_21901_23625 | 568 |
| 1924 | 3300046674 | Ga0495588_0012941 | Ga0495588_0012941_1357_3093 | 568 |
| 1925 | 3300048903 | Ga0496100_0009305 | Ga0496100_0009305_2843_4579 | 568 |
| 1926 | 3300048905 | Ga0496102_0021055 | Ga0496102_0021055_2398_4134 | 568 |
| 1927 | 3300048906 | Ga0496103_0030937 | Ga0496103_0030937_1188_2924 | 568 |
| 1928 | 3300048907 | Ga0496104_0010383 | Ga0496104_0010383_5001_6737 | 568 |
| 1929 | 3300048909 | Ga0496106_0030266 | Ga0496106_0030266_940_2676 | 568 |
| 1930 | 3300048916 | Ga0496113_0051703 | Ga0496113_0051703_1158_2894 | 568 |
| 1931 | 3300048929 | Ga0496126_0000918 | Ga0496126_0000918_5125_6861 | 568 |
| 1932 | iso_pu_bacteria | 2671180115 | 2671584449 | 568 |
| 1933 | iso_pu_bacteria | 2738541307 | 2738882064 | 568 |
| 1934 | iso_pu_bacteria | 2929160207 | 2929165892 | 568 |
| 1935 | iso_pu_bacteria | 2929212328 | 2929214141 | 568 |
| 1936 | iso_pu_bacteria | 2941479691 | 2941481551 | 568 |
| 1937 | iso_pu_bacteria | 2513020051 | 2513227555 | 569 |
| 1938 | iso_pu_bacteria | 2547132424 | 2548693413 | 569 |
| 1939 | iso_pu_bacteria | 2551306166 | 2552106125 | 569 |
| 1940 | iso_pu_bacteria | 2599185155 | 2599327355 | 569 |
| 1941 | iso_pu_bacteria | 2599185214 | 2599621826 | 569 |
| 1942 | iso_pu_bacteria | 2599185226 | 2599670490 | 569 |
| 1943 | iso_pu_bacteria | 2599185227 | 2599678980 | 569 |
| 1944 | iso_pu_bacteria | 2599185229 | 2599691337 | 569 |
| 1945 | iso_pu_bacteria | 2643221658 | 2644327015 | 569 |
| 1946 | iso_pu_bacteria | 2643221672 | 2644398816 | 569 |
| 1947 | iso_pu_bacteria | 2818991446 | 2819597993 | 569 |
| 1948 | iso_pu_bacteria | 2826581358 | 2826585347 | 569 |
| 1949 | iso_pu_bacteria | 2831265667 | 2831268985 | 569 |
| 1950 | iso_pu_bacteria | 2838054893 | 2838058411 | 569 |
| 1951 | iso_pu_bacteria | 2842815866 | 2842820442 | 569 |
| 1952 | iso_pu_bacteria | 2842849001 | 2842849054 | 569 |
| 1953 | iso_pu_bacteria | 2842888712 | 2842892102 | 569 |
| 1954 | iso_pu_bacteria | 2885198086 | 2885203848 | 569 |
| 1955 | iso_pu_bacteria | 2885211737 | 2885217817 | 569 |
| 1956 | iso_pu_bacteria | 2899924645 | 2899929412 | 569 |
| 1957 | iso_pu_bacteria | 2902792274 | 2902799358 | 569 |
| 1958 | iso_pu_bacteria | 2919713450 | 2919718527 | 569 |
| 1959 | iso_pu_bacteria | 2928037797 | 2928040144 | 569 |
| 1960 | iso_pu_bacteria | 2928044640 | 2928047107 | 569 |
| 1961 | iso_pu_bacteria | 2928051484 | 2928057689 | 569 |
| 1962 | iso_pu_bacteria | 2928064002 | 2928067928 | 569 |
| 1963 | iso_pu_bacteria | 2928070936 | 2928072494 | 569 |
| 1964 | iso_pu_bacteria | 2928084124 | 2928085691 | 569 |
| 1965 | iso_pu_bacteria | 8056137416 | 8056139705 | 569 |
| 1966 | iso_pu_bacteria | 2513237165 | 2514041943 | 570 |
| 1967 | iso_pu_bacteria | 2619619299 | 2621300000 | 570 |
| 1968 | iso_pu_bacteria | 2721755523 | 2722881726 | 570 |
