F496273

General Info

Members Datasets Scaffolds Average Seq Length
2022 926 1595 569

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0000883|Ga0501046_0000883_10380_12320
Length 637
Sequence MNLPASPMTRLAPDTRISLRGDLDVIAVTSPVGPWAGTVGPFADSGRIRGETTLSKPLGKVLIANRGEIAVRVIRACKDAGIGSVAVYADPDRDALHVRLADEAYSLEGATPADSYLSIEKIVDVALRSGADSVHPGYGFLAENADFAQAVLDAGLTWIGPSPAAIDALGDKAKAKHIAQKANAPLAPGTKDPVKDADEVIAFAREFGLPVAIKAVFGGGGRGLKVARTLEEIPDAYESAVREAVTAFGRGECLVEKFLDKPRHVETQCLADSHGNVVVISTRDCSLQRRHQKLVEEAPAPFLTDDQMKRLYDSSKAILKEAGYVGAGTCEFLVAADGTISFLEVNTRLQVEHCVSEEVTGIDLVREMFRIAAGEELGYDDPDIRGHAIEFRINAEDGGRNFMPAPGTLTEWAPPQGPGVRVDGGYEKGETIPGSFDSLIAKLIVSGRDRTQALERSRRALAEFQVDGMPTVIPFHRAIVSDPAYVGSSNPTGEGSFDVYTTWIETEFDNQIQPYDGEPGEAAEAGERQTVVVEVGGKRIDVVIPAGLGGLSAGSAXXXXKKPKRVSGDAVTSPMQGTVVKVVVEEGQEVAEGDTVVVIEAMKMEQPLKAHKAGTITGLSAAVGETVTNGAVICEIK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2508501039 Frankia saprophytica CN3 Isolate Nodule
4 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
5 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
6 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
7 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
8 2517572101 Frankia sp. DC12 Isolate Nodule
9 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
10 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
11 2527291627 Frankia casuarinae Thr Isolate Nodule
12 2527291629 Frankia sp. BMG5.23 Isolate Nodule
13 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
14 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
15 2547132424 Nocardia nova SH22a Isolate Unclassified
16 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
17 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
18 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
19 2558860280 Kutzneria sp. 744 Isolate Unclassified
20 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
21 2576861822 Frankia sp. CeD Isolate Nodule
22 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
23 2582580736 Prauserella sp. Am3 Isolate Unclassified
24 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
25 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
26 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
27 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
28 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
29 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
30 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
31 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
32 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
33 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
34 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
35 2619618881 Frankia sp. ACN1ag Isolate Unclassified
36 2619619003 Frankia sp. CpI1-P Isolate Nodule
37 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
38 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
39 2626541554 Frankia sp. AvcI.1 Isolate Nodule
40 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
41 2643221546 Microbacterium sp. Root53 Isolate Unclassified
42 2643221548 Streptomyces sp. Root55 Isolate Unclassified
43 2643221549 Agromyces sp. Root1464 Isolate Unclassified
44 2643221553 Microbacterium sp. Root553 Isolate Unclassified
45 2643221561 Nocardioides sp. Root151 Isolate Unclassified
46 2643221566 Microbacterium sp. Root166 Isolate Unclassified
47 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
48 2643221575 Microbacterium sp. Root61 Isolate Unclassified
49 2643221576 Nocardioides sp. Root614 Isolate Unclassified
50 2643221578 Streptomyces sp. Root63 Isolate Unclassified
51 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
52 2643221590 Nocardioides sp. Root682 Isolate Unclassified
53 2643221597 Microbacterium sp. Root180 Isolate Unclassified
54 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
55 2643221604 Nocardioides sp. Root190 Isolate Unclassified
56 2643221615 Nocardioides sp. Root224 Isolate Unclassified
57 2643221616 Leifsonia sp. Root227 Isolate Unclassified
58 2643221617 Nocardioides sp. Root79 Isolate Unclassified
59 2643221619 Agromyces sp. Root81 Isolate Unclassified
60 2643221620 Nocardioides sp. Root240 Isolate Unclassified
61 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
62 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
63 2643221630 Microbacterium sp. Root322 Isolate Unclassified
64 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
65 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
66 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
67 2643221641 Nocardioides sp. Root122 Isolate Unclassified
68 2643221647 Streptomyces sp. Root369 Isolate Unclassified
69 2643221649 Leifsonia sp. Root4 Isolate Unclassified
70 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
71 2643221658 Variovorax sp. Root411 Isolate Unclassified
72 2643221670 Streptomyces sp. Root431 Isolate Unclassified
73 2643221672 Variovorax sp. Root434 Isolate Unclassified
74 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
75 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
76 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
77 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
78 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
79 2643221683 Variovorax sp. Root473 Isolate Unclassified
80 2643221692 Nocardia sp. Root136 Isolate Unclassified
81 2643221696 Nocardioides sp. Root140 Isolate Unclassified
82 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
83 2643221711 Terrabacter sp. Root85 Isolate Unclassified
84 2643221714 Streptomyces sp. Root264 Isolate Unclassified
85 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
86 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
87 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
88 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
89 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
90 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
91 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
92 2684623036 Frankia sp. CgIM4 Isolate Nodule
93 2687453737 Frankia sp. BMG5.36 Isolate Nodule
94 2710264753 Frankia sp. KB5 Isolate Nodule
95 2721755523 Delftia sp. HK171 Isolate Unclassified
96 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
97 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
98 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
99 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
100 2738541277 Variovorax sp. GV051 Isolate Unclassified
101 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
102 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
103 2738541305 Nocardioides sp. CF167 Isolate Unclassified
104 2738541307 Variovorax sp. GV008 Isolate Unclassified
105 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
106 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
107 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
108 2738543019 Variovorax sp. GV040 Isolate Unclassified
109 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
110 2739367898 Nocardioides sp. CF479 Isolate Unclassified
111 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
112 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
113 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
114 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
115 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
116 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
117 2773857759 Microbacterium sp. 1294 Isolate Unclassified
118 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
119 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
120 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
121 2773857924 Frankia sp. CgIS1 Isolate Nodule
122 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
123 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
124 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
125 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
126 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
127 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
128 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
129 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
130 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
131 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
132 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
133 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
134 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
135 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
136 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
137 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
138 2808606372 Agromyces sp. 23-23 Isolate Unclassified
139 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
140 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
141 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
142 2808606448 Streptomyces sp. 193411 Isolate Unclassified
143 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
144 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
145 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
146 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
147 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
148 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
149 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
150 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
151 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
152 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
153 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
154 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
155 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
156 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
157 2818991446 Variovorax sp. 1180 Isolate Unclassified
158 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
159 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
160 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
161 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
162 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
163 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
164 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
165 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
166 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
167 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
168 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
169 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
170 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
171 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
172 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
173 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
174 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
175 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
176 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
177 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
178 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
179 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
180 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
181 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
182 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
183 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
184 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
185 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
186 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
187 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
188 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
189 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
190 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
191 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
192 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
193 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
194 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
195 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
196 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
197 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
198 2862574272 Streptomyces sp. AcE210 Isolate Nodule
199 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
200 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
201 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
202 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
203 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
204 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
205 2867369537 Streptomyces sp. Z26 Isolate Unclassified
206 2867428634 Streptomyces sp. RP5T Isolate Unclassified
207 2867475112 Streptomyces sp. TM32 Isolate Unclassified
208 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
209 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
210 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
211 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
212 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
213 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
214 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
215 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
216 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
217 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
218 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
219 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
220 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
221 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
222 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
223 2885198086 Variovorax sp. 679 Isolate Unclassified
224 2885211737 Variovorax sp. 553 Isolate Unclassified
225 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
226 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
227 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
228 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
229 2891562705 Microbispora tritici MT50 Isolate Unclassified
230 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
231 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
232 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
233 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
234 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
235 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
236 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
237 2899924645 Variovorax sp. 369 Isolate Unclassified
238 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
239 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
240 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
241 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
242 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
243 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
244 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
245 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
246 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
247 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
248 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
249 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
250 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
251 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
252 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
253 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
254 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
255 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
256 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
257 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
258 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
259 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
260 2919069694 Microbacterium sp. 1154 Isolate Unclassified
261 2919395869 Microbacterium resistens 2980 Isolate Unclassified
262 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
263 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
264 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
265 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
266 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
267 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
268 2920879853 Kocuria salina CV6 Isolate Unclassified
269 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
270 2922554459 Rhodococcus sp. 66b Isolate Unclassified
271 2928037797 Variovorax sp. 1126 Isolate Unclassified
272 2928044640 Variovorax sp. 1128 Isolate Unclassified
273 2928051484 Variovorax sp. 1133 Isolate Unclassified
274 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
275 2928070936 Variovorax gossypii 1167 Isolate Unclassified
276 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
277 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
278 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
279 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
280 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
281 2928153084 Leifsonia sp. 563 Isolate Unclassified
282 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
283 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
284 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
285 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
286 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
287 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
288 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
289 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
290 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
291 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
292 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
293 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
294 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
295 2941479691
296 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
297 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
298 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
299 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
300 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
301 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
302 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
303 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
304 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
305 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
306 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
307 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
308 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
309 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
310 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
311 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
312 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
313 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
314 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
315 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
316 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
317 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
318 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
319 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
320 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
321 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
322 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
323 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
324 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
325 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
326 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
327 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
328 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
329 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
330 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
331 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
332 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
333 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
334 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
335 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
336 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
337 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
338 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
339 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
340 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
341 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
342 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
343 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
344 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
345 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
346 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
347 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
348 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
349 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
350 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
351 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
352 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
353 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
354 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
355 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
356 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
357 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
358 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
359 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
360 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
361 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
362 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
363 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
364 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
365 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
366 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
367 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
368 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
369 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
370 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
371 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
372 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
373 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
374 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
375 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
376 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
377 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
378 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
379 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
380 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
381 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
382 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
383 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
384 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
385 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
386 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
387 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
388 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
389 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
390 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
391 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
392 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
393 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
394 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
395 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
396 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
397 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
398 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
399 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
400 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
401 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
402 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
403 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
404 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
405 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
406 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
407 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
408 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
409 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
410 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
411 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
412 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
413 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
414 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
415 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
416 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
417 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
418 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
419 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
420 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
421 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
422 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
423 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
424 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
425 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
426 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
427 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
428 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
429 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
430 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
431 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
432 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
433 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
434 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
435 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
436 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
437 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
438 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
439 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
440 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
441 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
442 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
443 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
444 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
445 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
446 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
447 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
448 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
449 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
450 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
451 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
452 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
453 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
454 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
455 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
456 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
457 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
458 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
459 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
460 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
461 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
462 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
463 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
464 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
465 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
466 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
467 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
468 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
469 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
470 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
471 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
472 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
473 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
474 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
475 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
476 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
477 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
478 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
479 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
480 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
481 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
482 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
483 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
484 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
485 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
486 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
487 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
488 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
489 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
490 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
491 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
492 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
493 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
494 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
495 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
496 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
497 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
498 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
499 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
500 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
501 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
502 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
503 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
504 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
505 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
506 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
507 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
508 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
509 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
510 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
511 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
512 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
513 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
514 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
515 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
516 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
517 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
518 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
519 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
520 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
521 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
522 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
523 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
524 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
525 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
526 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
527 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
528 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
529 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
530 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
531 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
532 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
533 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
534 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
535 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
536 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
537 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
538 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
539 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
540 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
541 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
542 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
543 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
544 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
545 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
546 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
547 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
548 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
549 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
550 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
551 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
552 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
553 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
554 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
555 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
556 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
557 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
558 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
559 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
560 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
561 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
562 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
563 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
564 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
565 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
566 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
567 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
568 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
569 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
570 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
571 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
572 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
573 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
574 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
575 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
576 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
577 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
578 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
579 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
580 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
581 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
582 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
583 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
584 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
585 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
586 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
587 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
588 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
589 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
590 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
591 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
592 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
593 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
594 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
595 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
596 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
597 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
598 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
599 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
600 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
601 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
602 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
603 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
604 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
605 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
606 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
607 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
608 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
609 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
610 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
611 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
612 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
613 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
614 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
615 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
616 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
617 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
618 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
619 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
620 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
621 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
622 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
623 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
624 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
625 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
626 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
627 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
628 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
629 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
630 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
631 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
632 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
633 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
634 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
635 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
636 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
637 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
638 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
639 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
640 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
641 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
642 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
643 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
644 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
645 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
646 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
647 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
648 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
649 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
650 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
651 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
652 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
653 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
654 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
655 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
656 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
657 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
658 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
659 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
660 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
661 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
662 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
663 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
664 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
665 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
666 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
667 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
668 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
669 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
670 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
671 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
672 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
673 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
674 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
675 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
676 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
677 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
678 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
679 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
680 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
681 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
682 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
683 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
684 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
685 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
686 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
687 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
688 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
689 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
690 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
691 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
692 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
693 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
694 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
695 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
696 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
697 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
698 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
699 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
700 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
701 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
702 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
703 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
704 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
705 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
706 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
707 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
708 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
709 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
710 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
711 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
712 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
713 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
714 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
715 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
716 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
717 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
718 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
719 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
720 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
721 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
722 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
723 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
724 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
725 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
726 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
727 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
728 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
729 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
730 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
731 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
732 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
733 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
734 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
735 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
736 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
737 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
738 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
739 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
740 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
741 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
742 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
743 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
744 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
745 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
746 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
747 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
748 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
749 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
750 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
751 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
752 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
753 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
754 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
755 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
756 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
757 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
758 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
759 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
760 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
761 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
762 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
763 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
764 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
765 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
766 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
767 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
768 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
769 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
770 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
771 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
772 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
773 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
774 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
775 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
776 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
777 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
778 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
779 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
780 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
781 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
782 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
783 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
784 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
785 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
786 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
787 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
788 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
789 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
790 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
791 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
792 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
793 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
794 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
795 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
796 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
797 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
798 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
799 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
800 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
801 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
802 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
803 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
804 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
805 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
806 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
807 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
808 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
809 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
810 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
811 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
812 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
813 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
814 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
815 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
816 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
817 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
818 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
819 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
820 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
821 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
822 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
823 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
824 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
825 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
826 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
827 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
828 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
829 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
830 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
831 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
832 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
833 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
834 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
835 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
836 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
837 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
838 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
839 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
840 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
841 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
842 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
843 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
844 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
845 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
846 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
847 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
848 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
849 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
850 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
851 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
852 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
853 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
854 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
855 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
856 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
857 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
858 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
859 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
860 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
861 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
862 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
863 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
864 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
865 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
866 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
867 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
868 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
869 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
870 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
871 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
872 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
873 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
874 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
875 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
876 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
877 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
878 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
879 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
880 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
881 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
882 637000116 Frankia casuarinae CcI3 Isolate Nodule
883 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
884 8002775197 Frankia nepalensis CN7 Isolate Nodule
885 8002784119 Frankia sp. AgB1.9 Isolate Nodule
886 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
887 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
888 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
889 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
890 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
891 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
892 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
893 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
894 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
895 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
896 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
897 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
898 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
899 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
900 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
901 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
902 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
903 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
904 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
905 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
906 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
907 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
908 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
909 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
910 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
911 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
912 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
913 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
914 8054920844 Frankia tisae Agncl-8 Isolate Nodule
915 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
916 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
917 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
918 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
919 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
920 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
921 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
922 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
923 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
924 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
925 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
926 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.34
Metatranscriptomes 0.54
Isolates 21.12

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 8.06
Nodule 2.18
Rhizoplane 5.19
Rhizosphere 66.72
Stem 0
Stem Tuber 0.1
Unclassified 17.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2512745 2162886007 Bacteria 2656
2 MRS1b_contig_5332385 2162886011 Bacteria 2334
3 JGI24739J22299_10003636 3300001989 Bacteria 5889
4 JGI24739J22299_10023236 3300001989 Bacteria 2193
5 JGI24737J22298_10002216 3300001990 Bacteria 6927
6 JGI24735J21928_10007117 3300002067 Bacteria 3654
7 JGI24744J21845_10000282 3300002077 Bacteria 8421
8 JGI25152J39213_1000090 3300002773 Bacteria 63717
9 JGI25152J39213_1003304 3300002773 Bacteria 5567
10 JGI25159J45721_1007018 3300002987 Bacteria 3287
11 JGI25151J46595_10007031 3300003187 Bacteria 5567
12 JGI25151J46595_10014470 3300003187 Bacteria 3512
13 JGI25406J46586_10008172 3300003203 Bacteria 4751
14 JGI25165J46597_1000044 3300003214 Bacteria 263289
15 JGI25153J46596_10007089 3300003215 Bacteria 5567
16 JGI25160J50197_1010761 3300003354 Bacteria 3287
17 JGI25161J50226_1002092 3300003374 Bacteria 5391
18 Ga0006562J51391_1022179 3300003578 Bacteria 13092
19 Ga0006562J51391_1053958 3300003578 Bacteria 2175
20 Ga0006562J51391_1059279 3300003578 Bacteria 5581
21 Ga0006562J51391_1094765 3300003578 Bacteria 5389
22 Ga0006562J51391_1099265 3300003578 Bacteria 2579
23 Ga0006562J51391_1099266 3300003578 Bacteria 1870
24 Ga0006562J51391_1101838 3300003578 Bacteria 2250
25 JGI25404J52841_10000835 3300003659 Bacteria 4937
26 Ga0055539_1000027 3300003752 Bacteria 258020
27 Ga0055533_1000020 3300003756 Bacteria 353998
28 Ga0055525_1000151 3300003759 Bacteria 94158
29 Ga0055527_1000005 3300003760 Bacteria 504776
30 Ga0055535_1000522 3300003761 Bacteria 33444
31 Ga0055542_1000003 3300003762 Bacteria 582721
32 Ga0055542_1000006 3300003762 Bacteria 504776
33 Ga0055529_1000400 3300003763 Bacteria 46269
34 Ga0055526_1014173 3300003771 Bacteria 3302
35 Ga0055526_1014242 3300003771 Bacteria 3287
36 Ga0055537_1006217 3300003773 Bacteria 3068
37 Ga0055524_1013525 3300003775 Bacteria 3073
38 Ga0055524_1013538 3300003775 Bacteria 3072
39 Ga0055536_1001522 3300003781 Bacteria 13907
40 Ga0055536_1002089 3300003781 Bacteria 11385
41 Ga0055536_1003520 3300003781 Bacteria 8386
42 Ga0055534_1006353 3300003784 Bacteria 2985
43 Ga0055534_1007404 3300003784 Bacteria 2618
44 Ga0055530_10000773 3300003791 Bacteria 26694
45 Ga0055540_1001603 3300003792 Bacteria 13189
46 Ga0055540_1002446 3300003792 Bacteria 9794
47 Ga0055531_10001546 3300003794 Bacteria 16850
48 Ga0055531_10016147 3300003794 Bacteria 3240
49 Ga0055531_10017628 3300003794 Bacteria 3001
50 Ga0055541_1000508 3300003841 Bacteria 10819
51 Ga0055543_1001840 3300004625 Bacteria 7760
52 Ga0065165_1000076 3300005262 Bacteria 163890
53 Ga0065165_1007043 3300005262 Bacteria 5661
54 Ga0065714_10090062 3300005288 Bacteria 1957
55 Ga0065704_10075631 3300005289 Bacteria 5491
56 Ga0065712_10071676 3300005290 Bacteria 5119
57 Ga0070658_10001484 3300005327 Bacteria 19913
58 Ga0070658_10010283 3300005327 Bacteria 7504
59 Ga0070658_10016932 3300005327 Bacteria 5834
60 Ga0070658_10040342 3300005327 Bacteria 3766
61 Ga0070683_100009374 3300005329 Bacteria 8368
62 Ga0070683_100020474 3300005329 Bacteria 5888
63 Ga0070683_100026289 3300005329 Bacteria 5239
64 Ga0070682_100007546 3300005337 Bacteria 6128
65 Ga0068868_100121629 3300005338 Bacteria 2130
66 Ga0070660_100005500 3300005339 Bacteria 8776
67 Ga0070660_100015206 3300005339 Bacteria 5552
68 Ga0070660_100068251 3300005339 Bacteria 2771
69 Ga0070660_100077012 3300005339 Bacteria 2612
70 Ga0070691_10010169 3300005341 Bacteria 4288
71 Ga0070687_100062940 3300005343 Bacteria 1966
72 Ga0070668_100000752 3300005347 Bacteria 22213
73 Ga0070668_100075630 3300005347 Bacteria 2629
74 Ga0070673_100024309 3300005364 Bacteria 4440
75 Ga0070659_100000513 3300005366 Bacteria 28466
76 Ga0070659_100004357 3300005366 Bacteria 10106
77 Ga0070659_100017069 3300005366 Bacteria 5456
78 Ga0070659_100018431 3300005366 Bacteria 5268
79 Ga0070659_100026681 3300005366 Bacteria 4446
80 Ga0070659_100047517 3300005366 Bacteria 3367
81 Ga0070667_100023307 3300005367 Bacteria 5134
82 Ga0070667_100034330 3300005367 Bacteria 4244
83 Ga0070667_100095660 3300005367 Bacteria 2561
84 Ga0070709_10000118 3300005434 Bacteria 53312
85 Ga0070714_100008719 3300005435 Bacteria 7926
86 Ga0070714_100009991 3300005435 Bacteria 7485
87 Ga0070714_100012884 3300005435 Bacteria 6686
88 Ga0070714_100025037 3300005435 Bacteria 4921
89 Ga0070714_100063812 3300005435 Bacteria 3169
90 Ga0070714_100081990 3300005435 Bacteria 2809
91 Ga0070713_100001150 3300005436 Bacteria 16960
92 Ga0070713_100010863 3300005436 Bacteria 6602
93 Ga0070713_100119942 3300005436 Bacteria 2305
94 Ga0070710_10000216 3300005437 Bacteria 26980
95 Ga0070710_10047928 3300005437 Bacteria 2385
96 Ga0070701_10011409 3300005438 Bacteria 3971
97 Ga0070711_100000161 3300005439 Bacteria 36464
98 Ga0070711_100073680 3300005439 Bacteria 2413
99 Ga0070700_100023955 3300005441 Bacteria 3577
100 Ga0070700_100061722 3300005441 Bacteria 2365
101 Ga0070708_100006414 3300005445 Bacteria 9365
102 Ga0070708_100051587 3300005445 Bacteria 3645
103 Ga0070663_100000324 3300005455 Bacteria 24761
104 Ga0070678_100038330 3300005456 Bacteria 3373
105 Ga0068867_100021638 3300005459 Bacteria 4590
106 Ga0070685_10001210 3300005466 Bacteria 13726
107 Ga0070706_100001268 3300005467 Bacteria 26964
108 Ga0070706_100008575 3300005467 Bacteria 9528
109 Ga0070706_100022289 3300005467 Bacteria 5831
110 Ga0070706_100066715 3300005467 Bacteria 3328
111 Ga0070707_100013921 3300005468 Bacteria 7533
112 Ga0070707_100014576 3300005468 Bacteria 7372
113 Ga0070707_100015820 3300005468 Bacteria 7082
114 Ga0070698_100000621 3300005471 Bacteria 38176
115 Ga0070698_100001158 3300005471 Bacteria 29227
116 Ga0070698_100006233 3300005471 Bacteria 12978
117 Ga0070698_100013176 3300005471 Bacteria 8749
118 Ga0070698_100032360 3300005471 Bacteria 5417
119 Ga0070698_100040406 3300005471 Bacteria 4794
120 Ga0070699_100005880 3300005518 Bacteria 10716
121 Ga0070679_100057096 3300005530 Bacteria 3890
122 Ga0070679_100101454 3300005530 Bacteria 2864
123 Ga0070684_100008587 3300005535 Bacteria 8000
124 Ga0070684_100142538 3300005535 Bacteria 2168
125 Ga0070697_100008356 3300005536 Bacteria 8077
126 Ga0068853_100052939 3300005539 Bacteria 3496
127 Ga0068853_100057556 3300005539 Bacteria 3355
128 Ga0070672_100012309 3300005543 Bacteria 6000
129 Ga0070672_100017922 3300005543 Bacteria 5107
130 Ga0070693_100023994 3300005547 Bacteria 3266
131 Ga0070665_100007856 3300005548 Bacteria 10818
132 Ga0070665_100012763 3300005548 Bacteria 8463
133 Ga0070665_100016627 3300005548 Bacteria 7372
134 Ga0068855_100002245 3300005563 Bacteria 23878
135 Ga0068855_100006136 3300005563 Bacteria 14647
136 Ga0068855_100009451 3300005563 Bacteria 11782
137 Ga0068855_100020286 3300005563 Bacteria 7976
138 Ga0068855_100029077 3300005563 Bacteria 6609
139 Ga0068855_100130463 3300005563 Bacteria 2871
140 Ga0068855_100220376 3300005563 Bacteria 2128
141 Ga0068857_100008845 3300005577 Bacteria 8722
142 Ga0068857_100040492 3300005577 Bacteria 4131
143 Ga0068857_100163022 3300005577 Bacteria 2023
144 Ga0068854_100011506 3300005578 Bacteria 5765
145 Ga0068856_100036826 3300005614 Bacteria 4798
146 Ga0068852_100002359 3300005616 Bacteria 13006
147 Ga0068852_100003937 3300005616 Bacteria 10438
148 Ga0068852_100012789 3300005616 Bacteria 6394
149 Ga0068852_100023223 3300005616 Bacteria 4988
150 Ga0068852_100064681 3300005616 Bacteria 3189
151 Ga0068852_100093836 3300005616 Bacteria 2691
152 Ga0068852_100126261 3300005616 Bacteria 2350
153 Ga0068859_100000049 3300005617 Bacteria 137619
154 Ga0068864_100019057 3300005618 Bacteria 5735
155 Ga0068866_10016443 3300005718 Bacteria 3308
156 Ga0068861_100016118 3300005719 Bacteria 5279
157 Ga0068851_10000001 3300005834 Bacteria 495512
158 Ga0068863_100000604 3300005841 Bacteria 36426
159 Ga0068858_100000003 3300005842 Bacteria 349151
160 Ga0068858_100000048 3300005842 Bacteria 126360
161 Ga0068858_100013685 3300005842 Bacteria 7656
162 Ga0068858_100062383 3300005842 Bacteria 3446
163 Ga0068860_100000286 3300005843 Bacteria 71981
164 Ga0068860_100158790 3300005843 Bacteria 2179
165 Ga0068862_100000200 3300005844 Bacteria 66299
166 Ga0081455_10000144 3300005937 Bacteria 84406
167 Ga0081455_10000454 3300005937 Bacteria 53871
168 Ga0081455_10000683 3300005937 Bacteria 44068
169 Ga0081455_10000960 3300005937 Bacteria 36843
170 Ga0081455_10001546 3300005937 Bacteria 28331
171 Ga0081455_10005669 3300005937 Bacteria 13626
172 Ga0081455_10007554 3300005937 Bacteria 11432
173 Ga0081455_10015373 3300005937 Bacteria 7439
174 Ga0081455_10017647 3300005937 Bacteria 6832
175 Ga0081455_10033912 3300005937 Bacteria 4580
176 Ga0081538_10000079 3300005981 Bacteria 92419
177 Ga0081538_10000350 3300005981 Bacteria 52656
178 Ga0081538_10003762 3300005981 Bacteria 14206
179 Ga0081538_10026557 3300005981 Bacteria 4046
180 Ga0081538_10034927 3300005981 Bacteria 3314
181 Ga0081540_1000292 3300005983 Bacteria 52588
182 Ga0081539_10000356 3300005985 Bacteria 100748
183 Ga0081539_10004815 3300005985 Bacteria 14485
184 Ga0081539_10022964 3300005985 Bacteria 4103
185 Ga0070717_10000504 3300006028 Bacteria 24742
186 Ga0070717_10052397 3300006028 Bacteria 3361
187 Ga0070717_10082444 3300006028 Bacteria 2703
188 Ga0075365_10012704 3300006038 Bacteria 5010
189 Ga0075365_10014987 3300006038 Bacteria 4676
190 Ga0075368_10004038 3300006042 Bacteria 4936
191 Ga0075363_100000523 3300006048 Bacteria 12347
192 Ga0075363_100007222 3300006048 Bacteria 5092
193 Ga0075363_100012544 3300006048 Bacteria 4091
194 Ga0075364_10003312 3300006051 Bacteria 9137
195 Ga0075364_10004093 3300006051 Bacteria 8366
196 Ga0075432_10000101 3300006058 Bacteria 18315
197 Ga0070715_10001275 3300006163 Bacteria 7221
198 Ga0070716_100000491 3300006173 Bacteria 16432
199 Ga0070712_100009384 3300006175 Bacteria 6164
200 Ga0075367_10034800 3300006178 Bacteria 2912
201 Ga0075369_10001262 3300006186 Bacteria 8618
202 Ga0097621_100026268 3300006237 Bacteria 4566
203 Ga0097621_100028229 3300006237 Bacteria 4422
204 Ga0075370_10007332 3300006353 Bacteria 5615
205 Ga0075370_10015790 3300006353 Bacteria 4050
206 Ga0075428_100000616 3300006844 Bacteria 36391
207 Ga0075430_100009757 3300006846 Bacteria 8118
208 Ga0075430_100021990 3300006846 Bacteria 5420
209 Ga0075430_100079552 3300006846 Bacteria 2747
210 Ga0075431_100004927 3300006847 Bacteria 13146
211 Ga0075431_100022382 3300006847 Bacteria 6459
212 Ga0075431_100062498 3300006847 Bacteria 3842
213 Ga0075433_10000832 3300006852 Bacteria 21596
214 Ga0075433_10038687 3300006852 Bacteria 4121
215 Ga0075434_100000238 3300006871 Bacteria 38170
216 Ga0075429_100006984 3300006880 Bacteria 9810
217 Ga0075429_100046081 3300006880 Bacteria 3794
218 Ga0075429_100081459 3300006880 Bacteria 2822
219 Ga0075429_100100345 3300006880 Bacteria 2526
220 Ga0068865_100015082 3300006881 Bacteria 4923
221 Ga0075436_100002267 3300006914 Bacteria 13278
222 Ga0097620_100000049 3300006931 Bacteria 137619
223 Ga0079104_1000016 3300006946 Bacteria 313865
224 Ga0075435_100003528 3300007076 Bacteria 10617
225 Ga0105244_10000125 3300009036 Bacteria 78586
226 Ga0105244_10011954 3300009036 Bacteria 5167
227 Ga0105244_10054775 3300009036 Bacteria 2023
228 Ga0105250_10009500 3300009092 Bacteria 4093
229 Ga0105240_10000538 3300009093 Bacteria 70068
230 Ga0105240_10034274 3300009093 Bacteria 6550
231 Ga0105240_10037482 3300009093 Bacteria 6231
232 Ga0111539_10000095 3300009094 Bacteria 93635
233 Ga0111539_10020703 3300009094 Bacteria 8100
234 Ga0105245_10004429 3300009098 Bacteria 12427
235 Ga0105245_10023441 3300009098 Bacteria 5418
236 Ga0105245_10087168 3300009098 Bacteria 2865
237 Ga0105245_10161910 3300009098 Bacteria 2124
238 Ga0105247_10000016 3300009101 Bacteria 263389
239 Ga0105247_10001447 3300009101 Bacteria 17144
240 Ga0114129_10032099 3300009147 Bacteria 7423
241 Ga0114129_10037355 3300009147 Bacteria 6858
242 Ga0114129_10069299 3300009147 Bacteria 4916
243 Ga0105243_10001051 3300009148 Bacteria 25286
244 Ga0105243_10002952 3300009148 Bacteria 14064
245 Ga0105243_10008770 3300009148 Bacteria 7744
246 Ga0105243_10011876 3300009148 Bacteria 6588
247 Ga0105243_10022266 3300009148 Bacteria 4814
248 Ga0105243_10085039 3300009148 Bacteria 2592
249 Ga0105241_10000768 3300009174 Bacteria 24407
250 Ga0105241_10014845 3300009174 Bacteria 5703
251 Ga0105242_10001582 3300009176 Bacteria 17897
252 Ga0105242_10088615 3300009176 Bacteria 2600
253 Ga0105248_10000108 3300009177 Bacteria 93521
254 Ga0105248_10000890 3300009177 Bacteria 33432
255 Ga0105248_10014121 3300009177 Bacteria 8790
256 Ga0105248_10026802 3300009177 Bacteria 6410
257 Ga0105248_10072231 3300009177 Bacteria 3878
258 Ga0105248_10102589 3300009177 Bacteria 3224
259 Ga0105237_10001702 3300009545 Bacteria 28464
260 Ga0105237_10014162 3300009545 Bacteria 8348
261 Ga0105238_10001962 3300009551 Bacteria 20721
262 Ga0105238_10037448 3300009551 Bacteria 4931
263 Ga0105249_10004792 3300009553 Bacteria 11679
264 Ga0105249_10020433 3300009553 Bacteria 5919
265 Ga0105249_10022400 3300009553 Bacteria 5658
266 Ga0105249_10095806 3300009553 Bacteria 2783
267 Ga0105239_10009208 3300010375 Bacteria 11167
268 Ga0105239_10030862 3300010375 Bacteria 5896
269 Ga0105239_10036954 3300010375 Bacteria 5358
270 Ga0105246_10000370 3300011119 Bacteria 23989
271 Ga0105246_10003548 3300011119 Bacteria 9442
272 Ga0105246_10011718 3300011119 Bacteria 5449
273 Ga0105246_10045538 3300011119 Bacteria 2988
274 Ga0105246_10051663 3300011119 Bacteria 2824
275 Ga0105246_10076994 3300011119 Bacteria 2365
276 Ga0157371_10107012 3300013102 Bacteria 1984
277 Ga0157371_10114335 3300013102 Bacteria 1917
278 Ga0157370_10011155 3300013104 Bacteria 9418
279 Ga0157370_10027475 3300013104 Bacteria 5611
280 Ga0157369_10009270 3300013105 Bacteria 11262
281 Ga0157369_10073150 3300013105 Bacteria 3678
282 Ga0157369_10092031 3300013105 Bacteria 3236
283 Ga0157369_10166995 3300013105 Bacteria 2320
284 Ga0157369_10179529 3300013105 Bacteria 2228
285 Ga0171462_1001 3300013250 Bacteria 1135406
286 Ga0163162_10096158 3300013306 Bacteria 3050
287 Ga0163162_10180635 3300013306 Bacteria 2236
288 Ga0157372_10024275 3300013307 Bacteria 6583
289 Ga0157372_10240518 3300013307 Bacteria 2101
290 Ga0157375_10009533 3300013308 Bacteria 8524
291 Ga0157375_10113808 3300013308 Bacteria 2807
292 Ga0163163_10023526 3300014325 Bacteria 5848
293 Ga0163163_10027387 3300014325 Bacteria 5459
294 Ga0163163_10094123 3300014325 Bacteria 3013
295 Ga0157380_10123417 3300014326 Bacteria 2198
296 Ga0182008_10000566 3300014497 Bacteria 27335
297 Ga0182008_10001782 3300014497 Bacteria 14098
298 Ga0182008_10012848 3300014497 Bacteria 4412
299 Ga0157379_10001992 3300014968 Bacteria 16912
300 Ga0157379_10018022 3300014968 Bacteria 6223
301 Ga0157379_10169475 3300014968 Bacteria 1971
302 Ga0157376_10013386 3300014969 Bacteria 6119
303 Ga0182007_10001078 3300015262 Bacteria 14864
304 Ga0182007_10009441 3300015262 Bacteria 3930
305 Ga0183367_1002 3300015688 Bacteria 1101531
306 Ga0163161_10082328 3300017792 Bacteria 2371
307 Ga0197907_10217434 3300020069 Bacteria 2413
308 Ga0206350_10893355 3300020080 Bacteria 2188
309 Ga0206354_10551289 3300020081 Bacteria 2130
310 Ga0206353_10548390 3300020082 Bacteria 10514
311 Ga0213875_10000250 3300021388 Bacteria 54123
312 Ga0213875_10000488 3300021388 Bacteria 33637
313 Ga0213875_10000514 3300021388 Bacteria 32222
314 Ga0213875_10005151 3300021388 Bacteria 7072
315 Ga0213875_10009992 3300021388 Bacteria 4775
316 Ga0209436_104146 3300025208 Bacteria 3643
317 Ga0209566_100043 3300025225 Bacteria 266609
318 Ga0209674_100001 3300025226 Bacteria 4013750
319 Ga0209672_100003 3300025228 Bacteria 1560476
320 Ga0209672_101287 3300025228 Bacteria 9832
321 Ga0209147_100285 3300025229 Bacteria 42943
322 Ga0209147_100657 3300025229 Bacteria 17942
323 Ga0209563_100001 3300025230 Bacteria 4013775
324 Ga0209563_100222 3300025230 Bacteria 28212
325 Ga0207427_100077 3300025231 Bacteria 149591
326 Ga0209437_101291 3300025233 Bacteria 6746
327 Ga0209258_100015 3300025242 Bacteria 706310
328 Ga0209258_102017 3300025242 Bacteria 5848
329 Ga0207425_1000229 3300025245 Bacteria 43700
330 Ga0207425_1011324 3300025245 Bacteria 2133
331 Ga0209646_1000209 3300025246 Bacteria 66608
332 Ga0209677_100001 3300025253 Bacteria 4013787
333 Ga0209677_100723 3300025253 Bacteria 16824
334 Ga0209148_1000004 3300025254 Bacteria 1844481
335 Ga0209148_1000028 3300025254 Bacteria 582773
336 Ga0209148_1003188 3300025254 Bacteria 4708
337 Ga0209148_1003774 3300025254 Bacteria 3984
338 Ga0209129_1000049 3300025258 Bacteria 268086
339 Ga0209129_1000201 3300025258 Bacteria 75344
340 Ga0209233_1000014 3300025261 Bacteria 996641
341 Ga0209565_1001437 3300025263 Bacteria 10524
342 Ga0209565_1002407 3300025263 Bacteria 6774
343 Ga0209565_1003093 3300025263 Bacteria 5583
344 Ga0209455_1000046 3300025272 Bacteria 382681
345 Ga0209455_1002176 3300025272 Bacteria 7779
346 Ga0209673_1001483 3300025273 Bacteria 21915
347 Ga0209673_1005158 3300025273 Bacteria 6681
348 Ga0209130_1000974 3300025284 Bacteria 22515
349 Ga0209130_1004840 3300025284 Bacteria 4926
350 Ga0209675_1002160 3300025291 Bacteria 10362
351 Ga0209675_1004266 3300025291 Bacteria 6435
352 Ga0209675_1005987 3300025291 Bacteria 4977
353 Ga0209676_1000074 3300025292 Bacteria 305770
354 Ga0209676_1000209 3300025292 Bacteria 130388
355 Ga0209676_1000961 3300025292 Bacteria 34895
356 Ga0209025_1000086 3300025294 Bacteria 262586
357 Ga0209025_1000279 3300025294 Bacteria 116352
358 Ga0209025_1000822 3300025294 Bacteria 49588
359 Ga0209025_1001092 3300025294 Bacteria 39204
360 Ga0209025_1041585 3300025294 Bacteria 1966
361 Ga0209564_1004997 3300025295 Bacteria 7793
362 Ga0209564_1005012 3300025295 Bacteria 7774
363 Ga0209758_1000496 3300025297 Bacteria 64085
364 Ga0209758_1006882 3300025297 Bacteria 7944
365 Ga0209050_1000015 3300025298 Bacteria 759102
366 Ga0209050_1000884 3300025298 Bacteria 40094
367 Ga0209256_1000264 3300025299 Bacteria 92750
368 Ga0209256_1000304 3300025299 Bacteria 85971
369 Ga0207426_1000108 3300025302 Bacteria 242257
370 Ga0207426_1000130 3300025302 Bacteria 210271
371 Ga0207426_1006087 3300025302 Bacteria 5319
372 Ga0207426_1006196 3300025302 Bacteria 5258
373 Ga0209051_1000010 3300025303 Bacteria 641298
374 Ga0209051_1000156 3300025303 Bacteria 128246
375 Ga0209051_1000830 3300025303 Bacteria 31912
376 Ga0209051_1001619 3300025303 Bacteria 18363
377 Ga0209257_1000026 3300025304 Bacteria 723225
378 Ga0209257_1000172 3300025304 Bacteria 167434
379 Ga0209257_1003207 3300025304 Bacteria 14476
380 Ga0207697_10001781 3300025315 Bacteria 11535
381 Ga0207697_10014594 3300025315 Bacteria 3257
382 Ga0207656_10000002 3300025321 Bacteria 792178
383 Ga0207656_10026211 3300025321 Bacteria 2374
384 Ga0207655_1010439 3300025728 Bacteria 5630
385 Ga0207682_10025978 3300025893 Bacteria 2324
386 Ga0207692_10000186 3300025898 Bacteria 20249
387 Ga0207692_10004777 3300025898 Bacteria 5384
388 Ga0207692_10024588 3300025898 Bacteria 2802
389 Ga0207692_10033752 3300025898 Bacteria 2472
390 Ga0207710_10000017 3300025900 Bacteria 370962
391 Ga0207710_10000062 3300025900 Bacteria 164192
392 Ga0207710_10011096 3300025900 Bacteria 3793
393 Ga0207688_10048179 3300025901 Bacteria 2381
394 Ga0207688_10051593 3300025901 Bacteria 2304
395 Ga0207647_10003148 3300025904 Bacteria 12376
396 Ga0207647_10012451 3300025904 Bacteria 5920
397 Ga0207699_10000106 3300025906 Bacteria 58842
398 Ga0207699_10009598 3300025906 Bacteria 4827
399 Ga0207699_10017708 3300025906 Bacteria 3759
400 Ga0207699_10061248 3300025906 Bacteria 2263
401 Ga0207699_10061634 3300025906 Bacteria 2257
402 Ga0207645_10006791 3300025907 Bacteria 8169
403 Ga0207705_10000001 3300025909 Bacteria 2061880
404 Ga0207705_10070691 3300025909 Bacteria 2529
405 Ga0207684_10003330 3300025910 Bacteria 15772
406 Ga0207684_10010264 3300025910 Bacteria 8243
407 Ga0207684_10017354 3300025910 Bacteria 6175
408 Ga0207684_10024597 3300025910 Bacteria 5134
409 Ga0207654_10000001 3300025911 Bacteria 1816198
410 Ga0207695_10000983 3300025913 Bacteria 50658
411 Ga0207695_10001199 3300025913 Bacteria 44583
412 Ga0207695_10012810 3300025913 Bacteria 10042
413 Ga0207695_10034932 3300025913 Bacteria 5459
414 Ga0207671_10000002 3300025914 Bacteria 1144816
415 Ga0207671_10000371 3300025914 Bacteria 63641
416 Ga0207693_10014760 3300025915 Bacteria 6275
417 Ga0207693_10020593 3300025915 Bacteria 5244
418 Ga0207693_10042577 3300025915 Bacteria 3574
419 Ga0207663_10000661 3300025916 Bacteria 15240
420 Ga0207663_10050913 3300025916 Bacteria 2576
421 Ga0207663_10063777 3300025916 Bacteria 2348
422 Ga0207657_10006095 3300025919 Bacteria 12537
423 Ga0207657_10031297 3300025919 Bacteria 4823
424 Ga0207657_10035487 3300025919 Bacteria 4471
425 Ga0207649_10043813 3300025920 Bacteria 2738
426 Ga0207652_10015342 3300025921 Bacteria 6221
427 Ga0207646_10000434 3300025922 Bacteria 55879
428 Ga0207646_10009064 3300025922 Bacteria 9882
429 Ga0207646_10017313 3300025922 Bacteria 6747
430 Ga0207646_10045671 3300025922 Bacteria 3932
431 Ga0207646_10046390 3300025922 Bacteria 3898
432 Ga0207646_10094101 3300025922 Bacteria 2684
433 Ga0207681_10022072 3300025923 Bacteria 4055
434 Ga0207694_10000022 3300025924 Bacteria 288900
435 Ga0207694_10006984 3300025924 Bacteria 8571
436 Ga0207687_10042757 3300025927 Bacteria 3119
437 Ga0207687_10043672 3300025927 Bacteria 3089
438 Ga0207687_10092574 3300025927 Bacteria 2208
439 Ga0207700_10000053 3300025928 Bacteria 75986
440 Ga0207700_10020110 3300025928 Bacteria 4526
441 Ga0207700_10033204 3300025928 Bacteria 3691
442 Ga0207700_10034015 3300025928 Bacteria 3654
443 Ga0207664_10000869 3300025929 Bacteria 20441
444 Ga0207664_10000949 3300025929 Bacteria 19516
445 Ga0207664_10003140 3300025929 Bacteria 10973
446 Ga0207664_10007844 3300025929 Bacteria 7417
447 Ga0207664_10019890 3300025929 Bacteria 4969
448 Ga0207664_10042322 3300025929 Bacteria 3555
449 Ga0207664_10053802 3300025929 Bacteria 3188
450 Ga0207664_10070580 3300025929 Bacteria 2812
451 Ga0207664_10072195 3300025929 Bacteria 2782
452 Ga0207690_10000189 3300025932 Bacteria 47490
453 Ga0207690_10019543 3300025932 Bacteria 4174
454 Ga0207706_10091931 3300025933 Bacteria 2668
455 Ga0207686_10012807 3300025934 Bacteria 4621
456 Ga0207686_10106914 3300025934 Bacteria 1879
457 Ga0207709_10000433 3300025935 Bacteria 39614
458 Ga0207709_10001930 3300025935 Bacteria 13624
459 Ga0207709_10003225 3300025935 Bacteria 9792
460 Ga0207709_10004881 3300025935 Bacteria 7676
461 Ga0207709_10011362 3300025935 Bacteria 4910
462 Ga0207709_10016612 3300025935 Bacteria 4093
463 Ga0207709_10017782 3300025935 Bacteria 3973
464 Ga0207709_10036161 3300025935 Bacteria 2926
465 Ga0207709_10036449 3300025935 Bacteria 2915
466 Ga0207665_10000166 3300025939 Bacteria 44650
467 Ga0207665_10003060 3300025939 Bacteria 11221
468 Ga0207665_10005581 3300025939 Bacteria 8389
469 Ga0207665_10012322 3300025939 Bacteria 5616
470 Ga0207691_10001822 3300025940 Bacteria 20843
471 Ga0207691_10004770 3300025940 Bacteria 13115
472 Ga0207691_10076862 3300025940 Bacteria 3009
473 Ga0207711_10000593 3300025941 Bacteria 36689
474 Ga0207711_10001430 3300025941 Bacteria 22343
475 Ga0207711_10004915 3300025941 Bacteria 11346
476 Ga0207711_10018109 3300025941 Bacteria 5856
477 Ga0207689_10020565 3300025942 Bacteria 5554
478 Ga0207661_10028912 3300025944 Bacteria 4251
479 Ga0207661_10029768 3300025944 Bacteria 4197
480 Ga0207661_10035553 3300025944 Bacteria 3883
481 Ga0207679_10078159 3300025945 Bacteria 2520
482 Ga0207667_10014198 3300025949 Bacteria 9089
483 Ga0207667_10021231 3300025949 Bacteria 7198
484 Ga0207667_10021635 3300025949 Bacteria 7124
485 Ga0207667_10024976 3300025949 Bacteria 6551
486 Ga0207667_10154988 3300025949 Bacteria 2357
487 Ga0207667_10188859 3300025949 Bacteria 2114
488 Ga0207712_10001330 3300025961 Bacteria 16919
489 Ga0207712_10024793 3300025961 Bacteria 3978
490 Ga0207668_10019243 3300025972 Bacteria 4311
491 Ga0207658_10061919 3300025986 Bacteria 2798
492 Ga0207703_10000006 3300026035 Bacteria 502351
493 Ga0207703_10000064 3300026035 Bacteria 126619
494 Ga0207703_10127966 3300026035 Bacteria 2189
495 Ga0207639_10058457 3300026041 Bacteria 2966
496 Ga0207639_10096701 3300026041 Bacteria 2376
497 Ga0207678_10026466 3300026067 Bacteria 5059
498 Ga0207708_10000897 3300026075 Bacteria 22343
499 Ga0207708_10019229 3300026075 Bacteria 5145
500 Ga0207702_10016001 3300026078 Bacteria 6210
501 Ga0207702_10038950 3300026078 Bacteria 3982
502 Ga0207702_10050966 3300026078 Bacteria 3496
503 Ga0207641_10000357 3300026088 Bacteria 54479
504 Ga0207648_10001889 3300026089 Bacteria 22892
505 Ga0207674_10002289 3300026116 Bacteria 24291
506 Ga0207674_10002541 3300026116 Bacteria 22988
507 Ga0207674_10004262 3300026116 Bacteria 17251
508 Ga0207674_10027562 3300026116 Bacteria 6007
509 Ga0207674_10040825 3300026116 Bacteria 4803
510 Ga0207674_10112573 3300026116 Bacteria 2695
511 Ga0207674_10118576 3300026116 Bacteria 2616
512 Ga0207675_100017737 3300026118 Bacteria 6640
513 Ga0207675_100021530 3300026118 Bacteria 6005
514 Ga0207675_100037656 3300026118 Bacteria 4512
515 Ga0207683_10006712 3300026121 Bacteria 9847
516 Ga0207683_10010893 3300026121 Bacteria 7755
517 Ga0207698_10000744 3300026142 Bacteria 18903
518 Ga0207698_10000881 3300026142 Bacteria 17390
519 Ga0207698_10062208 3300026142 Bacteria 2914
520 Ga0207698_10070547 3300026142 Bacteria 2769
521 Ga0207698_10134565 3300026142 Bacteria 2119
522 Ga0209281_1000017 3300027111 Bacteria 583251
523 Ga0209389_1000059 3300027296 Bacteria 106207
524 Ga0209813_10003346 3300027866 Bacteria 3743
525 Ga0207428_10000102 3300027907 Bacteria 118940
526 Ga0207428_10021600 3300027907 Bacteria 5447
527 Ga0207428_10023405 3300027907 Bacteria 5195
528 Ga0268266_10005786 3300028379 Bacteria 11448
529 Ga0268266_10007499 3300028379 Bacteria 9836
530 Ga0268266_10135855 3300028379 Bacteria 2203
531 Ga0268265_10000041 3300028380 Bacteria 189918
532 Ga0268264_10000246 3300028381 Bacteria 102361
533 Ga0268264_10089662 3300028381 Bacteria 2648
534 Ga0265337_1000031 3300028556 Bacteria 64194
535 Ga0265319_1003061 3300028563 Bacteria 8856
536 Ga0265334_10000091 3300028573 Bacteria 64750
537 Ga0265334_10001270 3300028573 Bacteria 12251
538 Ga0265323_10005541 3300028653 Bacteria 5356
539 Ga0307517_10014055 3300028786 Bacteria 10797
540 Ga0307517_10038332 3300028786 Bacteria 5310
541 Ga0307515_10009209 3300028794 Bacteria 19123
542 Ga0307515_10011010 3300028794 Bacteria 17230
543 Ga0307515_10068065 3300028794 Bacteria 4899
544 Ga0307515_10075891 3300028794 Bacteria 4469
545 Ga0265338_10000233 3300028800 Bacteria 103593
546 Ga0265338_10007550 3300028800 Bacteria 13445
547 Ga0265338_10008581 3300028800 Bacteria 12367
548 Ga0265338_10008722 3300028800 Bacteria 12255
549 Ga0265338_10013142 3300028800 Bacteria 9378
550 Ga0307511_10000751 3300030521 Bacteria 34613
551 Ga0307511_10008735 3300030521 Bacteria 10125
552 Ga0307512_10007694 3300030522 Bacteria 10622
553 Ga0314311_1181306 3300030733 Bacteria 2776
554 Ga0265332_10000006 3300031238 Bacteria 327963
555 Ga0265328_10013552 3300031239 Bacteria 3226
556 Ga0265320_10004172 3300031240 Bacteria 9495
557 Ga0265325_10008286 3300031241 Bacteria 6139
558 Ga0265325_10041176 3300031241 Bacteria 2422
559 Ga0265340_10007133 3300031247 Bacteria 6090
560 Ga0265340_10028204 3300031247 Bacteria 2825
561 Ga0265339_10022542 3300031249 Bacteria 3649
562 Ga0265327_10000019 3300031251 Bacteria 427653
563 Ga0265327_10000183 3300031251 Bacteria 133191
564 Ga0307513_10014769 3300031456 Bacteria 9496
565 Ga0307513_10027182 3300031456 Bacteria 6574
566 Ga0307513_10140542 3300031456 Bacteria 2342
567 Ga0307513_10170324 3300031456 Bacteria 2056
568 Ga0307509_10188955 3300031507 Bacteria 1913
569 Ga0307408_100003857 3300031548 Bacteria 10200
570 Ga0307408_100005598 3300031548 Bacteria 8399
571 Ga0307408_100006285 3300031548 Bacteria 7886
572 Ga0307408_100007559 3300031548 Bacteria 7185
573 Ga0307408_100016251 3300031548 Bacteria 4964
574 Ga0307408_100017107 3300031548 Bacteria 4850
575 Ga0307408_100019305 3300031548 Bacteria 4588
576 Ga0307408_100019852 3300031548 Bacteria 4527
577 Ga0265313_10016922 3300031595 Bacteria 4170
578 Ga0307508_10004145 3300031616 Bacteria 14266
579 Ga0307508_10005673 3300031616 Bacteria 11829
580 Ga0307514_10001437 3300031649 Bacteria 29185
581 Ga0307514_10004905 3300031649 Bacteria 12158
582 Ga0307514_10019860 3300031649 Bacteria 5494
583 Ga0307514_10026254 3300031649 Bacteria 4711
584 Ga0316575_10000018 3300031665 Bacteria 42928
585 Ga0316575_10001941 3300031665 Bacteria 6843
586 Ga0316579_10013154 3300031691 Bacteria 3557
587 Ga0265314_10004372 3300031711 Bacteria 13149
588 Ga0265314_10026176 3300031711 Bacteria 4387
589 Ga0265342_10007083 3300031712 Bacteria 8264
590 Ga0316576_10004581 3300031727 Bacteria 8314
591 Ga0316578_10000364 3300031728 Bacteria 14435
592 Ga0316578_10025309 3300031728 Bacteria 3335
593 Ga0307516_10093837 3300031730 Bacteria 2826
594 Ga0307405_10001845 3300031731 Bacteria 9086
595 Ga0307405_10002105 3300031731 Bacteria 8674
596 Ga0307405_10010452 3300031731 Bacteria 4811
597 Ga0307405_10011740 3300031731 Bacteria 4608
598 Ga0307405_10015727 3300031731 Bacteria 4105
599 Ga0307405_10018242 3300031731 Bacteria 3868
600 Ga0307405_10032042 3300031731 Bacteria 3102
601 Ga0307405_10052973 3300031731 Bacteria 2525
602 Ga0307413_10001911 3300031824 Bacteria 8246
603 Ga0307413_10014644 3300031824 Bacteria 3992
604 Ga0307410_10000323 3300031852 Bacteria 18618
605 Ga0307410_10014413 3300031852 Bacteria 4650
606 Ga0307410_10017434 3300031852 Bacteria 4313
607 Ga0307410_10025312 3300031852 Bacteria 3722
608 Ga0307410_10047928 3300031852 Bacteria 2859
609 Ga0307410_10048087 3300031852 Bacteria 2854
610 Ga0307406_10000126 3300031901 Bacteria 44932
611 Ga0307406_10001419 3300031901 Bacteria 13274
612 Ga0307406_10002924 3300031901 Bacteria 9302
613 Ga0307406_10004754 3300031901 Bacteria 7396
614 Ga0307406_10015634 3300031901 Bacteria 4396
615 Ga0307406_10033406 3300031901 Bacteria 3149
616 Ga0307406_10040519 3300031901 Bacteria 2897
617 Ga0307406_10061689 3300031901 Bacteria 2422
618 Ga0307407_10002987 3300031903 Bacteria 6792
619 Ga0307407_10003910 3300031903 Bacteria 6219
620 Ga0307407_10010042 3300031903 Bacteria 4444
621 Ga0307407_10015535 3300031903 Bacteria 3767
622 Ga0307407_10023760 3300031903 Bacteria 3203
623 Ga0307407_10028232 3300031903 Bacteria 2997
624 Ga0307412_10002071 3300031911 Bacteria 11131
625 Ga0307412_10005539 3300031911 Bacteria 7092
626 Ga0307412_10008137 3300031911 Bacteria 5974
627 Ga0307412_10010104 3300031911 Bacteria 5428
628 Ga0307412_10013117 3300031911 Bacteria 4849
629 Ga0307412_10016091 3300031911 Bacteria 4447
630 Ga0307412_10018006 3300031911 Bacteria 4240
631 Ga0307412_10064512 3300031911 Bacteria 2475
632 Ga0307412_10114192 3300031911 Bacteria 1933
633 Ga0307409_100002136 3300031995 Bacteria 10185
634 Ga0307409_100002325 3300031995 Bacteria 9871
635 Ga0307409_100006212 3300031995 Bacteria 6992
636 Ga0307409_100021393 3300031995 Bacteria 4434
637 Ga0307409_100031733 3300031995 Bacteria 3818
638 Ga0307409_100036390 3300031995 Bacteria 3618
639 Ga0307416_100000046 3300032002 Bacteria 120916
640 Ga0307416_100010993 3300032002 Bacteria 6009
641 Ga0307416_100015457 3300032002 Bacteria 5274
642 Ga0307416_100015813 3300032002 Bacteria 5223
643 Ga0307416_100028464 3300032002 Bacteria 4155
644 Ga0307416_100028502 3300032002 Bacteria 4153
645 Ga0307416_100039439 3300032002 Bacteria 3657
646 Ga0307416_100120896 3300032002 Bacteria 2333
647 Ga0307416_100146689 3300032002 Bacteria 2156
648 Ga0307411_10000436 3300032005 Bacteria 14249
649 Ga0307411_10042891 3300032005 Bacteria 2891
650 Ga0307415_100000050 3300032126 Bacteria 51540
651 Ga0307415_100001823 3300032126 Bacteria 10436
652 Ga0307415_100030264 3300032126 Bacteria 3472
653 Ga0307415_100031243 3300032126 Bacteria 3428
654 Ga0307415_100044246 3300032126 Bacteria 2975
655 Ga0316585_10012240 3300032137 Bacteria 2538
656 Ga0316585_10013757 3300032137 Bacteria 2410
657 Ga0307507_10013353 3300033179 Bacteria 9980
658 Ga0307507_10119239 3300033179 Bacteria 2117
659 Ga0307510_10027928 3300033180 Bacteria 6453
660 Ga0307510_10088495 3300033180 Bacteria 2956
661 Ga0373926_0000865 3300035083 Bacteria 8653
662 Ga0373926_0002814 3300035083 Bacteria 5557
663 Ga0373934_0006884 3300035086 Bacteria 4220
664 Ga0373944_0003068 3300035089 Bacteria 4293
665 Ga0373923_0003076 3300035111 Bacteria 5285
666 Ga0373923_0007372 3300035111 Bacteria 3863
667 Ga0373923_0027195 3300035111 Bacteria 2280
668 Ga0373936_0008511 3300035113 Bacteria 3865
669 Ga0373945_0000182 3300035116 Bacteria 16849
670 Ga0373954_0005660 3300035118 Bacteria 5416
671 Ga0373954_0007919 3300035118 Bacteria 4654
672 Ga0373956_0001955 3300035119 Bacteria 8527
673 Ga0373956_0003024 3300035119 Bacteria 6811
674 Ga0373957_0000075 3300035120 Bacteria 24277
675 Ga0373957_0005287 3300035120 Bacteria 3995
676 Ga0373943_0000977 3300035170 Bacteria 12693
677 Ga0373943_0008756 3300035170 Bacteria 4532
678 Ga0373946_0000413 3300035171 Bacteria 13922
679 Ga0373955_0000013 3300035172 Bacteria 73449
680 Ga0316574_0000620 3300035398 Bacteria 14834
681 Ga0316574_0006103 3300035398 Bacteria 6483
682 Ga0316574_0099693 3300035398 Bacteria 1858
683 Ga0373924_0000065 3300035410 Bacteria 27687
684 Ga0373924_0002376 3300035410 Bacteria 6335
685 Ga0373924_0004378 3300035410 Bacteria 4927
686 Ga0373931_0017406 3300035691 Bacteria 3554
687 Ga0373935_0000348 3300035692 Bacteria 23484
688 Ga0373935_0004199 3300035692 Bacteria 8436
689 Ga0373935_0084097 3300035692 Bacteria 2072
690 Ga0373927_0006703 3300035695 Bacteria 7835
691 Ga0373933_0009213 3300035724 Bacteria 5389
692 Ga0373933_0013657 3300035724 Bacteria 4503
693 Ga0373933_0057308 3300035724 Bacteria 2341
694 Ga0373947_0000004 3300035725 Bacteria 248228
695 Ga0373937_0000336 3300036401 Bacteria 44361
696 Ga0373937_0058487 3300036401 Bacteria 3541
697 Ga0373937_0070358 3300036401 Bacteria 3227
698 Ga0316582_0005540 3300036647 Bacteria 6515
699 Ga0373925_0000008 3300037068 Bacteria 249158
700 Ga0373925_0034901 3300037068 Bacteria 3708
701 Ga0373925_0057053 3300037068 Bacteria 2925
702 Ga0395899_0000958 3300037312 Bacteria 26854
703 Ga0395899_0001686 3300037312 Bacteria 18415
704 Ga0395899_0005130 3300037312 Bacteria 10185
705 Ga0395900_0005784 3300037418 Bacteria 12916
706 Ga0395900_0016794 3300037418 Bacteria 7466
707 Ga0395900_0059129 3300037418 Bacteria 3946
708 Ga0395900_0060860 3300037418 Bacteria 3884
709 Ga0395900_0222184 3300037418 Bacteria 1903
710 Ga0395898_0000098 3300037466 Bacteria 229806
711 Ga0395898_0008019 3300037466 Bacteria 11200
712 Ga0395898_0057804 3300037466 Bacteria 3778
713 Ga0395898_0062169 3300037466 Bacteria 3626
714 Ga0395898_0099706 3300037466 Bacteria 2790
715 Ga0395898_0108430 3300037466 Bacteria 2662
716 Ga0395898_0114974 3300037466 Bacteria 2578
717 Ga0395905_0005189 3300037471 Bacteria 13351
718 Ga0436364_0132601 3300037853 Bacteria 24278
719 Ga0436364_0214533 3300037853 Bacteria 14394
720 Ga0436364_0220436 3300037853 Bacteria 2228
721 Ga0436364_0287407 3300037853 Bacteria 132611
722 Ga0436364_0370872 3300037853 Bacteria 2378
723 Ga0436364_0711490 3300037853 Bacteria 21692
724 Ga0436364_1085870 3300037853 Bacteria 14936
725 Ga0436364_1379988 3300037853 Bacteria 24630
726 Ga0395901_0004916 3300038443 Bacteria 13488
727 Ga0395901_0007569 3300038443 Bacteria 10967
728 Ga0395901_0012624 3300038443 Bacteria 8571
729 Ga0395901_0012908 3300038443 Bacteria 8473
730 Ga0395901_0024722 3300038443 Bacteria 6167
731 Ga0395901_0029932 3300038443 Bacteria 5608
732 Ga0395901_0048675 3300038443 Bacteria 4402
733 Ga0395901_0048880 3300038443 Bacteria 4393
734 Ga0395901_0075774 3300038443 Bacteria 3510
735 Ga0395901_0091401 3300038443 Bacteria 3186
736 Ga0400485_06792 3300038735 Bacteria 25476
737 Ga0400488_30705 3300038741 Bacteria 11438
738 Ga0400486_28029 3300038742 Bacteria 34737
739 Ga0436365_0033839 3300039437 Bacteria 5986
740 Ga0436365_1506144 3300039437 Bacteria 2818
741 Ga0439436_0001748 3300041404 Bacteria 6370
742 Ga0439436_0003722 3300041404 Bacteria 4653
743 Ga0439436_0005736 3300041404 Bacteria 3805
744 Ga0439436_0007310 3300041404 Bacteria 3399
745 Ga0439439_0001564 3300041406 Bacteria 4603
746 Ga0439466_0009365 3300041411 Bacteria 3659
747 Ga0439466_0016304 3300041411 Bacteria 2686
748 Ga0439465_0008468 3300041413 Bacteria 3247
749 Ga0439465_0015558 3300041413 Bacteria 2374
750 Ga0451837_0657235 3300041494 Bacteria 6107
751 Ga0439433_0000773 3300041999 Bacteria 6312
752 Ga0439433_0004729 3300041999 Bacteria 2923
753 Ga0439442_000057 3300042002 Bacteria 26095
754 Ga0439442_002691 3300042002 Bacteria 3487
755 Ga0439448_0004385 3300042005 Bacteria 3983
756 Ga0439432_000995 3300042006 Bacteria 10711
757 Ga0439449_0004606 3300042007 Bacteria 5327
758 Ga0439449_0005656 3300042007 Bacteria 4781
759 Ga0439452_009170 3300042010 Bacteria 2929
760 Ga0439457_000316 3300042014 Bacteria 13330
761 Ga0439457_002913 3300042014 Bacteria 4768
762 Ga0439457_004376 3300042014 Bacteria 3688
763 Ga0439457_006789 3300042014 Bacteria 2777
764 Ga0439462_0000292 3300042015 Bacteria 9240
765 Ga0450911_000036 3300042115 Bacteria 60797
766 Ga0450894_000053 3300042131 Bacteria 17593
767 Ga0450899_001598 3300042135 Bacteria 2502
768 Ga0450902_000354 3300042137 Bacteria 5599
769 Ga0450905_003021 3300042142 Bacteria 2196
770 Ga0450907_000926 3300042146 Bacteria 6981
771 Ga0439434_0007901 3300042435 Bacteria 3119
772 Ga0450901_000013 3300042533 Bacteria 18184
773 Ga0451577_0008355 3300042876 Bacteria 10075
774 Ga0451577_0020062 3300042876 Bacteria 6138
775 Ga0439440_0003562 3300042993 Bacteria 3011
776 Ga0466969_0003237 3300044656 Bacteria 8662
777 Ga0466969_0003937 3300044656 Bacteria 7886
778 Ga0466969_0011020 3300044656 Bacteria 4787
779 Ga0466969_0013550 3300044656 Bacteria 4294
780 Ga0466969_0021423 3300044656 Bacteria 3342
781 Ga0466969_0027170 3300044656 Bacteria 2931
782 Ga0466972_0002348 3300044658 Bacteria 9327
783 Ga0466972_0008717 3300044658 Bacteria 5084
784 Ga0466972_0011951 3300044658 Bacteria 4362
785 Ga0466972_0015351 3300044658 Bacteria 3829
786 Ga0466972_0016390 3300044658 Bacteria 3706
787 Ga0466972_0038856 3300044658 Bacteria 2324
788 Ga0453683_0007877 3300044673 Bacteria 7187
789 Ga0466965_0001118 3300044683 Bacteria 10481
790 Ga0466965_0003356 3300044683 Bacteria 7019
791 Ga0466965_0011414 3300044683 Bacteria 4164
792 Ga0466965_0028398 3300044683 Bacteria 2718
793 Ga0466965_0047653 3300044683 Bacteria 2122
794 Ga0466966_0002982 3300044684 Bacteria 11147
795 Ga0466966_0005391 3300044684 Bacteria 8407
796 Ga0466966_0014252 3300044684 Bacteria 5264
797 Ga0466966_0018034 3300044684 Bacteria 4661
798 Ga0466966_0027234 3300044684 Bacteria 3728
799 Ga0466966_0082728 3300044684 Bacteria 1997
800 Ga0466966_0084442 3300044684 Bacteria 1975
801 Ga0466961_0003814 3300044693 Bacteria 9431
802 Ga0466961_0011269 3300044693 Bacteria 5715
803 Ga0466961_0027590 3300044693 Bacteria 3652
804 Ga0466961_0029108 3300044693 Bacteria 3551
805 Ga0466961_0044676 3300044693 Bacteria 2835
806 Ga0466961_0049372 3300044693 Bacteria 2689
807 Ga0466961_0049728 3300044693 Bacteria 2679
808 Ga0466961_0070653 3300044693 Bacteria 2216
809 Ga0466963_0000177 3300044694 Bacteria 26340
810 Ga0466963_0000859 3300044694 Bacteria 15348
811 Ga0466963_0001380 3300044694 Bacteria 12998
812 Ga0466963_0023435 3300044694 Bacteria 3921
813 Ga0466963_0029795 3300044694 Bacteria 3516
814 Ga0466963_0035088 3300044694 Bacteria 3266
815 Ga0466963_0036504 3300044694 Bacteria 3206
816 Ga0466963_0100299 3300044694 Bacteria 1981
817 Ga0466964_0003790 3300044706 Bacteria 5543
818 Ga0466964_0005906 3300044706 Bacteria 4558
819 Ga0453684_0028691 3300044712 Bacteria 7928
820 Ga0453684_0039654 3300044712 Bacteria 6412
821 Ga0466971_0000394 3300044719 Bacteria 16912
822 Ga0466971_0000548 3300044719 Bacteria 14868
823 Ga0466971_0001709 3300044719 Bacteria 9301
824 Ga0466971_0005419 3300044719 Bacteria 5535
825 Ga0466971_0008322 3300044719 Bacteria 4526
826 Ga0466971_0014172 3300044719 Bacteria 3505
827 Ga0466971_0019127 3300044719 Bacteria 3040
828 Ga0466971_0025072 3300044719 Bacteria 2663
829 Ga0466968_0002141 3300044735 Bacteria 7197
830 Ga0466968_0020101 3300044735 Bacteria 2692
831 Ga0466968_0052709 3300044735 Bacteria 1741
832 Ga0466970_0000599 3300044765 Bacteria 17670
833 Ga0466970_0000683 3300044765 Bacteria 16572
834 Ga0466970_0000767 3300044765 Bacteria 15563
835 Ga0466970_0008393 3300044765 Bacteria 5197
836 Ga0466970_0016267 3300044765 Bacteria 3833
837 Ga0466970_0021539 3300044765 Bacteria 3357
838 Ga0466970_0026285 3300044765 Bacteria 3051
839 Ga0466970_0036219 3300044765 Bacteria 2613
840 Ga0466970_0048458 3300044765 Bacteria 2265
841 Ga0466957_0000564 3300044842 Bacteria 18694
842 Ga0466957_0002004 3300044842 Bacteria 10844
843 Ga0466957_0002915 3300044842 Bacteria 9266
844 Ga0466957_0003511 3300044842 Bacteria 8620
845 Ga0466957_0005913 3300044842 Bacteria 6897
846 Ga0466957_0006505 3300044842 Bacteria 6598
847 Ga0466957_0008538 3300044842 Bacteria 5829
848 Ga0466957_0044097 3300044842 Bacteria 2702
849 Ga0466957_0051141 3300044842 Bacteria 2515
850 Ga0466957_0092920 3300044842 Bacteria 1893
851 Ga0466960_0001455 3300044901 Bacteria 8629
852 Ga0466960_0005069 3300044901 Bacteria 5205
853 Ga0466960_0010726 3300044901 Bacteria 3812
854 Ga0466960_0024582 3300044901 Bacteria 2719
855 Ga0466960_0037581 3300044901 Bacteria 2272
856 Ga0466960_0061772 3300044901 Bacteria 1840
857 Ga0466959_0001241 3300045049 Bacteria 15410
858 Ga0466959_0003447 3300045049 Bacteria 10352
859 Ga0466959_0003694 3300045049 Bacteria 10096
860 Ga0466959_0021315 3300045049 Bacteria 4778
861 Ga0466959_0027764 3300045049 Bacteria 4197
862 Ga0466959_0046007 3300045049 Bacteria 3212
863 Ga0466959_0047755 3300045049 Bacteria 3148
864 Ga0451576_0018666 3300045051 Bacteria 7588
865 Ga0466958_0000784 3300045836 Bacteria 14001
866 Ga0466958_0002002 3300045836 Bacteria 10028
867 Ga0466958_0009851 3300045836 Bacteria 5333
868 Ga0466958_0010462 3300045836 Bacteria 5197
869 Ga0466958_0012190 3300045836 Bacteria 4861
870 Ga0466958_0014277 3300045836 Bacteria 4535
871 Ga0466958_0026999 3300045836 Bacteria 3395
872 Ga0466958_0069878 3300045836 Bacteria 2148
873 Ga0466967_0000237 3300045976 Bacteria 24015
874 Ga0466967_0000439 3300045976 Bacteria 19905
875 Ga0466967_0006810 3300045976 Bacteria 8147
876 Ga0466967_0009642 3300045976 Bacteria 7179
877 Ga0466967_0010619 3300045976 Bacteria 6920
878 Ga0466967_0014660 3300045976 Bacteria 6117
879 Ga0466967_0015286 3300045976 Bacteria 6012
880 Ga0466967_0016174 3300045976 Bacteria 5873
881 Ga0466967_0016752 3300045976 Bacteria 5791
882 Ga0466967_0027070 3300045976 Bacteria 4763
883 Ga0466967_0056008 3300045976 Bacteria 3475
884 Ga0466967_0065625 3300045976 Bacteria 3231
885 Ga0466967_0067148 3300045976 Bacteria 3198
886 Ga0466967_0071568 3300045976 Bacteria 3106
887 Ga0466967_0098880 3300045976 Bacteria 2664
888 Ga0466967_0100182 3300045976 Bacteria 2647
889 Ga0466967_0117740 3300045976 Bacteria 2449
890 Ga0466967_0133703 3300045976 Bacteria 2305
891 Ga0466967_0137789 3300045976 Bacteria 2270
892 Ga0466967_0144086 3300045976 Bacteria 2221
893 Ga0466967_0163906 3300045976 Bacteria 2088
894 Ga0466967_0172165 3300045976 Bacteria 2038
895 Ga0466967_0232033 3300045976 Bacteria 1757
896 Ga0495617_019271 3300046452 Bacteria 2307
897 Ga0495592_0000094 3300046454 Bacteria 78801
898 Ga0495592_0006662 3300046454 Bacteria 8610
899 Ga0495592_0023690 3300046454 Bacteria 4669
900 Ga0495592_0033965 3300046454 Bacteria 3847
901 Ga0495603_0000669 3300046455 Bacteria 19408
902 Ga0495603_0001010 3300046455 Bacteria 16242
903 Ga0495603_0002872 3300046455 Bacteria 10187
904 Ga0495603_0004938 3300046455 Bacteria 7984
905 Ga0495603_0006758 3300046455 Bacteria 6882
906 Ga0495603_0078736 3300046455 Bacteria 1932
907 Ga0495590_0000227 3300046457 Bacteria 30807
908 Ga0495629_0002738 3300046459 Bacteria 13485
909 Ga0495629_0004235 3300046459 Bacteria 10754
910 Ga0495629_0022598 3300046459 Bacteria 4482
911 Ga0495629_0029618 3300046459 Bacteria 3881
912 Ga0495629_0042180 3300046459 Bacteria 3207
913 Ga0495651_0000041 3300046462 Bacteria 94160
914 Ga0495651_0002692 3300046462 Bacteria 13787
915 Ga0495651_0013925 3300046462 Bacteria 6219
916 Ga0495651_0017144 3300046462 Bacteria 5612
917 Ga0495651_0020354 3300046462 Bacteria 5150
918 Ga0495651_0027748 3300046462 Bacteria 4412
919 Ga0495651_0077856 3300046462 Bacteria 2509
920 Ga0495651_0078318 3300046462 Bacteria 2500
921 Ga0495653_0000888 3300046463 Bacteria 23132
922 Ga0495653_0001553 3300046463 Bacteria 17945
923 Ga0495653_0005594 3300046463 Bacteria 10247
924 Ga0495653_0009782 3300046463 Bacteria 7840
925 Ga0495653_0016023 3300046463 Bacteria 6109
926 Ga0495653_0035328 3300046463 Bacteria 3945
927 Ga0495653_0057281 3300046463 Bacteria 2966
928 Ga0495653_0061707 3300046463 Bacteria 2835
929 Ga0495650_0002733 3300046471 Bacteria 13667
930 Ga0495580_0004763 3300046472 Bacteria 11354
931 Ga0495582_0020589 3300046473 Bacteria 3611
932 Ga0495582_0040292 3300046473 Bacteria 2572
933 Ga0495639_0005355 3300046475 Bacteria 5524
934 Ga0495639_0014844 3300046475 Bacteria 3376
935 Ga0495639_0015370 3300046475 Bacteria 3319
936 Ga0495662_0000490 3300046476 Bacteria 18037
937 Ga0495662_0003913 3300046476 Bacteria 7512
938 Ga0495662_0016589 3300046476 Bacteria 3568
939 Ga0495662_0018560 3300046476 Bacteria 3366
940 Ga0495662_0051892 3300046476 Bacteria 1979
941 Ga0495664_0006585 3300046477 Bacteria 6420
942 Ga0495664_0014367 3300046477 Bacteria 4488
943 Ga0495664_0060537 3300046477 Bacteria 2254
944 Ga0495585_0025941 3300046492 Bacteria 3351
945 Ga0495594_0004245 3300046499 Bacteria 7359
946 Ga0495594_0039489 3300046499 Bacteria 2581
947 Ga0495607_0012834 3300046501 Bacteria 5510
948 Ga0495607_0054822 3300046501 Bacteria 2296
949 Ga0495608_0000081 3300046511 Bacteria 69898
950 Ga0495608_0003322 3300046511 Bacteria 11507
951 Ga0495608_0019838 3300046511 Bacteria 4624
952 Ga0495608_0030128 3300046511 Bacteria 3676
953 Ga0495608_0050312 3300046511 Bacteria 2764
954 Ga0495608_0053335 3300046511 Bacteria 2675
955 Ga0495616_0001315 3300046513 Bacteria 17340
956 Ga0495618_0005659 3300046514 Bacteria 7597
957 Ga0495618_0010625 3300046514 Bacteria 5572
958 Ga0495620_0009619 3300046515 Bacteria 5131
959 Ga0495628_0000164 3300046516 Bacteria 57810
960 Ga0495628_0005418 3300046516 Bacteria 11179
961 Ga0495628_0011191 3300046516 Bacteria 7592
962 Ga0495628_0021126 3300046516 Bacteria 5360
963 Ga0495628_0027189 3300046516 Bacteria 4657
964 Ga0495628_0087074 3300046516 Bacteria 2422
965 Ga0495630_0004990 3300046517 Bacteria 9336
966 Ga0495630_0019859 3300046517 Bacteria 4945
967 Ga0495630_0025052 3300046517 Bacteria 4410
968 Ga0495630_0091446 3300046517 Bacteria 2299
969 Ga0495631_0000382 3300046518 Bacteria 30522
970 Ga0495637_0011661 3300046520 Bacteria 4219
971 Ga0495643_0028846 3300046522 Bacteria 3108
972 Ga0495663_0015683 3300046525 Bacteria 2136
973 Ga0495666_0014640 3300046526 Bacteria 3904
974 Ga0495666_0022852 3300046526 Bacteria 3094
975 Ga0495642_0022835 3300046528 Bacteria 2467
976 Ga0495642_0042216 3300046528 Bacteria 1857
977 Ga0495652_0000289 3300046529 Bacteria 59692
978 Ga0495652_0009990 3300046529 Bacteria 8601
979 Ga0495652_0014752 3300046529 Bacteria 7006
980 Ga0495652_0015739 3300046529 Bacteria 6769
981 Ga0495652_0023514 3300046529 Bacteria 5463
982 Ga0495652_0049005 3300046529 Bacteria 3617
983 Ga0495665_0001254 3300046531 Bacteria 13505
984 Ga0495665_0003807 3300046531 Bacteria 8164
985 Ga0495665_0007087 3300046531 Bacteria 6050
986 Ga0495665_0024051 3300046531 Bacteria 3272
987 Ga0495640_0005210 3300046533 Bacteria 10332
988 Ga0495640_0026089 3300046533 Bacteria 4228
989 Ga0495640_0041777 3300046533 Bacteria 3203
990 Ga0495640_0045965 3300046533 Bacteria 3027
991 Ga0495586_0008159 3300046535 Bacteria 5580
992 Ga0495586_0015352 3300046535 Bacteria 4075
993 Ga0495586_0022466 3300046535 Bacteria 3366
994 Ga0495587_0000038 3300046536 Bacteria 116118
995 Ga0495587_0000669 3300046536 Bacteria 22978
996 Ga0495587_0003319 3300046536 Bacteria 10743
997 Ga0495587_0011319 3300046536 Bacteria 5654
998 Ga0495587_0055243 3300046536 Bacteria 2339
999 Ga0495609_0049091 3300046538 Bacteria 1884
1000 Ga0495597_0001209 3300046542 Bacteria 19263
1001 Ga0495645_0004299 3300046543 Bacteria 9733
1002 Ga0495645_0007697 3300046543 Bacteria 7495
1003 Ga0495645_0008837 3300046543 Bacteria 7036
1004 Ga0495645_0033523 3300046543 Bacteria 3746
1005 Ga0495645_0054733 3300046543 Bacteria 2898
1006 Ga0495622_0003240 3300046557 Bacteria 7705
1007 Ga0495633_0000657 3300046558 Bacteria 31904
1008 Ga0495633_0063266 3300046558 Bacteria 1731
1009 Ga0495667_0000070 3300046559 Bacteria 78776
1010 Ga0495667_0002311 3300046559 Bacteria 12765
1011 Ga0495667_0003843 3300046559 Bacteria 10087
1012 Ga0495667_0004000 3300046559 Bacteria 9898
1013 Ga0495667_0019683 3300046559 Bacteria 4553
1014 Ga0495667_0044554 3300046559 Bacteria 2938
1015 Ga0495656_0032591 3300046615 Bacteria 2121
1016 Ga0495668_0001747 3300046616 Bacteria 19925
1017 Ga0495634_0001770 3300046642 Bacteria 18689
1018 Ga0495634_0012977 3300046642 Bacteria 6028
1019 Ga0495634_0016111 3300046642 Bacteria 5350
1020 Ga0495634_0026200 3300046642 Bacteria 4070
1021 Ga0495611_0006045 3300046648 Bacteria 5164
1022 Ga0495625_0027105 3300046660 Bacteria 4319
1023 Ga0495625_0082704 3300046660 Bacteria 2232
1024 Ga0495635_0022760 3300046663 Bacteria 4368
1025 Ga0495635_0054674 3300046663 Bacteria 2749
1026 Ga0495635_0106102 3300046663 Bacteria 1919
1027 Ga0495588_0009123 3300046674 Bacteria 4575
1028 Ga0495588_0011498 3300046674 Bacteria 4157
1029 Ga0495588_0011567 3300046674 Bacteria 4144
1030 Ga0495588_0012941 3300046674 Bacteria 3960
1031 Ga0495588_0014089 3300046674 Bacteria 3822
1032 Ga0495588_0023001 3300046674 Bacteria 3082
1033 Ga0495588_0027976 3300046674 Bacteria 2819
1034 Ga0495657_0000192 3300046675 Bacteria 55017
1035 Ga0495657_0001890 3300046675 Bacteria 17803
1036 Ga0495657_0005519 3300046675 Bacteria 9995
1037 Ga0495657_0006450 3300046675 Bacteria 9179
1038 Ga0495657_0044179 3300046675 Bacteria 3032
1039 Ga0495657_0047372 3300046675 Bacteria 2906
1040 Ga0495657_0054015 3300046675 Bacteria 2685
1041 Ga0495657_0084082 3300046675 Bacteria 2053
1042 Ga0495599_0002816 3300046678 Bacteria 10130
1043 Ga0495599_0003579 3300046678 Bacteria 9107
1044 Ga0495599_0030269 3300046678 Bacteria 3395
1045 Ga0495623_0000248 3300046679 Bacteria 34834
1046 Ga0495623_0002383 3300046679 Bacteria 12478
1047 Ga0495623_0034878 3300046679 Bacteria 3225
1048 Ga0495646_0000278 3300046680 Bacteria 26142
1049 Ga0495646_0001725 3300046680 Bacteria 13115
1050 Ga0495646_0014856 3300046680 Bacteria 4945
1051 Ga0495646_0036489 3300046680 Bacteria 3044
1052 Ga0495647_0000976 3300046681 Bacteria 8665
1053 Ga0495658_0048348 3300046683 Bacteria 2398
1054 Ga0495658_0055715 3300046683 Bacteria 2253
1055 Ga0495658_0072858 3300046683 Bacteria 1998
1056 Ga0495669_0021449 3300046684 Bacteria 2803
1057 Ga0495613_0003778 3300046689 Bacteria 11345
1058 Ga0495613_0006602 3300046689 Bacteria 8670
1059 Ga0495613_0028816 3300046689 Bacteria 4129
1060 Ga0495613_0034771 3300046689 Bacteria 3742
1061 Ga0495613_0063948 3300046689 Bacteria 2691
1062 Ga0495624_0007537 3300046690 Bacteria 7636
1063 Ga0495624_0042797 3300046690 Bacteria 2893
1064 Ga0495670_0022410 3300046691 Bacteria 3118
1065 Ga0495671_0008689 3300046692 Bacteria 5707
1066 Ga0495589_0027648 3300046794 Bacteria 2868
1067 Ga0495589_0029548 3300046794 Bacteria 2763
1068 Ga0495600_0005479 3300046809 Bacteria 7655
1069 Ga0495600_0016887 3300046809 Bacteria 4640
1070 Ga0495600_0022609 3300046809 Bacteria 4038
1071 Ga0495600_0029739 3300046809 Bacteria 3537
1072 Ga0495600_0047245 3300046809 Bacteria 2807
1073 Ga0495600_0057700 3300046809 Bacteria 2535
1074 Ga0495600_0082472 3300046809 Bacteria 2098
1075 Ga0495660_0002746 3300046810 Bacteria 11100
1076 Ga0495581_0001126 3300047315 Bacteria 14627
1077 Ga0495581_0004980 3300047315 Bacteria 7689
1078 Ga0495581_0011966 3300047315 Bacteria 5020
1079 Ga0495581_0015229 3300047315 Bacteria 4464
1080 Ga0495581_0016628 3300047315 Bacteria 4276
1081 Ga0495581_0037166 3300047315 Bacteria 2817
1082 Ga0495581_0085038 3300047315 Bacteria 1833
1083 Ga0495604_0000061 3300047317 Bacteria 94158
1084 Ga0495604_0000868 3300047317 Bacteria 25246
1085 Ga0495604_0025409 3300047317 Bacteria 4720
1086 Ga0495604_0025499 3300047317 Bacteria 4711
1087 Ga0495604_0037243 3300047317 Bacteria 3831
1088 Ga0495604_0055044 3300047317 Bacteria 3068
1089 Ga0495636_0005765 3300047318 Bacteria 4853
1090 Ga0495636_0016968 3300047318 Bacteria 2911
1091 Ga0495636_0018142 3300047318 Bacteria 2822
1092 Ga0495636_0021053 3300047318 Bacteria 2630
1093 Ga0495674_0010600 3300047319 Bacteria 8722
1094 Ga0495674_0026893 3300047319 Bacteria 5262
1095 Ga0495674_0044498 3300047319 Bacteria 3947
1096 Ga0495674_0049212 3300047319 Bacteria 3725
1097 Ga0495672_0009497 3300047320 Bacteria 7045
1098 Ga0495676_0010245 3300047321 Bacteria 8509
1099 Ga0495676_0050630 3300047321 Bacteria 3329
1100 Ga0495676_0051628 3300047321 Bacteria 3288
1101 Ga0495676_0065324 3300047321 Bacteria 2824
1102 Ga0495676_0072838 3300047321 Bacteria 2636
1103 Ga0495676_0104458 3300047321 Bacteria 2090
1104 Ga0495680_0000099 3300047322 Bacteria 78801
1105 Ga0495680_0002145 3300047322 Bacteria 20477
1106 Ga0495680_0007008 3300047322 Bacteria 10394
1107 Ga0495680_0020086 3300047322 Bacteria 5628
1108 Ga0495680_0051439 3300047322 Bacteria 3216
1109 Ga0495680_0086540 3300047322 Bacteria 2357
1110 Ga0495683_0000534 3300047323 Bacteria 28829
1111 Ga0495683_0028087 3300047323 Bacteria 2876
1112 Ga0495687_023466 3300047443 Bacteria 2945
1113 Ga0495687_024164 3300047443 Bacteria 2893
1114 Ga0495675_0000597 3300047444 Bacteria 23291
1115 Ga0495675_0004430 3300047444 Bacteria 8495
1116 Ga0495675_0016513 3300047444 Bacteria 4669
1117 Ga0495677_0026424 3300047445 Bacteria 2106
1118 Ga0495685_004937 3300047447 Bacteria 4333
1119 Ga0495685_007407 3300047447 Bacteria 3622
1120 Ga0495685_009033 3300047447 Bacteria 3322
1121 Ga0495685_009324 3300047447 Bacteria 3276
1122 Ga0495681_0007141 3300047470 Bacteria 7191
1123 Ga0495684_0018790 3300047471 Bacteria 5325
1124 Ga0495684_0026486 3300047471 Bacteria 4457
1125 Ga0495684_0027484 3300047471 Bacteria 4368
1126 Ga0495684_0074495 3300047471 Bacteria 2579
1127 Ga0495684_0076083 3300047471 Bacteria 2550
1128 Ga0495686_0018267 3300047472 Bacteria 4709
1129 Ga0495593_0003998 3300047673 Bacteria 8795
1130 Ga0495593_0009194 3300047673 Bacteria 5729
1131 Ga0495602_0000319 3300048088 Bacteria 44489
1132 Ga0495602_0017318 3300048088 Bacteria 7225
1133 Ga0495602_0018424 3300048088 Bacteria 6972
1134 Ga0495614_0012492 3300048089 Bacteria 3725
1135 Ga0495614_0022327 3300048089 Bacteria 2731
1136 Ga0495614_0039984 3300048089 Bacteria 2013
1137 Ga0496100_0008684 3300048903 Bacteria 5675
1138 Ga0496100_0009015 3300048903 Bacteria 5588
1139 Ga0496100_0009305 3300048903 Bacteria 5518
1140 Ga0496100_0013346 3300048903 Bacteria 4736
1141 Ga0496100_0021797 3300048903 Bacteria 3865
1142 Ga0496100_0024129 3300048903 Bacteria 3705
1143 Ga0496100_0045991 3300048903 Bacteria 2803
1144 Ga0496100_0053971 3300048903 Bacteria 2619
1145 Ga0496101_0006147 3300048904 Bacteria 7707
1146 Ga0496101_0018337 3300048904 Bacteria 4757
1147 Ga0496101_0036802 3300048904 Bacteria 3467
1148 Ga0496101_0069423 3300048904 Bacteria 2578
1149 Ga0496102_0000121 3300048905 Bacteria 112133
1150 Ga0496102_0003371 3300048905 Bacteria 13548
1151 Ga0496102_0011485 3300048905 Bacteria 7637
1152 Ga0496102_0013458 3300048905 Bacteria 7087
1153 Ga0496102_0016668 3300048905 Bacteria 6426
1154 Ga0496102_0021055 3300048905 Bacteria 5766
1155 Ga0496102_0044021 3300048905 Bacteria 4049
1156 Ga0496102_0045926 3300048905 Bacteria 3966
1157 Ga0496102_0054849 3300048905 Bacteria 3635
1158 Ga0496102_0055400 3300048905 Bacteria 3616
1159 Ga0496102_0078123 3300048905 Bacteria 3047
1160 Ga0496102_0116897 3300048905 Bacteria 2489
1161 Ga0496102_0146233 3300048905 Bacteria 2218
1162 Ga0496103_0000224 3300048906 Bacteria 55730
1163 Ga0496103_0009243 3300048906 Bacteria 5840
1164 Ga0496103_0024195 3300048906 Bacteria 3664
1165 Ga0496103_0030937 3300048906 Bacteria 3259
1166 Ga0496104_0003155 3300048907 Bacteria 14192
1167 Ga0496104_0010383 3300048907 Bacteria 8318
1168 Ga0496104_0026269 3300048907 Bacteria 5374
1169 Ga0496104_0042691 3300048907 Bacteria 4257
1170 Ga0496104_0072403 3300048907 Bacteria 3277
1171 Ga0496104_0092129 3300048907 Bacteria 2898
1172 Ga0496105_0001578 3300048908 Bacteria 16154
1173 Ga0496105_0002299 3300048908 Bacteria 13865
1174 Ga0496105_0013756 3300048908 Bacteria 6424
1175 Ga0496105_0062127 3300048908 Bacteria 3083
1176 Ga0496105_0080500 3300048908 Bacteria 2690
1177 Ga0496105_0150492 3300048908 Bacteria 1913
1178 Ga0496106_0030266 3300048909 Bacteria 4037
1179 Ga0496106_0033123 3300048909 Bacteria 3854
1180 Ga0496106_0046042 3300048909 Bacteria 3278
1181 Ga0496106_0066798 3300048909 Bacteria 2740
1182 Ga0496107_0028614 3300048910 Bacteria 3961
1183 Ga0496107_0045741 3300048910 Bacteria 3149
1184 Ga0496107_0047975 3300048910 Bacteria 3075
1185 Ga0496107_0068220 3300048910 Bacteria 2581
1186 Ga0496108_0011795 3300048911 Bacteria 7109
1187 Ga0496108_0011859 3300048911 Bacteria 7090
1188 Ga0496108_0043405 3300048911 Bacteria 3756
1189 Ga0496108_0063215 3300048911 Bacteria 3117
1190 Ga0496108_0075342 3300048911 Bacteria 2851
1191 Ga0496108_0097184 3300048911 Bacteria 2509
1192 Ga0496109_0004982 3300048912 Bacteria 11090
1193 Ga0496109_0007565 3300048912 Bacteria 9207
1194 Ga0496109_0027727 3300048912 Bacteria 5060
1195 Ga0496109_0027940 3300048912 Bacteria 5042
1196 Ga0496109_0047585 3300048912 Bacteria 3900
1197 Ga0496109_0051803 3300048912 Bacteria 3739
1198 Ga0496109_0054036 3300048912 Bacteria 3665
1199 Ga0496109_0054251 3300048912 Bacteria 3656
1200 Ga0496109_0067691 3300048912 Bacteria 3272
1201 Ga0496110_0000029 3300048913 Bacteria 69418
1202 Ga0496110_0006086 3300048913 Bacteria 9507
1203 Ga0496110_0007385 3300048913 Bacteria 8771
1204 Ga0496110_0042296 3300048913 Bacteria 3977
1205 Ga0496110_0070365 3300048913 Bacteria 3100
1206 Ga0496110_0074672 3300048913 Bacteria 3011
1207 Ga0496110_0077499 3300048913 Bacteria 2957
1208 Ga0496110_0136298 3300048913 Bacteria 2218
1209 Ga0496111_0001582 3300048914 Bacteria 13150
1210 Ga0496111_0017455 3300048914 Bacteria 4963
1211 Ga0496111_0023458 3300048914 Bacteria 4333
1212 Ga0496112_0081252 3300048915 Bacteria 3205
1213 Ga0496112_0084481 3300048915 Bacteria 3140
1214 Ga0496112_0087242 3300048915 Bacteria 3087
1215 Ga0496112_0184865 3300048915 Bacteria 2048
1216 Ga0496113_0002367 3300048916 Bacteria 10927
1217 Ga0496113_0022948 3300048916 Bacteria 4422
1218 Ga0496113_0051703 3300048916 Bacteria 3067
1219 Ga0496114_0001105 3300048917 Bacteria 20371
1220 Ga0496114_0002027 3300048917 Bacteria 15424
1221 Ga0496114_0008469 3300048917 Bacteria 8148
1222 Ga0496114_0008504 3300048917 Bacteria 8136
1223 Ga0496114_0068772 3300048917 Bacteria 2973
1224 Ga0496114_0096124 3300048917 Bacteria 2522
1225 Ga0496114_0140665 3300048917 Bacteria 2089
1226 Ga0496115_0001767 3300048918 Bacteria 15470
1227 Ga0496115_0004766 3300048918 Bacteria 9843
1228 Ga0496115_0017134 3300048918 Bacteria 5530
1229 Ga0496115_0034135 3300048918 Bacteria 4020
1230 Ga0496115_0047192 3300048918 Bacteria 3443
1231 Ga0496115_0063077 3300048918 Bacteria 2990
1232 Ga0496115_0122599 3300048918 Bacteria 2139
1233 Ga0496116_0000192 3300048919 Bacteria 122270
1234 Ga0496116_0001646 3300048919 Bacteria 24574
1235 Ga0496116_0024962 3300048919 Bacteria 4405
1236 Ga0496117_0000028 3300048920 Bacteria 407392
1237 Ga0496117_0000084 3300048920 Bacteria 214308
1238 Ga0496117_0000827 3300048920 Bacteria 47916
1239 Ga0496117_0001658 3300048920 Bacteria 31204
1240 Ga0496117_0003700 3300048920 Bacteria 17553
1241 Ga0496117_0004915 3300048920 Bacteria 14357
1242 Ga0496117_0005959 3300048920 Bacteria 12568
1243 Ga0496117_0009224 3300048920 Bacteria 9226
1244 Ga0496117_0010513 3300048920 Bacteria 8418
1245 Ga0496117_0013171 3300048920 Bacteria 7233
1246 Ga0496117_0020415 3300048920 Bacteria 5400
1247 Ga0496117_0046550 3300048920 Bacteria 3118
1248 Ga0496117_0053468 3300048920 Bacteria 2837
1249 Ga0496118_0000240 3300048921 Bacteria 96796
1250 Ga0496118_0000593 3300048921 Bacteria 59957
1251 Ga0496118_0006742 3300048921 Bacteria 12503
1252 Ga0496118_0009293 3300048921 Bacteria 9967
1253 Ga0496119_0000104 3300048922 Bacteria 121325
1254 Ga0496119_0001365 3300048922 Bacteria 29774
1255 Ga0496119_0003128 3300048922 Bacteria 17428
1256 Ga0496119_0003294 3300048922 Bacteria 16870
1257 Ga0496119_0003323 3300048922 Bacteria 16782
1258 Ga0496119_0015916 3300048922 Bacteria 5757
1259 Ga0496119_0018005 3300048922 Bacteria 5282
1260 Ga0496119_0024996 3300048922 Bacteria 4181
1261 Ga0496119_0058054 3300048922 Bacteria 2334
1262 Ga0496120_0000050 3300048923 Bacteria 187078
1263 Ga0496120_0000586 3300048923 Bacteria 55320
1264 Ga0496120_0000622 3300048923 Bacteria 53364
1265 Ga0496120_0001791 3300048923 Bacteria 24151
1266 Ga0496120_0008685 3300048923 Bacteria 7322
1267 Ga0496120_0034461 3300048923 Bacteria 3032
1268 Ga0496121_0000025 3300048924 Bacteria 453467
1269 Ga0496121_0000159 3300048924 Bacteria 147049
1270 Ga0496121_0008036 3300048924 Bacteria 12575
1271 Ga0496121_0008771 3300048924 Bacteria 11794
1272 Ga0496121_0009318 3300048924 Bacteria 11323
1273 Ga0496121_0046631 3300048924 Bacteria 3707
1274 Ga0496121_0062848 3300048924 Bacteria 3038
1275 Ga0496122_0000020 3300048925 Bacteria 401675
1276 Ga0496122_0000032 3300048925 Bacteria 327099
1277 Ga0496122_0000115 3300048925 Bacteria 183402
1278 Ga0496122_0000449 3300048925 Bacteria 85961
1279 Ga0496122_0000522 3300048925 Bacteria 79377
1280 Ga0496122_0009163 3300048925 Bacteria 10481
1281 Ga0496122_0032946 3300048925 Bacteria 4271
1282 Ga0496122_0040836 3300048925 Bacteria 3680
1283 Ga0496122_0049741 3300048925 Bacteria 3205
1284 Ga0496122_0106083 3300048925 Bacteria 1861
1285 Ga0496123_0000003 3300048926 Bacteria 866556
1286 Ga0496123_0000093 3300048926 Bacteria 179205
1287 Ga0496123_0000129 3300048926 Bacteria 153816
1288 Ga0496123_0000251 3300048926 Bacteria 108664
1289 Ga0496123_0000263 3300048926 Bacteria 105886
1290 Ga0496123_0003958 3300048926 Bacteria 16050
1291 Ga0496123_0013793 3300048926 Bacteria 6746
1292 Ga0496123_0020352 3300048926 Bacteria 5193
1293 Ga0496123_0021495 3300048926 Bacteria 5014
1294 Ga0496123_0041591 3300048926 Bacteria 3183
1295 Ga0496124_0000070 3300048927 Bacteria 220875
1296 Ga0496124_0001325 3300048927 Bacteria 37278
1297 Ga0496124_0001543 3300048927 Bacteria 33363
1298 Ga0496124_0006912 3300048927 Bacteria 12195
1299 Ga0496124_0009389 3300048927 Bacteria 10079
1300 Ga0496124_0014874 3300048927 Bacteria 7496
1301 Ga0496124_0023563 3300048927 Bacteria 5618
1302 Ga0496124_0058064 3300048927 Bacteria 3256
1303 Ga0496124_0097865 3300048927 Bacteria 2382
1304 Ga0496124_0109359 3300048927 Bacteria 2228
1305 Ga0496125_0000005 3300048928 Bacteria 827598
1306 Ga0496125_0000041 3300048928 Bacteria 310158
1307 Ga0496125_0001053 3300048928 Bacteria 42635
1308 Ga0496125_0002973 3300048928 Bacteria 21314
1309 Ga0496125_0004896 3300048928 Bacteria 15178
1310 Ga0496125_0005318 3300048928 Bacteria 14393
1311 Ga0496125_0006622 3300048928 Bacteria 12469
1312 Ga0496125_0006849 3300048928 Bacteria 12218
1313 Ga0496125_0008173 3300048928 Bacteria 11015
1314 Ga0496125_0023700 3300048928 Bacteria 5659
1315 Ga0496125_0025264 3300048928 Bacteria 5443
1316 Ga0496125_0025735 3300048928 Bacteria 5382
1317 Ga0496125_0035820 3300048928 Bacteria 4345
1318 Ga0496125_0099525 3300048928 Bacteria 2147
1319 Ga0496126_0000013 3300048929 Bacteria 690046
1320 Ga0496126_0000246 3300048929 Bacteria 116854
1321 Ga0496126_0000335 3300048929 Bacteria 99038
1322 Ga0496126_0000565 3300048929 Bacteria 70942
1323 Ga0496126_0000918 3300048929 Bacteria 50977
1324 Ga0496126_0008904 3300048929 Bacteria 10747
1325 Ga0496126_0012464 3300048929 Bacteria 8708
1326 Ga0496126_0028309 3300048929 Bacteria 5342
1327 Ga0496126_0030560 3300048929 Bacteria 5100
1328 Ga0496126_0030579 3300048929 Bacteria 5098
1329 Ga0501031_0001297 3300049568 Bacteria 15308
1330 Ga0501031_0003815 3300049568 Bacteria 9696
1331 Ga0501031_0006974 3300049568 Bacteria 7379
1332 Ga0501031_0014136 3300049568 Bacteria 5194
1333 Ga0501031_0015152 3300049568 Bacteria 5006
1334 Ga0501031_0040295 3300049568 Bacteria 3050
1335 Ga0501031_0040799 3300049568 Bacteria 3030
1336 Ga0501032_0002102 3300049569 Bacteria 15707
1337 Ga0501032_0008948 3300049569 Bacteria 7281
1338 Ga0501032_0013720 3300049569 Bacteria 5752
1339 Ga0501032_0014495 3300049569 Bacteria 5582
1340 Ga0501032_0047639 3300049569 Bacteria 2894
1341 Ga0501032_0049949 3300049569 Bacteria 2821
1342 Ga0501033_0006828 3300049570 Bacteria 8908
1343 Ga0501033_0007862 3300049570 Bacteria 8263
1344 Ga0501033_0030583 3300049570 Bacteria 4045
1345 Ga0501033_0034771 3300049570 Bacteria 3778
1346 Ga0501033_0040535 3300049570 Bacteria 3476
1347 Ga0501033_0080555 3300049570 Bacteria 2389
1348 Ga0501034_0000015 3300049571 Bacteria 296163
1349 Ga0501034_0000070 3300049571 Bacteria 180933
1350 Ga0501034_0000163 3300049571 Bacteria 125417
1351 Ga0501034_0001887 3300049571 Bacteria 26543
1352 Ga0501034_0018363 3300049571 Bacteria 7171
1353 Ga0501034_0027142 3300049571 Bacteria 5825
1354 Ga0501034_0049750 3300049571 Bacteria 4229
1355 Ga0501034_0127799 3300049571 Bacteria 2526
1356 Ga0501036_0009116 3300049572 Bacteria 8161
1357 Ga0501036_0019557 3300049572 Bacteria 5685
1358 Ga0501036_0025584 3300049572 Bacteria 4980
1359 Ga0501036_0064725 3300049572 Bacteria 3094
1360 Ga0501037_0000625 3300049573 Bacteria 27416
1361 Ga0501037_0000782 3300049573 Bacteria 23992
1362 Ga0501037_0022974 3300049573 Bacteria 4612
1363 Ga0501037_0023453 3300049573 Bacteria 4562
1364 Ga0501037_0029094 3300049573 Bacteria 4081
1365 Ga0501037_0030339 3300049573 Bacteria 3996
1366 Ga0501037_0043544 3300049573 Bacteria 3298
1367 Ga0501038_0001784 3300049574 Bacteria 19972
1368 Ga0501038_0002773 3300049574 Bacteria 16300
1369 Ga0501038_0002881 3300049574 Bacteria 16046
1370 Ga0501038_0007061 3300049574 Bacteria 10369
1371 Ga0501038_0022377 3300049574 Bacteria 5665
1372 Ga0501038_0024154 3300049574 Bacteria 5425
1373 Ga0501038_0028477 3300049574 Bacteria 4963
1374 Ga0501038_0041101 3300049574 Bacteria 4033
1375 Ga0501038_0073731 3300049574 Bacteria 2889
1376 Ga0501038_0107063 3300049574 Bacteria 2319
1377 Ga0501038_0119122 3300049574 Bacteria 2179
1378 Ga0501038_0124322 3300049574 Bacteria 2124
1379 Ga0501038_0128080 3300049574 Bacteria 2087
1380 Ga0501039_0010500 3300049575 Bacteria 7057
1381 Ga0501039_0016742 3300049575 Bacteria 5617
1382 Ga0501039_0026880 3300049575 Bacteria 4424
1383 Ga0501039_0037589 3300049575 Bacteria 3737
1384 Ga0501039_0054778 3300049575 Bacteria 3087
1385 Ga0501039_0096230 3300049575 Bacteria 2308
1386 Ga0501040_0020484 3300049576 Bacteria 4407
1387 Ga0501040_0034489 3300049576 Bacteria 3427
1388 Ga0501040_0039799 3300049576 Bacteria 3198
1389 Ga0501040_0047020 3300049576 Bacteria 2946
1390 Ga0501041_0003618 3300049577 Bacteria 8885
1391 Ga0501041_0023758 3300049577 Bacteria 3675
1392 Ga0501041_0029039 3300049577 Bacteria 3336
1393 Ga0501042_0022632 3300049578 Bacteria 4391
1394 Ga0501042_0043864 3300049578 Bacteria 3185
1395 Ga0501042_0063273 3300049578 Bacteria 2644
1396 Ga0501042_0088366 3300049578 Bacteria 2223
1397 Ga0501043_0005180 3300049579 Bacteria 10550
1398 Ga0501043_0006914 3300049579 Bacteria 9050
1399 Ga0501043_0008585 3300049579 Bacteria 8053
1400 Ga0501043_0010923 3300049579 Bacteria 7112
1401 Ga0501043_0020300 3300049579 Bacteria 5212
1402 Ga0501043_0063922 3300049579 Bacteria 2890
1403 Ga0501043_0131504 3300049579 Bacteria 1961
1404 Ga0501043_0139824 3300049579 Bacteria 1896
1405 Ga0501046_0000280 3300049580 Bacteria 51719
1406 Ga0501046_0000883 3300049580 Bacteria 29184
1407 Ga0501046_0001159 3300049580 Bacteria 25641
1408 Ga0501046_0008738 3300049580 Bacteria 8798
1409 Ga0501046_0055965 3300049580 Bacteria 3097
1410 Ga0501046_0056144 3300049580 Bacteria 3092
1411 Ga0501047_0000005 3300049581 Bacteria 456524
1412 Ga0501047_0000141 3300049581 Bacteria 88104
1413 Ga0501047_0000597 3300049581 Bacteria 38446
1414 Ga0501047_0006639 3300049581 Bacteria 10878
1415 Ga0501047_0007990 3300049581 Bacteria 9976
1416 Ga0501047_0016530 3300049581 Bacteria 7043
1417 Ga0501047_0019762 3300049581 Bacteria 6465
1418 Ga0501047_0027903 3300049581 Bacteria 5440
1419 Ga0501047_0038804 3300049581 Bacteria 4607
1420 Ga0501047_0041053 3300049581 Bacteria 4471
1421 Ga0501047_0055552 3300049581 Bacteria 3828
1422 Ga0501048_0000423 3300049582 Bacteria 29706
1423 Ga0501048_0006060 3300049582 Bacteria 9206
1424 Ga0501048_0008037 3300049582 Bacteria 7990
1425 Ga0501048_0024811 3300049582 Bacteria 4372
1426 Ga0501067_0000245 3300049583 Bacteria 29979
1427 Ga0501067_0002205 3300049583 Bacteria 10764
1428 Ga0501067_0004752 3300049583 Bacteria 7520
1429 Ga0501067_0006662 3300049583 Bacteria 6409
1430 Ga0501067_0023000 3300049583 Bacteria 3452
1431 Ga0501068_0001758 3300049584 Bacteria 11520
1432 Ga0501069_0014852 3300049585 Bacteria 4170
1433 Ga0501069_0016615 3300049585 Bacteria 3954
1434 Ga0501069_0024738 3300049585 Bacteria 3277
1435 Ga0501069_0064902 3300049585 Bacteria 2041
1436 Ga0501070_0000050 3300049586 Bacteria 103310
1437 Ga0501070_0000701 3300049586 Bacteria 30784
1438 Ga0501070_0001113 3300049586 Bacteria 24139
1439 Ga0501070_0002662 3300049586 Bacteria 15585
1440 Ga0501070_0014476 3300049586 Bacteria 6639
1441 Ga0501070_0016434 3300049586 Bacteria 6218
1442 Ga0501070_0024551 3300049586 Bacteria 5055
1443 Ga0501070_0040363 3300049586 Bacteria 3891
1444 Ga0501070_0074806 3300049586 Bacteria 2804
1445 Ga0501070_0079189 3300049586 Bacteria 2719
1446 Ga0501071_0002468 3300049587 Bacteria 11234
1447 Ga0501071_0002715 3300049587 Bacteria 10846
1448 Ga0501071_0011608 3300049587 Bacteria 5947
1449 Ga0501071_0060812 3300049587 Bacteria 2735
1450 Ga0501072_0011940 3300049588 Bacteria 6633
1451 Ga0501072_0020326 3300049588 Bacteria 5143
1452 Ga0501072_0040307 3300049588 Bacteria 3667
1453 Ga0501073_0011920 3300049589 Bacteria 6347
1454 Ga0501073_0014852 3300049589 Bacteria 5651
1455 Ga0501073_0026706 3300049589 Bacteria 4134
1456 Ga0501073_0118326 3300049589 Bacteria 1836
1457 Ga0501074_0002415 3300049590 Bacteria 13018
1458 Ga0501074_0006017 3300049590 Bacteria 8756
1459 Ga0501074_0020563 3300049590 Bacteria 4797
1460 Ga0501074_0050534 3300049590 Bacteria 3001
1461 Ga0501075_0046828 3300049591 Bacteria 3249
1462 Ga0501076_0011709 3300049592 Bacteria 6547
1463 Ga0501076_0029686 3300049592 Bacteria 4254
1464 Ga0501076_0038560 3300049592 Bacteria 3751
1465 Ga0501077_0008581 3300049593 Bacteria 6335
1466 Ga0501077_0071265 3300049593 Bacteria 2203
1467 Ga0501079_0020468 3300049741 Bacteria 5058
1468 Ga0501079_0035356 3300049741 Bacteria 3845
1469 Ga0501079_0037016 3300049741 Bacteria 3759
1470 Ga0501079_0038310 3300049741 Bacteria 3697
1471 Ga0501079_0100595 3300049741 Bacteria 2241
1472 Ga0501080_0000318 3300049742 Bacteria 36727
1473 Ga0501080_0000592 3300049742 Bacteria 28648
1474 Ga0501080_0002592 3300049742 Bacteria 15826
1475 Ga0501080_0014782 3300049742 Bacteria 7189
1476 Ga0501080_0046767 3300049742 Bacteria 4028
1477 Ga0501080_0091581 3300049742 Bacteria 2824
1478 Ga0501080_0133129 3300049742 Bacteria 2301
1479 Ga0501083_0002947 3300049744 Bacteria 11790
1480 Ga0501083_0008405 3300049744 Bacteria 7298
1481 Ga0501083_0026752 3300049744 Bacteria 3985
1482 Ga0501035_0004251 3300049822 Bacteria 13595
1483 Ga0501035_0006710 3300049822 Bacteria 10757
1484 Ga0501035_0008273 3300049822 Bacteria 9694
1485 Ga0501035_0012536 3300049822 Bacteria 7831
1486 Ga0501035_0015452 3300049822 Bacteria 7041
1487 Ga0501035_0023796 3300049822 Bacteria 5619
1488 Ga0501035_0033775 3300049822 Bacteria 4650
1489 Ga0501035_0085250 3300049822 Bacteria 2785
1490 Ga0501044_0003079 3300049823 Bacteria 18880
1491 Ga0501044_0004786 3300049823 Bacteria 15144
1492 Ga0501044_0008754 3300049823 Bacteria 11072
1493 Ga0501044_0009760 3300049823 Bacteria 10441
1494 Ga0501044_0054689 3300049823 Bacteria 4102
1495 Ga0501044_0056557 3300049823 Bacteria 4028
1496 Ga0501044_0108832 3300049823 Bacteria 2781
1497 Ga0501044_0166508 3300049823 Bacteria 2178
1498 nmdc:mga03n38_14040_c1 3300050490 Bacteria 3061
1499 nmdc:mga03n38_2040_c1 3300050490 Bacteria 6089
1500 nmdc:mga00v17_11769_c1 3300050491 Bacteria 4812
1501 nmdc:mga00v17_19006_c1 3300050491 Bacteria 3915
1502 nmdc:mga00v17_4667_c1 3300050491 Bacteria 7155
1503 nmdc:mga0yw44_11425_c1 3300050492 Bacteria 4584
1504 nmdc:mga0yw44_26353_c1 3300050492 Bacteria 3320
1505 nmdc:mga0yw44_29266_c1 3300050492 Bacteria 3178
1506 nmdc:mga0yw44_34279_c1 3300050492 Bacteria 2973
1507 nmdc:mga0yw44_50487_c1 3300050492 Bacteria 2515
1508 nmdc:mga0yw44_9237_c1 3300050492 Bacteria 4967
1509 nmdc:mga06z11_1166_c1 3300050494 Bacteria 9629
1510 nmdc:mga06z11_34918_c1 3300050494 Bacteria 2471
1511 nmdc:mga06z11_4395_c1 3300050494 Bacteria 5548
1512 nmdc:mga04h51_3426_c1 3300050495 Bacteria 3857
1513 nmdc:mga04h51_530_c1 3300050495 Bacteria 9048
1514 nmdc:mga07m45_1731_c1 3300050496 Bacteria 10054
1515 nmdc:mga07m45_28936_c1 3300050496 Bacteria 3060
1516 nmdc:mga05p37_14800_c1 3300050507 Bacteria 9368
1517 nmdc:mga05p37_2661_c1 3300050507 Bacteria 20811
1518 nmdc:mga0qj67_12131_c1 3300050509 Bacteria 6481
1519 nmdc:mga06r32_11849_c1 3300050510 Bacteria 7853
1520 nmdc:mga06r32_1669_c3 3300050510 Bacteria 9384
1521 nmdc:mga06r32_288_c1 3300050510 Bacteria 41844
1522 nmdc:mga08y16_2042_c1 3300050511 Bacteria 20694
1523 nmdc:mga08y16_54408_c1 3300050511 Bacteria 4182
1524 nmdc:mga08y16_83547_c1 3300050511 Bacteria 3328
1525 nmdc:mga0n895_24107_c1 3300050512 Bacteria 5730
1526 nmdc:mga0n895_3611_c1 3300050512 Bacteria 12507
1527 nmdc:mga0rr50_2329_c1 3300050513 Bacteria 10669
1528 nmdc:mga0rr50_9742_c1 3300050513 Bacteria 6062
1529 nmdc:mga08x19_26384_c1 3300050514 Bacteria 3625
1530 nmdc:mga08x19_600_c1 3300050514 Bacteria 23378
1531 nmdc:mga0a205_128026_c1 3300050515 Bacteria 2439
1532 nmdc:mga0a205_228_c1 3300050515 Bacteria 39737
1533 nmdc:mga0sz30_2197_c2 3300050516 Bacteria 4855
1534 Ga0495601_0009778 3300053077 Bacteria 5672
1535 Ga0495601_0015455 3300053077 Bacteria 4613
1536 Ga0495601_0018005 3300053077 Bacteria 4294
1537 Ga0495601_0029992 3300053077 Bacteria 3376
1538 Ga0495601_0040946 3300053077 Bacteria 2903
1539 Ga0495612_0008717 3300053078 Bacteria 4113
1540 Ga0495612_0024377 3300053078 Bacteria 2428
1541 Ga0500635_0000004 3300053080 Bacteria 210675
1542 Ga0500635_0002469 3300053080 Bacteria 4588
1543 Ga0495595_0000246 3300053084 Bacteria 21386
1544 Ga0495595_0032678 3300053084 Bacteria 2344
1545 Ga0495619_0001561 3300053085 Bacteria 15068
1546 Ga0495619_0010924 3300053085 Bacteria 5715
1547 Ga0495619_0019382 3300053085 Bacteria 4323
1548 Ga0495619_0021621 3300053085 Bacteria 4109
1549 Ga0495619_0047803 3300053085 Bacteria 2818
1550 Ga0495619_0055024 3300053085 Bacteria 2635
1551 Ga0500643_000575 3300053087 Bacteria 25486
1552 Ga0500643_009893 3300053087 Bacteria 3600
1553 Ga0500644_0002035 3300053088 Bacteria 5132
1554 Ga0500644_0005730 3300053088 Bacteria 3146
1555 Ga0500651_0000093 3300053093 Bacteria 55843
1556 Ga0500641_0002075 3300053096 Bacteria 7106
1557 Ga0500650_0004010 3300053098 Bacteria 5239
1558 Ga0500556_0000026 3300053104 Bacteria 166874
1559 Ga0500556_0000560 3300053104 Bacteria 24819
1560 Ga0500560_006351 3300053107 Bacteria 2698
1561 Ga0500571_000456 3300053110 Bacteria 16458
1562 Ga0500655_000269 3300053133 Bacteria 12114
1563 Ga0500658_0000312 3300053134 Bacteria 21747
1564 Ga0500658_0000700 3300053134 Bacteria 13860
1565 Ga0500559_0000210 3300053136 Bacteria 46871
1566 Ga0500559_0002339 3300053136 Bacteria 9915
1567 Ga0500559_0003977 3300053136 Bacteria 7117
1568 Ga0500573_0000001 3300053140 Bacteria 436394
1569 Ga0500573_0007564 3300053140 Bacteria 5933
1570 Ga0500573_0008128 3300053140 Bacteria 5769
1571 Ga0500573_0011354 3300053140 Bacteria 4984
1572 Ga0500573_0023039 3300053140 Bacteria 3575
1573 Ga0500573_0064686 3300053140 Bacteria 2091
1574 Ga0500573_0082392 3300053140 Bacteria 1827
1575 Ga0500579_081146 3300053143 Bacteria 1812
1576 Ga0500616_0009763 3300053153 Bacteria 5795
1577 Ga0500620_000151 3300053155 Bacteria 13944
1578 Ga0500634_0061814 3300053161 Bacteria 1985
1579 Ga0501084_0002835 3300054114 Bacteria 13994
1580 Ga0501084_0028165 3300054114 Bacteria 4694
1581 Ga0501084_0135333 3300054114 Bacteria 2075
1582 Ga0501084_0187183 3300054114 Bacteria 1747
1583 Ga0501082_0007249 3300060353 Bacteria 9565
1584 Ga0501082_0016270 3300060353 Bacteria 6403
1585 Ga0501082_0019185 3300060353 Bacteria 5892
1586 Ga0501082_0033651 3300060353 Bacteria 4421
1587 Ga0501082_0045533 3300060353 Bacteria 3783
1588 Ga0466962_0000273 3300061719 Bacteria 21782
1589 Ga0466962_0000868 3300061719 Bacteria 13694
1590 Ga0466962_0003062 3300061719 Bacteria 7967
1591 Ga0466962_0008985 3300061719 Bacteria 4788
1592 Ga0466962_0028361 3300061719 Bacteria 2682
1593 Ga0530510_0017884 3300061734 Bacteria 5026
1594 Ga0530510_0082724 3300061734 Bacteria 2337
1595 Ga0530510_0096693 3300061734 Bacteria 2158

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0232033 Ga0466967_0232033_47_1675 472
2 iso_pu_bacteria 2901300506 2901304104 482
3 3300044656 Ga0466969_0021423 Ga0466969_0021423_1681_3309 491
4 3300044694 Ga0466963_0035088 Ga0466963_0035088_137_1909 491
5 3300044901 Ga0466960_0024582 Ga0466960_0024582_683_2443 494
6 3300031731 Ga0307405_10018242 Ga0307405_100182423 500
7 3300031911 Ga0307412_10114192 Ga0307412_101141921 501
8 3300037418 Ga0395900_0005784 Ga0395900_0005784_8071_9831 501
9 3300037466 Ga0395898_0057804 Ga0395898_0057804_321_2081 501
10 3300048905 Ga0496102_0054849 Ga0496102_0054849_949_2718 503
11 3300048910 Ga0496107_0068220 Ga0496107_0068220_286_2064 503
12 3300049585 Ga0501069_0064902 Ga0501069_0064902_254_1936 503
13 3300045049 Ga0466959_0021315 Ga0466959_0021315_1268_3046 504
14 3300048903 Ga0496100_0053971 Ga0496100_0053971_610_2379 504
15 3300048909 Ga0496106_0046042 Ga0496106_0046042_1280_3049 504
16 3300005981 Ga0081538_10003762 Ga0081538_100037625 506
17 3300005981 Ga0081538_10034927 Ga0081538_100349272 510
18 3300046455 Ga0495603_0078736 Ga0495603_0078736_12_1619 510
19 3300005445 Ga0070708_100006414 Ga0070708_1000064143 511
20 3300005467 Ga0070706_100022289 Ga0070706_1000222896 511
21 3300005468 Ga0070707_100014576 Ga0070707_1000145766 511
22 3300005471 Ga0070698_100032360 Ga0070698_1000323604 511
23 3300025910 Ga0207684_10017354 Ga0207684_100173546 511
24 3300025922 Ga0207646_10009064 Ga0207646_100090646 511
25 3300025922 Ga0207646_10094101 Ga0207646_100941011 511
26 3300050512 nmdc:mga0n895_24107_c1 nmdc:mga0n895_24107_c1_2783_4573 511
27 3300050513 nmdc:mga0rr50_9742_c1 nmdc:mga0rr50_9742_c1_1452_3242 511
28 3300050514 nmdc:mga08x19_26384_c1 nmdc:mga08x19_26384_c1_1154_2944 511
29 3300050515 nmdc:mga0a205_128026_c1 nmdc:mga0a205_128026_c1_57_1847 511
30 iso_pu_bacteria 2643221548 2643763611 511
31 3300021388 Ga0213875_10000250 Ga0213875_1000025025 512
32 3300037853 Ga0436364_0287407 Ga0436364_0287407_79532_81289 512
33 3300053077 Ga0495601_0029992 Ga0495601_0029992_1148_2935 512
34 3300046558 Ga0495633_0063266 Ga0495633_0063266_56_1684 513
35 3300047445 Ga0495677_0026424 Ga0495677_0026424_432_2060 513
36 3300025906 Ga0207699_10017708 Ga0207699_100177083 514
37 3300032002 Ga0307416_100039439 Ga0307416_1000394391 515
38 3300046809 Ga0495600_0082472 Ga0495600_0082472_42_1805 515
39 3300031548 Ga0307408_100016251 Ga0307408_1000162513 516
40 3300031824 Ga0307413_10014644 Ga0307413_100146442 516
41 3300031852 Ga0307410_10014413 Ga0307410_100144132 516
42 3300031903 Ga0307407_10023760 Ga0307407_100237602 516
43 3300031911 Ga0307412_10016091 Ga0307412_100160913 516
44 3300031995 Ga0307409_100006212 Ga0307409_1000062124 516
45 3300032002 Ga0307416_100015457 Ga0307416_1000154573 516
46 3300005435 Ga0070714_100012884 Ga0070714_1000128846 517
47 3300005981 Ga0081538_10026557 Ga0081538_100265573 517
48 3300025906 Ga0207699_10061634 Ga0207699_100616342 517
49 3300025929 Ga0207664_10042322 Ga0207664_100423223 517
50 3300031548 Ga0307408_100017107 Ga0307408_1000171073 517
51 3300032126 Ga0307415_100030264 Ga0307415_1000302643 517
52 3300046642 Ga0495634_0026200 Ga0495634_0026200_207_1985 517
53 3300049569 Ga0501032_0002102 Ga0501032_0002102_7244_9013 517
54 3300049571 Ga0501034_0000015 Ga0501034_0000015_242002_243771 517
55 3300049579 Ga0501043_0005180 Ga0501043_0005180_2358_4127 517
56 3300053077 Ga0495601_0040946 Ga0495601_0040946_23_1783 517
57 3300053087 Ga0500643_009893 Ga0500643_009893_1218_2948 517
58 3300005367 Ga0070667_100023307 Ga0070667_1000233075 518
59 3300037853 Ga0436364_0132601 Ga0436364_0132601_5686_7434 518
60 3300039437 Ga0436365_1506144 Ga0436365_1506144_239_1987 518
61 3300047319 Ga0495674_0026893 Ga0495674_0026893_446_2227 518
62 3300049586 Ga0501070_0079189 Ga0501070_0079189_927_2693 518
63 3300005339 Ga0070660_100005500 Ga0070660_1000055007 519
64 3300005366 Ga0070659_100018431 Ga0070659_1000184314 519
65 3300005563 Ga0068855_100130463 Ga0068855_1001304633 519
66 3300025904 Ga0207647_10012451 Ga0207647_100124515 519
67 3300025919 Ga0207657_10006095 Ga0207657_1000609511 519
68 3300025928 Ga0207700_10033204 Ga0207700_100332041 519
69 3300025929 Ga0207664_10019890 Ga0207664_100198903 519
70 3300046511 Ga0495608_0019838 Ga0495608_0019838_111_1889 519
71 3300049573 Ga0501037_0023453 Ga0501037_0023453_2726_4501 519
72 3300053140 Ga0500573_0082392 Ga0500573_0082392_172_1794 519
73 3300006028 Ga0070717_10082444 Ga0070717_100824442 520
74 3300006847 Ga0075431_100062498 Ga0075431_1000624983 520
75 3300011119 Ga0105246_10000370 Ga0105246_1000037016 520
76 3300025915 Ga0207693_10014760 Ga0207693_100147602 520
77 3300047315 Ga0495581_0015229 Ga0495581_0015229_740_2518 520
78 3300050510 nmdc:mga06r32_1669_c3 nmdc:mga06r32_1669_c3_7333_9099 520
79 3300054114 Ga0501084_0187183 Ga0501084_0187183_55_1737 520
80 3300005367 Ga0070667_100095660 Ga0070667_1000956601 521
81 3300005577 Ga0068857_100008845 Ga0068857_1000088452 521
82 3300009036 Ga0105244_10011954 Ga0105244_100119543 521
83 3300025303 Ga0209051_1001619 Ga0209051_10016192 521
84 3300035111 Ga0373923_0027195 Ga0373923_0027195_229_2007 521
85 3300036401 Ga0373937_0058487 Ga0373937_0058487_1476_3254 521
86 3300046454 Ga0495592_0023690 Ga0495592_0023690_1114_2892 521
87 3300046459 Ga0495629_0029618 Ga0495629_0029618_1961_3739 521
88 3300046476 Ga0495662_0016589 Ga0495662_0016589_306_2084 521
89 3300046535 Ga0495586_0015352 Ga0495586_0015352_187_1965 521
90 3300046679 Ga0495623_0034878 Ga0495623_0034878_1133_2911 521
91 3300046809 Ga0495600_0047245 Ga0495600_0047245_315_2093 521
92 3300047444 Ga0495675_0016513 Ga0495675_0016513_1949_3727 521
93 3300047673 Ga0495593_0009194 Ga0495593_0009194_1826_3604 521
94 3300048089 Ga0495614_0039984 Ga0495614_0039984_161_1939 521
95 3300049581 Ga0501047_0000141 Ga0501047_0000141_59578_61335 521
96 3300053078 Ga0495612_0024377 Ga0495612_0024377_176_1954 521
97 3300053085 Ga0495619_0047803 Ga0495619_0047803_376_2160 521
98 3300003203 JGI25406J46586_10008172 JGI25406J46586_100081723 522
99 3300005471 Ga0070698_100040406 Ga0070698_1000404065 522
100 3300005530 Ga0070679_100101454 Ga0070679_1001014544 522
101 3300005985 Ga0081539_10000356 Ga0081539_1000035666 522
102 3300021388 Ga0213875_10000488 Ga0213875_1000048816 522
103 3300025898 Ga0207692_10033752 Ga0207692_100337521 522
104 3300026116 Ga0207674_10002289 Ga0207674_1000228921 522
105 3300026118 Ga0207675_100037656 Ga0207675_1000376561 522
106 3300037853 Ga0436364_0370872 Ga0436364_0370872_325_2091 522
107 3300044694 Ga0466963_0023435 Ga0466963_0023435_1927_3681 522
108 3300045049 Ga0466959_0027764 Ga0466959_0027764_79_1845 522
109 3300045976 Ga0466967_0098880 Ga0466967_0098880_866_2632 522
110 3300046473 Ga0495582_0020589 Ga0495582_0020589_164_1942 522
111 3300046475 Ga0495639_0015370 Ga0495639_0015370_1492_3258 522
112 3300046513 Ga0495616_0001315 Ga0495616_0001315_12268_13998 522
113 3300046518 Ga0495631_0000382 Ga0495631_0000382_18414_20144 522
114 3300046520 Ga0495637_0011661 Ga0495637_0011661_1300_3030 522
115 3300046674 Ga0495588_0011567 Ga0495588_0011567_2384_4069 522
116 3300048903 Ga0496100_0021797 Ga0496100_0021797_1690_3543 522
117 3300048914 Ga0496111_0017455 Ga0496111_0017455_56_1831 522
118 3300048917 Ga0496114_0140665 Ga0496114_0140665_230_2050 522
119 3300005468 Ga0070707_100015820 Ga0070707_1000158202 523
120 3300005471 Ga0070698_100013176 Ga0070698_1000131763 523
121 3300009148 Ga0105243_10001051 Ga0105243_100010515 523
122 3300025922 Ga0207646_10000434 Ga0207646_1000043456 523
123 3300025935 Ga0207709_10003225 Ga0207709_100032257 523
124 3300031548 Ga0307408_100006285 Ga0307408_1000062856 523
125 3300031731 Ga0307405_10052973 Ga0307405_100529732 523
126 3300035086 Ga0373934_0006884 Ga0373934_0006884_2253_3998 523
127 3300035111 Ga0373923_0003076 Ga0373923_0003076_1266_3011 523
128 3300035113 Ga0373936_0008511 Ga0373936_0008511_955_2700 523
129 3300035118 Ga0373954_0005660 Ga0373954_0005660_1345_3090 523
130 3300035170 Ga0373943_0000977 Ga0373943_0000977_7317_9062 523
131 3300038443 Ga0395901_0029932 Ga0395901_0029932_1701_3515 523
132 3300044901 Ga0466960_0037581 Ga0466960_0037581_473_2236 523
133 3300046459 Ga0495629_0002738 Ga0495629_0002738_7278_9023 523
134 3300046473 Ga0495582_0040292 Ga0495582_0040292_337_2082 523
135 3300046475 Ga0495639_0005355 Ga0495639_0005355_2825_4570 523
136 3300046476 Ga0495662_0000490 Ga0495662_0000490_2691_4436 523
137 3300046511 Ga0495608_0053335 Ga0495608_0053335_465_2210 523
138 3300046514 Ga0495618_0005659 Ga0495618_0005659_1626_3371 523
139 3300046517 Ga0495630_0019859 Ga0495630_0019859_1754_3499 523
140 3300046522 Ga0495643_0028846 Ga0495643_0028846_394_2247 523
141 3300046526 Ga0495666_0022852 Ga0495666_0022852_267_2012 523
142 3300046531 Ga0495665_0007087 Ga0495665_0007087_2809_4554 523
143 3300046533 Ga0495640_0045965 Ga0495640_0045965_117_1862 523
144 3300046663 Ga0495635_0054674 Ga0495635_0054674_50_1795 523
145 3300046674 Ga0495588_0014089 Ga0495588_0014089_2154_3812 523
146 3300046675 Ga0495657_0047372 Ga0495657_0047372_124_1869 523
147 3300046678 Ga0495599_0030269 Ga0495599_0030269_1314_3059 523
148 3300046680 Ga0495646_0014856 Ga0495646_0014856_1447_3192 523
149 3300046681 Ga0495647_0000976 Ga0495647_0000976_5567_7312 523
150 3300046690 Ga0495624_0007537 Ga0495624_0007537_2957_4702 523
151 3300047315 Ga0495581_0001126 Ga0495581_0001126_4490_6235 523
152 3300047317 Ga0495604_0025409 Ga0495604_0025409_174_1919 523
153 3300047322 Ga0495680_0086540 Ga0495680_0086540_148_1893 523
154 3300047471 Ga0495684_0026486 Ga0495684_0026486_2135_3880 523
155 3300047673 Ga0495593_0003998 Ga0495593_0003998_6714_8459 523
156 3300053077 Ga0495601_0009778 Ga0495601_0009778_1951_3696 523
157 3300053078 Ga0495612_0008717 Ga0495612_0008717_517_2262 523
158 3300053085 Ga0495619_0001561 Ga0495619_0001561_4487_6232 523
159 3300005539 Ga0068853_100057556 Ga0068853_1000575563 524
160 3300005548 Ga0070665_100012763 Ga0070665_1000127636 524
161 3300005563 Ga0068855_100006136 Ga0068855_10000613613 524
162 3300005563 Ga0068855_100009451 Ga0068855_1000094515 524
163 3300009093 Ga0105240_10034274 Ga0105240_100342743 524
164 3300009174 Ga0105241_10014845 Ga0105241_100148453 524
165 3300009545 Ga0105237_10014162 Ga0105237_100141625 524
166 3300025254 Ga0209148_1003188 Ga0209148_10031883 524
167 3300025904 Ga0207647_10003148 Ga0207647_100031483 524
168 3300025913 Ga0207695_10001199 Ga0207695_1000119931 524
169 3300025914 Ga0207671_10000371 Ga0207671_1000037133 524
170 3300025924 Ga0207694_10006984 Ga0207694_100069844 524
171 3300025949 Ga0207667_10021635 Ga0207667_100216353 524
172 3300025949 Ga0207667_10024976 Ga0207667_100249763 524
173 3300026116 Ga0207674_10112573 Ga0207674_101125732 524
174 3300031616 Ga0307508_10004145 Ga0307508_100041455 524
175 3300031665 Ga0316575_10001941 Ga0316575_100019416 524
176 3300031691 Ga0316579_10013154 Ga0316579_100131541 524
177 3300031728 Ga0316578_10000364 Ga0316578_100003643 524
178 3300031728 Ga0316578_10025309 Ga0316578_100253093 524
179 3300032137 Ga0316585_10012240 Ga0316585_100122401 524
180 3300032137 Ga0316585_10013757 Ga0316585_100137571 524
181 3300033179 Ga0307507_10119239 Ga0307507_101192391 524
182 3300035398 Ga0316574_0000620 Ga0316574_0000620_12095_13876 524
183 3300035398 Ga0316574_0099693 Ga0316574_0099693_47_1828 524
184 3300036647 Ga0316582_0005540 Ga0316582_0005540_1291_3075 524
185 3300038443 Ga0395901_0024722 Ga0395901_0024722_309_2096 524
186 3300041404 Ga0439436_0007310 Ga0439436_0007310_231_2084 524
187 3300041411 Ga0439466_0009365 Ga0439466_0009365_422_2275 524
188 3300041413 Ga0439465_0008468 Ga0439465_0008468_980_2833 524
189 3300042007 Ga0439449_0004606 Ga0439449_0004606_2027_3880 524
190 3300042014 Ga0439457_004376 Ga0439457_004376_1311_3164 524
191 3300042435 Ga0439434_0007901 Ga0439434_0007901_125_1978 524
192 3300044694 Ga0466963_0036504 Ga0466963_0036504_926_2677 524
193 3300044842 Ga0466957_0005913 Ga0466957_0005913_4028_5779 524
194 3300044842 Ga0466957_0044097 Ga0466957_0044097_905_2671 524
195 3300044901 Ga0466960_0061772 Ga0466960_0061772_16_1767 524
196 3300045836 Ga0466958_0012190 Ga0466958_0012190_114_1865 524
197 3300045836 Ga0466958_0014277 Ga0466958_0014277_141_1907 524
198 3300046501 Ga0495607_0054822 Ga0495607_0054822_84_1850 524
199 3300046615 Ga0495656_0032591 Ga0495656_0032591_186_1952 524
200 3300046691 Ga0495670_0022410 Ga0495670_0022410_684_2450 524
201 3300046809 Ga0495600_0022609 Ga0495600_0022609_2275_4014 524
202 3300046810 Ga0495660_0002746 Ga0495660_0002746_1730_3496 524
203 3300047318 Ga0495636_0018142 Ga0495636_0018142_178_1944 524
204 3300047447 Ga0495685_007407 Ga0495685_007407_652_2418 524
205 3300053143 Ga0500579_081146 Ga0500579_081146_14_1780 524
206 iso_pu_bacteria 2875391855 2875395526 524
207 3300006844 Ga0075428_100000616 Ga0075428_10000061617 525
208 3300006846 Ga0075430_100009757 Ga0075430_1000097572 525
209 3300006880 Ga0075429_100006984 Ga0075429_1000069846 525
210 3300011119 Ga0105246_10076994 Ga0105246_100769942 525
211 3300030521 Ga0307511_10000751 Ga0307511_100007519 525
212 3300042002 Ga0439442_000057 Ga0439442_000057_15046_16830 525
213 3300044658 Ga0466972_0011951 Ga0466972_0011951_14_1774 525
214 3300045976 Ga0466967_0006810 Ga0466967_0006810_825_2585 525
215 3300048905 Ga0496102_0146233 Ga0496102_0146233_31_1809 525
216 3300048909 Ga0496106_0066798 Ga0496106_0066798_236_2014 525
217 3300048911 Ga0496108_0075342 Ga0496108_0075342_225_1979 525
218 3300048917 Ga0496114_0068772 Ga0496114_0068772_862_2640 525
219 3300048929 Ga0496126_0000013 Ga0496126_0000013_23462_25222 525
220 3300005471 Ga0070698_100006233 Ga0070698_1000062332 526
221 3300006028 Ga0070717_10052397 Ga0070717_100523972 526
222 3300013105 Ga0157369_10009270 Ga0157369_100092706 526
223 3300027907 Ga0207428_10023405 Ga0207428_100234051 526
224 3300028786 Ga0307517_10038332 Ga0307517_100383324 526
225 3300031251 Ga0265327_10000019 Ga0265327_10000019324 526
226 3300031251 Ga0265327_10000183 Ga0265327_1000018386 526
227 3300031911 Ga0307412_10013117 Ga0307412_100131171 526
228 3300031995 Ga0307409_100021393 Ga0307409_1000213933 526
229 3300037312 Ga0395899_0005130 Ga0395899_0005130_5914_7692 526
230 3300037418 Ga0395900_0016794 Ga0395900_0016794_814_2592 526
231 3300037466 Ga0395898_0062169 Ga0395898_0062169_1272_3050 526
232 3300038443 Ga0395901_0012624 Ga0395901_0012624_19_1788 526
233 3300038443 Ga0395901_0091401 Ga0395901_0091401_894_2672 526
234 3300044656 Ga0466969_0011020 Ga0466969_0011020_314_2077 526
235 3300044683 Ga0466965_0047653 Ga0466965_0047653_110_1897 526
236 3300045836 Ga0466958_0069878 Ga0466958_0069878_361_2124 526
237 3300046463 Ga0495653_0005594 Ga0495653_0005594_4366_6216 526
238 3300046477 Ga0495664_0014367 Ga0495664_0014367_82_1932 526
239 3300046516 Ga0495628_0027189 Ga0495628_0027189_45_1835 526
240 3300046517 Ga0495630_0091446 Ga0495630_0091446_378_2228 526
241 3300046531 Ga0495665_0003807 Ga0495665_0003807_2167_4017 526
242 3300046535 Ga0495586_0008159 Ga0495586_0008159_489_2339 526
243 3300046543 Ga0495645_0007697 Ga0495645_0007697_2942_4792 526
244 3300046559 Ga0495667_0003843 Ga0495667_0003843_4027_5877 526
245 3300046809 Ga0495600_0057700 Ga0495600_0057700_751_2514 526
246 3300047315 Ga0495581_0004980 Ga0495581_0004980_3353_5203 526
247 3300047317 Ga0495604_0025499 Ga0495604_0025499_2368_4131 526
248 3300047321 Ga0495676_0072838 Ga0495676_0072838_155_1939 526
249 3300047444 Ga0495675_0004430 Ga0495675_0004430_4232_6082 526
250 3300048917 Ga0496114_0001105 Ga0496114_0001105_12449_14239 526
251 3300048927 Ga0496124_0006912 Ga0496124_0006912_4546_6330 526
252 3300049578 Ga0501042_0043864 Ga0501042_0043864_427_2238 526
253 3300050507 nmdc:mga05p37_14800_c1 nmdc:mga05p37_14800_c1_5954_7714 526
254 3300053096 Ga0500641_0002075 Ga0500641_0002075_5209_6981 526
255 3300005467 Ga0070706_100066715 Ga0070706_1000667153 527
256 3300005616 Ga0068852_100012789 Ga0068852_1000127898 527
257 3300025315 Ga0207697_10014594 Ga0207697_100145942 527
258 3300025900 Ga0207710_10011096 Ga0207710_100110963 527
259 3300025910 Ga0207684_10024597 Ga0207684_100245971 527
260 3300026142 Ga0207698_10070547 Ga0207698_100705471 527
261 3300038443 Ga0395901_0012908 Ga0395901_0012908_6556_8310 527
262 3300044656 Ga0466969_0003937 Ga0466969_0003937_1834_3621 527
263 3300044684 Ga0466966_0005391 Ga0466966_0005391_5987_7774 527
264 3300044693 Ga0466961_0070653 Ga0466961_0070653_159_1946 527
265 3300044719 Ga0466971_0000548 Ga0466971_0000548_6675_8444 527
266 3300044719 Ga0466971_0008322 Ga0466971_0008322_750_2537 527
267 3300044765 Ga0466970_0016267 Ga0466970_0016267_880_2667 527
268 3300044765 Ga0466970_0048458 Ga0466970_0048458_405_2192 527
269 3300045049 Ga0466959_0001241 Ga0466959_0001241_9721_11490 527
270 3300046462 Ga0495651_0027748 Ga0495651_0027748_272_2026 527
271 3300046477 Ga0495664_0060537 Ga0495664_0060537_451_2211 527
272 3300046529 Ga0495652_0009990 Ga0495652_0009990_4080_5834 527
273 3300046559 Ga0495667_0044554 Ga0495667_0044554_151_1905 527
274 3300046674 Ga0495588_0009123 Ga0495588_0009123_177_1943 527
275 3300046675 Ga0495657_0054015 Ga0495657_0054015_426_2180 527
276 3300047322 Ga0495680_0051439 Ga0495680_0051439_953_2707 527
277 3300048908 Ga0496105_0150492 Ga0496105_0150492_86_1852 527
278 3300048918 Ga0496115_0063077 Ga0496115_0063077_768_2648 527
279 3300049574 Ga0501038_0028477 Ga0501038_0028477_359_2137 527
280 3300050511 nmdc:mga08y16_83547_c1 nmdc:mga08y16_83547_c1_74_1858 527
281 3300061719 Ga0466962_0000273 Ga0466962_0000273_15937_17706 527
282 3300005288 Ga0065714_10090062 Ga0065714_100900621 528
283 3300005456 Ga0070678_100038330 Ga0070678_1000383303 528
284 3300006163 Ga0070715_10001275 Ga0070715_100012756 528
285 3300006353 Ga0075370_10007332 Ga0075370_100073323 528
286 3300009177 Ga0105248_10102589 Ga0105248_101025893 528
287 3300021388 Ga0213875_10005151 Ga0213875_100051516 528
288 3300025315 Ga0207697_10001781 Ga0207697_100017816 528
289 3300025907 Ga0207645_10006791 Ga0207645_100067915 528
290 3300025923 Ga0207681_10022072 Ga0207681_100220722 528
291 3300025929 Ga0207664_10000869 Ga0207664_100008696 528
292 3300025935 Ga0207709_10011362 Ga0207709_100113623 528
293 3300025940 Ga0207691_10004770 Ga0207691_100047707 528
294 3300026116 Ga0207674_10040825 Ga0207674_100408251 528
295 3300026121 Ga0207683_10006712 Ga0207683_100067122 528
296 3300031548 Ga0307408_100019852 Ga0307408_1000198523 528
297 3300031901 Ga0307406_10015634 Ga0307406_100156343 528
298 3300037853 Ga0436364_1085870 Ga0436364_1085870_11063_12829 528
299 3300041413 Ga0439465_0015558 Ga0439465_0015558_376_2184 528
300 3300042015 Ga0439462_0000292 Ga0439462_0000292_7340_9148 528
301 3300042146 Ga0450907_000926 Ga0450907_000926_451_2235 528
302 3300045976 Ga0466967_0000439 Ga0466967_0000439_4721_6478 528
303 3300045976 Ga0466967_0163906 Ga0466967_0163906_126_1874 528
304 3300046499 Ga0495594_0039489 Ga0495594_0039489_317_2071 528
305 3300046528 Ga0495642_0022835 Ga0495642_0022835_219_2072 528
306 3300046533 Ga0495640_0026089 Ga0495640_0026089_383_2143 528
307 3300047443 Ga0495687_024164 Ga0495687_024164_1124_2878 528
308 3300048903 Ga0496100_0045991 Ga0496100_0045991_507_2360 528
309 3300048907 Ga0496104_0003155 Ga0496104_0003155_7897_9672 528
310 3300048911 Ga0496108_0011859 Ga0496108_0011859_2893_4668 528
311 3300048912 Ga0496109_0004982 Ga0496109_0004982_1746_3521 528
312 3300048913 Ga0496110_0000029 Ga0496110_0000029_64569_66344 528
313 3300048913 Ga0496110_0074672 Ga0496110_0074672_364_2217 528
314 3300048914 Ga0496111_0001582 Ga0496111_0001582_4234_6009 528
315 3300048915 Ga0496112_0087242 Ga0496112_0087242_1035_2888 528
316 3300048916 Ga0496113_0002367 Ga0496113_0002367_5594_7369 528
317 3300048918 Ga0496115_0122599 Ga0496115_0122599_52_1905 528
318 3300050491 nmdc:mga00v17_19006_c1 nmdc:mga00v17_19006_c1_894_2714 528
319 3300053161 Ga0500634_0061814 Ga0500634_0061814_218_1972 528
320 iso_pu_bacteria 2875391855 2875396248 528
321 iso_pu_bacteria 2912757875 2912762351 528
322 3300002773 JGI25152J39213_1000090 JGI25152J39213_100009029 529
323 3300005347 Ga0070668_100000752 Ga0070668_10000075214 529
324 3300005578 Ga0068854_100011506 Ga0068854_1000115063 529
325 3300006175 Ga0070712_100009384 Ga0070712_1000093842 529
326 3300009551 Ga0105238_10001962 Ga0105238_1000196214 529
327 3300025258 Ga0209129_1000201 Ga0209129_100020116 529
328 3300025294 Ga0209025_1000279 Ga0209025_100027916 529
329 3300025915 Ga0207693_10020593 Ga0207693_100205931 529
330 3300025939 Ga0207665_10012322 Ga0207665_100123222 529
331 3300025972 Ga0207668_10019243 Ga0207668_100192433 529
332 3300035691 Ga0373931_0017406 Ga0373931_0017406_33_1817 529
333 3300044683 Ga0466965_0011414 Ga0466965_0011414_1094_2848 529
334 3300045976 Ga0466967_0027070 Ga0466967_0027070_2567_4339 529
335 3300046674 Ga0495588_0011498 Ga0495588_0011498_2298_4094 529
336 3300046794 Ga0495589_0027648 Ga0495589_0027648_1059_2735 529
337 3300048908 Ga0496105_0013756 Ga0496105_0013756_2030_3814 529
338 3300048918 Ga0496115_0001767 Ga0496115_0001767_4064_5848 529
339 3300005364 Ga0070673_100024309 Ga0070673_1000243092 530
340 3300005366 Ga0070659_100017069 Ga0070659_1000170693 530
341 3300005435 Ga0070714_100009991 Ga0070714_1000099914 530
342 3300005435 Ga0070714_100063812 Ga0070714_1000638122 530
343 3300005547 Ga0070693_100023994 Ga0070693_1000239942 530
344 3300005563 Ga0068855_100029077 Ga0068855_1000290775 530
345 3300006237 Ga0097621_100028229 Ga0097621_1000282292 530
346 3300013307 Ga0157372_10240518 Ga0157372_102405182 530
347 3300025906 Ga0207699_10061248 Ga0207699_100612481 530
348 3300025929 Ga0207664_10003140 Ga0207664_100031408 530
349 3300025929 Ga0207664_10007844 Ga0207664_100078446 530
350 3300025935 Ga0207709_10036161 Ga0207709_100361612 530
351 3300025942 Ga0207689_10020565 Ga0207689_100205653 530
352 3300025949 Ga0207667_10154988 Ga0207667_101549882 530
353 3300026067 Ga0207678_10026466 Ga0207678_100264663 530
354 3300031727 Ga0316576_10004581 Ga0316576_100045816 530
355 3300031731 Ga0307405_10010452 Ga0307405_100104522 530
356 3300035398 Ga0316574_0006103 Ga0316574_0006103_3705_5471 530
357 3300041404 Ga0439436_0003722 Ga0439436_0003722_2319_4127 530
358 3300041406 Ga0439439_0001564 Ga0439439_0001564_1392_3200 530
359 3300041411 Ga0439466_0016304 Ga0439466_0016304_859_2667 530
360 3300041999 Ga0439433_0000773 Ga0439433_0000773_41_1849 530
361 3300042002 Ga0439442_002691 Ga0439442_002691_1431_3239 530
362 3300042006 Ga0439432_000995 Ga0439432_000995_3781_5589 530
363 3300042007 Ga0439449_0005656 Ga0439449_0005656_812_2620 530
364 3300042010 Ga0439452_009170 Ga0439452_009170_527_2335 530
365 3300042014 Ga0439457_006789 Ga0439457_006789_799_2607 530
366 3300045976 Ga0466967_0016752 Ga0466967_0016752_2473_4275 530
367 3300047315 Ga0495581_0016628 Ga0495581_0016628_2458_4242 530
368 3300047315 Ga0495581_0037166 Ga0495581_0037166_981_2747 530
369 3300048920 Ga0496117_0046550 Ga0496117_0046550_47_1813 530
370 3300048921 Ga0496118_0009293 Ga0496118_0009293_6997_8763 530
371 3300049572 Ga0501036_0019557 Ga0501036_0019557_3457_5238 530
372 3300049573 Ga0501037_0030339 Ga0501037_0030339_641_2422 530
373 3300049574 Ga0501038_0041101 Ga0501038_0041101_1012_2793 530
374 3300049576 Ga0501040_0034489 Ga0501040_0034489_1049_2830 530
375 3300049577 Ga0501041_0023758 Ga0501041_0023758_466_2247 530
376 3300049587 Ga0501071_0011608 Ga0501071_0011608_3070_4851 530
377 3300049588 Ga0501072_0040307 Ga0501072_0040307_1086_2867 530
378 3300049590 Ga0501074_0020563 Ga0501074_0020563_2442_4223 530
379 3300049592 Ga0501076_0038560 Ga0501076_0038560_133_1914 530
380 3300049593 Ga0501077_0008581 Ga0501077_0008581_3521_5302 530
381 3300053140 Ga0500573_0023039 Ga0500573_0023039_1781_3535 530
382 3300060353 Ga0501082_0045533 Ga0501082_0045533_1518_3299 530
383 3300005468 Ga0070707_100013921 Ga0070707_1000139216 531
384 3300005518 Ga0070699_100005880 Ga0070699_1000058807 531
385 3300005536 Ga0070697_100008356 Ga0070697_1000083565 531
386 3300005937 Ga0081455_10000454 Ga0081455_1000045421 531
387 3300025922 Ga0207646_10017313 Ga0207646_100173135 531
388 3300031852 Ga0307410_10047928 Ga0307410_100479282 531
389 3300035119 Ga0373956_0001955 Ga0373956_0001955_1588_3381 531
390 3300035120 Ga0373957_0000075 Ga0373957_0000075_7944_9737 531
391 3300035172 Ga0373955_0000013 Ga0373955_0000013_21628_23421 531
392 3300035410 Ga0373924_0000065 Ga0373924_0000065_6251_8044 531
393 3300035724 Ga0373933_0009213 Ga0373933_0009213_510_2303 531
394 3300036401 Ga0373937_0000336 Ga0373937_0000336_26980_28773 531
395 3300044658 Ga0466972_0015351 Ga0466972_0015351_917_2710 531
396 3300044683 Ga0466965_0003356 Ga0466965_0003356_2862_4640 531
397 3300044693 Ga0466961_0044676 Ga0466961_0044676_1011_2819 531
398 3300044694 Ga0466963_0100299 Ga0466963_0100299_67_1875 531
399 3300044706 Ga0466964_0005906 Ga0466964_0005906_2614_4422 531
400 3300044719 Ga0466971_0014172 Ga0466971_0014172_764_2557 531
401 3300044765 Ga0466970_0008393 Ga0466970_0008393_2490_4283 531
402 3300044842 Ga0466957_0006505 Ga0466957_0006505_376_2169 531
403 3300044901 Ga0466960_0005069 Ga0466960_0005069_293_2077 531
404 3300045836 Ga0466958_0026999 Ga0466958_0026999_816_2609 531
405 3300045976 Ga0466967_0014660 Ga0466967_0014660_3027_4820 531
406 3300045976 Ga0466967_0100182 Ga0466967_0100182_162_1946 531
407 3300046454 Ga0495592_0000094 Ga0495592_0000094_50029_51822 531
408 3300046462 Ga0495651_0000041 Ga0495651_0000041_65388_67181 531
409 3300046462 Ga0495651_0078318 Ga0495651_0078318_534_2279 531
410 3300046463 Ga0495653_0000888 Ga0495653_0000888_6579_8372 531
411 3300046463 Ga0495653_0057281 Ga0495653_0057281_848_2593 531
412 3300046511 Ga0495608_0000081 Ga0495608_0000081_41133_42926 531
413 3300046516 Ga0495628_0000164 Ga0495628_0000164_26964_28757 531
414 3300046529 Ga0495652_0000289 Ga0495652_0000289_30938_32731 531
415 3300046536 Ga0495587_0000038 Ga0495587_0000038_21391_23184 531
416 3300046559 Ga0495667_0000070 Ga0495667_0000070_26973_28766 531
417 3300046675 Ga0495657_0000192 Ga0495657_0000192_23066_24859 531
418 3300046678 Ga0495599_0002816 Ga0495599_0002816_4520_6313 531
419 3300046679 Ga0495623_0000248 Ga0495623_0000248_26943_28736 531
420 3300046680 Ga0495646_0001725 Ga0495646_0001725_9397_11190 531
421 3300046809 Ga0495600_0005479 Ga0495600_0005479_1459_3252 531
422 3300047317 Ga0495604_0000061 Ga0495604_0000061_26980_28773 531
423 3300047322 Ga0495680_0000099 Ga0495680_0000099_26980_28773 531
424 3300047444 Ga0495675_0000597 Ga0495675_0000597_15563_17356 531
425 3300048088 Ga0495602_0000319 Ga0495602_0000319_15717_17510 531
426 3300048905 Ga0496102_0000121 Ga0496102_0000121_105434_107203 531
427 3300048906 Ga0496103_0000224 Ga0496103_0000224_4940_6709 531
428 3300048911 Ga0496108_0063215 Ga0496108_0063215_1099_2886 531
429 3300048912 Ga0496109_0027940 Ga0496109_0027940_11_1798 531
430 3300048924 Ga0496121_0062848 Ga0496121_0062848_525_2294 531
431 3300053084 Ga0495595_0000246 Ga0495595_0000246_10524_12317 531
432 iso_pu_bacteria 2862290372 2862294749 531
433 3300005434 Ga0070709_10000118 Ga0070709_1000011825 532
434 3300005435 Ga0070714_100025037 Ga0070714_1000250372 532
435 3300005436 Ga0070713_100001150 Ga0070713_1000011502 532
436 3300005437 Ga0070710_10000216 Ga0070710_1000021625 532
437 3300005439 Ga0070711_100000161 Ga0070711_10000016133 532
438 3300005455 Ga0070663_100000324 Ga0070663_1000003245 532
439 3300006028 Ga0070717_10000504 Ga0070717_1000050421 532
440 3300006173 Ga0070716_100000491 Ga0070716_1000004912 532
441 3300021388 Ga0213875_10009992 Ga0213875_100099923 532
442 3300025898 Ga0207692_10000186 Ga0207692_100001866 532
443 3300025906 Ga0207699_10000106 Ga0207699_1000010635 532
444 3300025916 Ga0207663_10000661 Ga0207663_100006612 532
445 3300025928 Ga0207700_10000053 Ga0207700_1000005347 532
446 3300025929 Ga0207664_10000949 Ga0207664_100009496 532
447 3300025939 Ga0207665_10000166 Ga0207665_1000016627 532
448 3300035724 Ga0373933_0057308 Ga0373933_0057308_312_2057 532
449 3300037068 Ga0373925_0057053 Ga0373925_0057053_602_2395 532
450 3300037466 Ga0395898_0114974 Ga0395898_0114974_123_1907 532
451 3300037853 Ga0436364_0711490 Ga0436364_0711490_744_2504 532
452 3300044901 Ga0466960_0001455 Ga0466960_0001455_416_2209 532
453 3300047471 Ga0495684_0027484 Ga0495684_0027484_1361_3145 532
454 3300017792 Ga0163161_10082328 Ga0163161_100823282 533
455 3300031911 Ga0307412_10010104 Ga0307412_100101041 533
456 3300035083 Ga0373926_0000865 Ga0373926_0000865_5339_7189 533
457 3300035692 Ga0373935_0000348 Ga0373935_0000348_11698_13548 533
458 3300035725 Ga0373947_0000004 Ga0373947_0000004_222603_224453 533
459 3300037418 Ga0395900_0059129 Ga0395900_0059129_806_2587 533
460 3300037471 Ga0395905_0005189 Ga0395905_0005189_1510_3291 533
461 3300038443 Ga0395901_0048880 Ga0395901_0048880_1043_2824 533
462 3300038443 Ga0395901_0075774 Ga0395901_0075774_999_2783 533
463 3300041404 Ga0439436_0005736 Ga0439436_0005736_825_2615 533
464 3300048905 Ga0496102_0078123 Ga0496102_0078123_1016_2782 533
465 3300005435 Ga0070714_100081990 Ga0070714_1000819901 534
466 3300025916 Ga0207663_10050913 Ga0207663_100509132 534
467 3300025928 Ga0207700_10020110 Ga0207700_100201102 534
468 3300025929 Ga0207664_10070580 Ga0207664_100705801 534
469 3300026116 Ga0207674_10118576 Ga0207674_101185763 534
470 3300033179 Ga0307507_10013353 Ga0307507_100133535 534
471 3300035083 Ga0373926_0002814 Ga0373926_0002814_29_1789 534
472 3300035089 Ga0373944_0003068 Ga0373944_0003068_253_2013 534
473 3300035116 Ga0373945_0000182 Ga0373945_0000182_14405_16165 534
474 3300035170 Ga0373943_0008756 Ga0373943_0008756_1123_2883 534
475 3300035171 Ga0373946_0000413 Ga0373946_0000413_10513_12273 534
476 3300035692 Ga0373935_0004199 Ga0373935_0004199_391_2151 534
477 3300035695 Ga0373927_0006703 Ga0373927_0006703_1787_3547 534
478 3300037068 Ga0373925_0034901 Ga0373925_0034901_1386_3146 534
479 3300037466 Ga0395898_0008019 Ga0395898_0008019_3788_5536 534
480 3300038443 Ga0395901_0007569 Ga0395901_0007569_4347_6107 534
481 3300044694 Ga0466963_0029795 Ga0466963_0029795_1542_3305 534
482 3300044735 Ga0466968_0052709 Ga0466968_0052709_21_1709 534
483 3300045976 Ga0466967_0065625 Ga0466967_0065625_633_2402 534
484 3300046454 Ga0495592_0033965 Ga0495592_0033965_351_2132 534
485 3300046477 Ga0495664_0006585 Ga0495664_0006585_124_1884 534
486 3300046516 Ga0495628_0011191 Ga0495628_0011191_672_2453 534
487 3300046529 Ga0495652_0049005 Ga0495652_0049005_1331_3091 534
488 3300047319 Ga0495674_0010600 Ga0495674_0010600_4563_6323 534
489 3300047321 Ga0495676_0010245 Ga0495676_0010245_2389_4149 534
490 3300047322 Ga0495680_0007008 Ga0495680_0007008_8185_9945 534
491 iso_pu_bacteria 2508501122 2509112779 534
492 iso_pu_bacteria 2524023207 2524454397 534
493 iso_pu_bacteria 2921257292 2921263959 534
494 iso_pu_bacteria 2937023124 2937028812 534
495 iso_pu_bacteria 2957395598 2957396403 534
496 iso_pu_bacteria 2964615318 2964615700 534
497 iso_pu_bacteria 2967755722 2967762259 534
498 iso_pu_bacteria 2970102677 2970108639 534
499 3300002077 JGI24744J21845_10000282 JGI24744J21845_100002823 535
500 3300003659 JGI25404J52841_10000835 JGI25404J52841_100008351 535
501 3300005983 Ga0081540_1000292 Ga0081540_100029244 535
502 3300035410 Ga0373924_0002376 Ga0373924_0002376_3112_4896 535
503 3300042014 Ga0439457_002913 Ga0439457_002913_3007_4701 535
504 3300046517 Ga0495630_0025052 Ga0495630_0025052_2362_4146 535
505 3300048912 Ga0496109_0054251 Ga0496109_0054251_97_1887 535
506 3300005467 Ga0070706_100008575 Ga0070706_1000085754 536
507 3300005471 Ga0070698_100000621 Ga0070698_10000062124 536
508 3300010375 Ga0105239_10009208 Ga0105239_1000920810 536
509 3300031731 Ga0307405_10011740 Ga0307405_100117403 536
510 3300031901 Ga0307406_10061689 Ga0307406_100616891 536
511 3300031903 Ga0307407_10002987 Ga0307407_100029873 536
512 3300031911 Ga0307412_10018006 Ga0307412_100180064 536
513 3300048903 Ga0496100_0024129 Ga0496100_0024129_885_2669 536
514 3300048908 Ga0496105_0001578 Ga0496105_0001578_9474_11258 536
515 3300048910 Ga0496107_0047975 Ga0496107_0047975_159_1943 536
516 3300048918 Ga0496115_0004766 Ga0496115_0004766_3759_5543 536
517 3300048925 Ga0496122_0000449 Ga0496122_0000449_67850_69583 536
518 3300048926 Ga0496123_0000263 Ga0496123_0000263_36249_37982 536
519 3300048927 Ga0496124_0014874 Ga0496124_0014874_4300_6033 536
520 3300005981 Ga0081538_10000079 Ga0081538_1000007927 537
521 3300005985 Ga0081539_10004815 Ga0081539_1000481510 537
522 3300025910 Ga0207684_10010264 Ga0207684_100102645 537
523 3300035118 Ga0373954_0007919 Ga0373954_0007919_2088_3863 537
524 3300035120 Ga0373957_0005287 Ga0373957_0005287_337_2112 537
525 3300045976 Ga0466967_0056008 Ga0466967_0056008_946_2697 537
526 3300046462 Ga0495651_0013925 Ga0495651_0013925_1970_3745 537
527 3300046463 Ga0495653_0061707 Ga0495653_0061707_367_2142 537
528 3300046511 Ga0495608_0030128 Ga0495608_0030128_301_2076 537
529 3300046516 Ga0495628_0087074 Ga0495628_0087074_317_2092 537
530 3300047322 Ga0495680_0020086 Ga0495680_0020086_428_2203 537
531 3300048917 Ga0496114_0008504 Ga0496114_0008504_100_1863 537
532 3300049580 Ga0501046_0056144 Ga0501046_0056144_1260_3032 537
533 3300031456 Ga0307513_10027182 Ga0307513_100271823 538
534 3300035111 Ga0373923_0007372 Ga0373923_0007372_1868_3667 538
535 3300048913 Ga0496110_0077499 Ga0496110_0077499_1044_2828 538
536 3300048929 Ga0496126_0000246 Ga0496126_0000246_5840_7600 538
537 iso_pu_bacteria 2643221627 2644155412 538
538 iso_pu_bacteria 2847670302 2847670569 538
539 iso_pu_bacteria 2876392853 2876394305 538
540 iso_pu_bacteria 2904659560 2904661022 538
541 3300005341 Ga0070691_10010169 Ga0070691_100101692 539
542 3300005343 Ga0070687_100062940 Ga0070687_1000629401 539
543 3300005366 Ga0070659_100026681 Ga0070659_1000266814 539
544 3300005438 Ga0070701_10011409 Ga0070701_100114092 539
545 3300005441 Ga0070700_100023955 Ga0070700_1000239553 539
546 3300005459 Ga0068867_100021638 Ga0068867_1000216382 539
547 3300005543 Ga0070672_100017922 Ga0070672_1000179223 539
548 3300005548 Ga0070665_100007856 Ga0070665_1000078563 539
549 3300005616 Ga0068852_100023223 Ga0068852_1000232232 539
550 3300009148 Ga0105243_10008770 Ga0105243_100087702 539
551 3300009177 Ga0105248_10026802 Ga0105248_100268023 539
552 3300009553 Ga0105249_10020433 Ga0105249_100204332 539
553 3300013307 Ga0157372_10024275 Ga0157372_100242753 539
554 3300025939 Ga0207665_10005581 Ga0207665_100055819 539
555 3300028379 Ga0268266_10007499 Ga0268266_100074994 539
556 3300031456 Ga0307513_10170324 Ga0307513_101703241 539
557 3300037312 Ga0395899_0000958 Ga0395899_0000958_17627_19390 539
558 3300044684 Ga0466966_0018034 Ga0466966_0018034_538_2376 539
559 3300005843 Ga0068860_100158790 Ga0068860_1001587902 540
560 3300025935 Ga0207709_10017782 Ga0207709_100177822 540
561 3300025940 Ga0207691_10001822 Ga0207691_100018225 540
562 3300026075 Ga0207708_10000897 Ga0207708_1000089715 540
563 3300026089 Ga0207648_10001889 Ga0207648_100018894 540
564 3300028381 Ga0268264_10089662 Ga0268264_100896623 540
565 3300035724 Ga0373933_0013657 Ga0373933_0013657_2494_4269 540
566 3300047321 Ga0495676_0051628 Ga0495676_0051628_749_2509 540
567 3300048912 Ga0496109_0067691 Ga0496109_0067691_1393_3186 540
568 3300048913 Ga0496110_0007385 Ga0496110_0007385_2967_4778 540
569 3300013102 Ga0157371_10107012 Ga0157371_101070122 541
570 3300014968 Ga0157379_10169475 Ga0157379_101694751 541
571 3300026035 Ga0207703_10127966 Ga0207703_101279661 541
572 3300026078 Ga0207702_10050966 Ga0207702_100509662 541
573 3300028800 Ga0265338_10008581 Ga0265338_100085813 541
574 3300046525 Ga0495663_0015683 Ga0495663_0015683_27_1670 541
575 3300048909 Ga0496106_0033123 Ga0496106_0033123_317_2071 541
576 3300049573 Ga0501037_0000625 Ga0501037_0000625_12035_13810 541
577 3300053104 Ga0500556_0000026 Ga0500556_0000026_117131_118831 541
578 3300005329 Ga0070683_100009374 Ga0070683_1000093741 542
579 3300005530 Ga0070679_100057096 Ga0070679_1000570963 542
580 3300005577 Ga0068857_100163022 Ga0068857_1001630222 542
581 3300009147 Ga0114129_10069299 Ga0114129_100692992 542
582 3300013105 Ga0157369_10166995 Ga0157369_101669951 542
583 3300021388 Ga0213875_10000514 Ga0213875_1000051411 542
584 3300025944 Ga0207661_10035553 Ga0207661_100355532 542
585 3300037853 Ga0436364_1379988 Ga0436364_1379988_12361_14121 542
586 3300047471 Ga0495684_0076083 Ga0495684_0076083_721_2496 542
587 3300048922 Ga0496119_0024996 Ga0496119_0024996_1769_3502 542
588 3300048924 Ga0496121_0000159 Ga0496121_0000159_113438_115171 542
589 3300048926 Ga0496123_0021495 Ga0496123_0021495_450_2183 542
590 3300048928 Ga0496125_0000005 Ga0496125_0000005_682481_684214 542
591 3300048928 Ga0496125_0023700 Ga0496125_0023700_414_2135 542
592 3300048929 Ga0496126_0008904 Ga0496126_0008904_1334_3067 542
593 iso_pu_bacteria 2961114664 2961116096 542
594 iso_pu_bacteria 2968110612 2968112079 542
595 3300005339 Ga0070660_100015206 Ga0070660_1000152062 543
596 3300005535 Ga0070684_100008587 Ga0070684_1000085874 543
597 3300005535 Ga0070684_100142538 Ga0070684_1001425382 543
598 3300005618 Ga0068864_100019057 Ga0068864_1000190573 543
599 3300005842 Ga0068858_100062383 Ga0068858_1000623832 543
600 3300006880 Ga0075429_100046081 Ga0075429_1000460812 543
601 3300009098 Ga0105245_10004429 Ga0105245_100044295 543
602 3300009098 Ga0105245_10023441 Ga0105245_100234413 543
603 3300009177 Ga0105248_10072231 Ga0105248_100722312 543
604 3300011119 Ga0105246_10003548 Ga0105246_100035483 543
605 3300013308 Ga0157375_10009533 Ga0157375_100095333 543
606 3300014325 Ga0163163_10023526 Ga0163163_100235264 543
607 3300014968 Ga0157379_10018022 Ga0157379_100180223 543
608 3300025901 Ga0207688_10051593 Ga0207688_100515931 543
609 3300025919 Ga0207657_10031297 Ga0207657_100312973 543
610 3300026116 Ga0207674_10004262 Ga0207674_1000426211 543
611 3300046516 Ga0495628_0021126 Ga0495628_0021126_2154_3965 543
612 3300046529 Ga0495652_0015739 Ga0495652_0015739_3681_5492 543
613 3300046536 Ga0495587_0000669 Ga0495587_0000669_8425_10236 543
614 3300046616 Ga0495668_0001747 Ga0495668_0001747_8107_9870 543
615 3300046663 Ga0495635_0106102 Ga0495635_0106102_85_1866 543
616 3300046675 Ga0495657_0044179 Ga0495657_0044179_951_2762 543
617 3300047471 Ga0495684_0018790 Ga0495684_0018790_2086_3897 543
618 3300048088 Ga0495602_0018424 Ga0495602_0018424_2569_4380 543
619 3300048905 Ga0496102_0044021 Ga0496102_0044021_2227_4011 543
620 3300048911 Ga0496108_0097184 Ga0496108_0097184_660_2423 543
621 3300048924 Ga0496121_0046631 Ga0496121_0046631_1368_3098 543
622 3300049585 Ga0501069_0014852 Ga0501069_0014852_294_2078 543
623 3300049586 Ga0501070_0016434 Ga0501070_0016434_56_1840 543
624 3300049742 Ga0501080_0091581 Ga0501080_0091581_1026_2810 543
625 3300053077 Ga0495601_0015455 Ga0495601_0015455_2673_4484 543
626 3300053085 Ga0495619_0019382 Ga0495619_0019382_2304_4115 543
627 3300053134 Ga0500658_0000312 Ga0500658_0000312_2888_4618 543
628 3300006237 Ga0097621_100026268 Ga0097621_1000262683 544
629 3300025927 Ga0207687_10092574 Ga0207687_100925742 544
630 3300026121 Ga0207683_10010893 Ga0207683_100108933 544
631 3300046501 Ga0495607_0012834 Ga0495607_0012834_1861_3660 544
632 3300046531 Ga0495665_0024051 Ga0495665_0024051_52_1851 544
633 3300046543 Ga0495645_0033523 Ga0495645_0033523_1080_2879 544
634 3300046690 Ga0495624_0042797 Ga0495624_0042797_62_1861 544
635 3300047323 Ga0495683_0000534 Ga0495683_0000534_18101_19900 544
636 3300048917 Ga0496114_0096124 Ga0496114_0096124_646_2400 544
637 3300005339 Ga0070660_100068251 Ga0070660_1000682512 545
638 3300005436 Ga0070713_100119942 Ga0070713_1001199422 545
639 3300005617 Ga0068859_100000049 Ga0068859_100000049107 545
640 3300005844 Ga0068862_100000200 Ga0068862_10000020037 545
641 3300005985 Ga0081539_10022964 Ga0081539_100229643 545
642 3300006931 Ga0097620_100000049 Ga0097620_10000004917 545
643 3300009553 Ga0105249_10004792 Ga0105249_100047926 545
644 3300014325 Ga0163163_10027387 Ga0163163_100273872 545
645 3300025921 Ga0207652_10015342 Ga0207652_100153425 545
646 3300025929 Ga0207664_10053802 Ga0207664_100538022 545
647 3300025949 Ga0207667_10188859 Ga0207667_101888592 545
648 3300025961 Ga0207712_10001330 Ga0207712_1000133011 545
649 3300028380 Ga0268265_10000041 Ga0268265_1000004184 545
650 3300028573 Ga0265334_10001270 Ga0265334_100012706 545
651 3300032126 Ga0307415_100001823 Ga0307415_1000018234 545
652 3300035119 Ga0373956_0003024 Ga0373956_0003024_419_2185 545
653 3300035692 Ga0373935_0084097 Ga0373935_0084097_170_1936 545
654 3300044684 Ga0466966_0014252 Ga0466966_0014252_2743_4497 545
655 3300046536 Ga0495587_0011319 Ga0495587_0011319_899_2665 545
656 3300049578 Ga0501042_0022632 Ga0501042_0022632_980_2731 545
657 3300049591 Ga0501075_0046828 Ga0501075_0046828_376_2127 545
658 3300049592 Ga0501076_0029686 Ga0501076_0029686_108_1859 545
659 3300049593 Ga0501077_0071265 Ga0501077_0071265_162_1913 545
660 3300049741 Ga0501079_0038310 Ga0501079_0038310_461_2212 545
661 3300053136 Ga0500559_0002339 Ga0500559_0002339_4118_5818 545
662 3300061734 Ga0530510_0082724 Ga0530510_0082724_247_1998 545
663 3300006038 Ga0075365_10012704 Ga0075365_100127042 546
664 3300009098 Ga0105245_10087168 Ga0105245_100871681 546
665 3300020081 Ga0206354_10551289 Ga0206354_105512891 546
666 3300025906 Ga0207699_10009598 Ga0207699_100095982 546
667 3300025915 Ga0207693_10042577 Ga0207693_100425773 546
668 3300025928 Ga0207700_10034015 Ga0207700_100340152 546
669 3300025929 Ga0207664_10072195 Ga0207664_100721952 546
670 3300028794 Ga0307515_10009209 Ga0307515_1000920920 546
671 3300028800 Ga0265338_10007550 Ga0265338_1000755012 546
672 3300031731 Ga0307405_10002105 Ga0307405_100021057 546
673 3300031995 Ga0307409_100031733 Ga0307409_1000317333 546
674 3300032005 Ga0307411_10042891 Ga0307411_100428913 546
675 3300032126 Ga0307415_100044246 Ga0307415_1000442462 546
676 3300035410 Ga0373924_0004378 Ga0373924_0004378_2209_3975 546
677 3300044693 Ga0466961_0049728 Ga0466961_0049728_919_2664 546
678 3300046463 Ga0495653_0035328 Ga0495653_0035328_1171_2937 546
679 3300046511 Ga0495608_0003322 Ga0495608_0003322_8594_10360 546
680 3300046514 Ga0495618_0010625 Ga0495618_0010625_1886_3652 546
681 3300046543 Ga0495645_0004299 Ga0495645_0004299_5703_7445 546
682 3300046559 Ga0495667_0002311 Ga0495667_0002311_10618_12384 546
683 3300046663 Ga0495635_0022760 Ga0495635_0022760_1336_3102 546
684 3300046680 Ga0495646_0036489 Ga0495646_0036489_88_1854 546
685 3300046684 Ga0495669_0021449 Ga0495669_0021449_353_2107 546
686 3300046809 Ga0495600_0016887 Ga0495600_0016887_1197_2963 546
687 3300048924 Ga0496121_0009318 Ga0496121_0009318_2126_3847 546
688 3300048928 Ga0496125_0001053 Ga0496125_0001053_39549_41312 546
689 3300053085 Ga0495619_0010924 Ga0495619_0010924_1702_3468 546
690 3300014969 Ga0157376_10013386 Ga0157376_100133863 547
691 3300025944 Ga0207661_10028912 Ga0207661_100289122 547
692 3300044706 Ga0466964_0003790 Ga0466964_0003790_2167_3972 547
693 3300044842 Ga0466957_0002915 Ga0466957_0002915_3409_5214 547
694 3300045836 Ga0466958_0000784 Ga0466958_0000784_12074_13879 547
695 3300046454 Ga0495592_0006662 Ga0495592_0006662_6815_8557 547
696 3300046463 Ga0495653_0001553 Ga0495653_0001553_12033_13775 547
697 3300046471 Ga0495650_0002733 Ga0495650_0002733_8074_9834 547
698 3300046476 Ga0495662_0003913 Ga0495662_0003913_2455_4197 547
699 3300046511 Ga0495608_0050312 Ga0495608_0050312_855_2597 547
700 3300046516 Ga0495628_0005418 Ga0495628_0005418_2029_3771 547
701 3300046517 Ga0495630_0004990 Ga0495630_0004990_4171_5913 547
702 3300046526 Ga0495666_0014640 Ga0495666_0014640_1302_3044 547
703 3300046531 Ga0495665_0001254 Ga0495665_0001254_3094_4836 547
704 3300046533 Ga0495640_0041777 Ga0495640_0041777_1302_3044 547
705 3300046535 Ga0495586_0022466 Ga0495586_0022466_92_1834 547
706 3300046536 Ga0495587_0003319 Ga0495587_0003319_5861_7603 547
707 3300046543 Ga0495645_0008837 Ga0495645_0008837_3091_4833 547
708 3300046559 Ga0495667_0019683 Ga0495667_0019683_1957_3699 547
709 3300046642 Ga0495634_0012977 Ga0495634_0012977_441_2183 547
710 3300046675 Ga0495657_0006450 Ga0495657_0006450_29_1771 547
711 3300046678 Ga0495599_0003579 Ga0495599_0003579_1505_3247 547
712 3300046683 Ga0495658_0055715 Ga0495658_0055715_418_2181 547
713 3300046689 Ga0495613_0003778 Ga0495613_0003778_5886_7628 547
714 3300047315 Ga0495581_0011966 Ga0495581_0011966_3267_5009 547
715 3300047317 Ga0495604_0000868 Ga0495604_0000868_7839_9581 547
716 3300048910 Ga0496107_0045741 Ga0496107_0045741_1037_2800 547
717 3300049570 Ga0501033_0040535 Ga0501033_0040535_100_1821 547
718 3300049571 Ga0501034_0027142 Ga0501034_0027142_838_2631 547
719 3300049572 Ga0501036_0064725 Ga0501036_0064725_988_2781 547
720 3300049574 Ga0501038_0002881 Ga0501038_0002881_1633_3426 547
721 3300049576 Ga0501040_0020484 Ga0501040_0020484_2627_4390 547
722 3300049