| 1969 | iso_pu_bacteria | 2738541265 | 2738670000 | 570 |
| 1970 | iso_pu_bacteria | 2738541282 | 2738748393 | 570 |
| 1971 | iso_pu_bacteria | 2738541303 | 2738857435 | 570 |
| 1972 | iso_pu_bacteria | 2816332298 | 2817491296 | 570 |
| 1973 | iso_pu_bacteria | 2834641062 | 2834644366 | 570 |
| 1974 | iso_pu_bacteria | 2839138175 | 2839143435 | 570 |
| 1975 | iso_pu_bacteria | 2842718218 | 2842718929 | 570 |
| 1976 | iso_pu_bacteria | 2894023352 | 2894023849 | 570 |
| 1977 | iso_pu_bacteria | 2904479285 | 2904481882 | 570 |
| 1978 | iso_pu_bacteria | 2945984333 | 2945990116 | 570 |
| 1979 | iso_pu_bacteria | 2974320154 | 2974320215 | 570 |
| 1980 | iso_pu_bacteria | 2979089926 | 2979090825 | 570 |
| 1981 | iso_pu_bacteria | 2979095461 | 2979096349 | 570 |
| 1982 | iso_pu_bacteria | 650716007 | 650843537 | 570 |
| 1983 | iso_pu_bacteria | 8003400568 | 8003404232 | 570 |
| 1984 | 3300003187 | JGI25151J46595_10014470 | JGI25151J46595_100144701 | 571 |
| 1985 | 3300009148 | Ga0105243_10002952 | Ga0105243_100029529 | 571 |
| 1986 | 3300025294 | Ga0209025_1000086 | Ga0209025_1000086125 | 571 |
| 1987 | 3300025935 | Ga0207709_10000433 | Ga0207709_100004338 | 571 |
| 1988 | 3300042115 | Ga0450911_000036 | Ga0450911_000036_19810_21534 | 571 |
| 1989 | 3300048920 | Ga0496117_0020415 | Ga0496117_0020415_534_2291 | 571 |
| 1990 | 3300048927 | Ga0496124_0001325 | Ga0496124_0001325_8330_10054 | 571 |
| 1991 | 3300048927 | Ga0496124_0097865 | Ga0496124_0097865_220_1944 | 571 |
| 1992 | 3300048928 | Ga0496125_0002973 | Ga0496125_0002973_16920_18644 | 571 |
| 1993 | 3300009176 | Ga0105242_10088615 | Ga0105242_100886151 | 572 |
| 1994 | 3300025291 | Ga0209675_1004266 | Ga0209675_10042663 | 572 |
| 1995 | 3300025294 | Ga0209025_1041585 | Ga0209025_10415851 | 572 |
| 1996 | 3300025934 | Ga0207686_10106914 | Ga0207686_101069142 | 572 |
| 1997 | 3300048919 | Ga0496116_0024962 | Ga0496116_0024962_182_1909 | 572 |
| 1998 | 3300048926 | Ga0496123_0020352 | Ga0496123_0020352_1349_3076 | 572 |
| 1999 | 2162886011 | MRS1b_contig_5332385 | MRS1b_0430.00001960 | 573 |
| 2000 | 3300005290 | Ga0065712_10071676 | Ga0065712_100716762 | 573 |
| 2001 | 3300009036 | Ga0105244_10000125 | Ga0105244_1000012541 | 573 |
| 2002 | 3300011119 | Ga0105246_10045538 | Ga0105246_100455382 | 573 |
| 2003 | 3300025728 | Ga0207655_1010439 | Ga0207655_10104394 | 573 |
| 2004 | 3300027296 | Ga0209389_1000059 | Ga0209389_100005911 | 573 |
| 2005 | 3300042137 | Ga0450902_000354 | Ga0450902_000354_3398_5137 | 573 |
| 2006 | 3300042142 | Ga0450905_003021 | Ga0450905_003021_139_1878 | 573 |
| 2007 | 3300042533 | Ga0450901_000013 | Ga0450901_000013_3130_4869 | 573 |
| 2008 | 3300049568 | Ga0501031_0003815 | Ga0501031_0003815_3392_5128 | 573 |
| 2009 | 3300013104 | Ga0157370_10011155 | Ga0157370_100111558 | 574 |
| 2010 | 3300025294 | Ga0209025_1000822 | Ga0209025_100082230 | 574 |
| 2011 | 3300042876 | Ga0451577_0020062 | Ga0451577_0020062_1794_3527 | 574 |
| 2012 | 3300044673 | Ga0453683_0007877 | Ga0453683_0007877_1832_3565 | 574 |
| 2013 | 3300044712 | Ga0453684_0039654 | Ga0453684_0039654_2096_3829 | 574 |
| 2014 | 3300045051 | Ga0451576_0018666 | Ga0451576_0018666_1618_3351 | 574 |
| 2015 | 3300048925 | Ga0496122_0040836 | Ga0496122_0040836_1581_3314 | 574 |
| 2016 | 3300048926 | Ga0496123_0041591 | Ga0496123_0041591_376_2115 | 574 |
| 2017 | 3300048928 | Ga0496125_0005318 | Ga0496125_0005318_11348_13087 | 574 |
| 2018 | 3300049571 | Ga0501034_0000163 | Ga0501034_0000163_119672_121402 | 574 |
| 2019 | 2162886007 | SwRhRL2b_contig_2512745 | SwRhRL2b_0748.00004260 | 575 |
| 2020 | 3300005262 | Ga0065165_1000076 | Ga0065165_100007693 | 575 |
| 2021 | 3300005289 | Ga0065704_10075631 | Ga0065704_100756313 | 575 |
| 2022 | 3300053153 | Ga0500616_0009763 | Ga0500616_0009763_924_2663 | 575 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mlk-assembly1.cif.gz_A | biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285) | 0.9847 | 2 | 454 |
| 5mlk-assembly1.cif.gz_B | biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285) | 0.9799 | 2 | 454 |
| 5mlk-assembly1.cif.gz_A | biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285) | 0.9782 | 2 | 454 |
| 3ouu-assembly1.cif.gz_A | crystal structure of biotin carboxylase-beta-gamma-atp complex from campylobacter jejuni | 0.9738 | 1 | 444 |
| 5mlk-assembly1.cif.gz_B | biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285) | 0.9723 | 2 | 454 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P96890_142_212_3.30.1490.20 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain | 1.002 | 132 | 202 | 3.30.1490.20 |
| af_Q4CS16_606_674_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.991 | 509 | 575 | 2.40.50.100 |
| af_P96890_142_212_3.30.1490.20 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain | 0.9885 | 132 | 202 | 3.30.1490.20 |
| 5mlkB02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.988 | 202 | 454 | 3.30.470.20 |
| 5mlkA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9851 | 87 | 454 | 3.30.470.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N9Y8D7-F1-model_v4 | deleted | 0.9937 | 213 | 430 |
|
| AF-A0A2T4S5Z1-F1-model_v4 | Acetyl-CoA carboxylase biotin carboxylase subunit | 0.989 | 3 | 111 |
GO:0005524
GO:0016874 |
| AF-A0A323V7T1-F1-model_v4 | biotin carboxylase (EC 6.3.4.14) | 0.9889 | 2 | 78 |
GO:0005524
GO:0016874 |
| AF-A0A2N0SS15-F1-model_v4 | biotin carboxylase (EC 6.3.4.14) | 0.9877 | 4 | 81 |
GO:0005524
GO:0016874 |
| AF-A0A4Z1CG50-F1-model_v4 | Acetyl-CoA carboxylase biotin carboxyl carrier protein subunit | 0.9865 | 501 | 575 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar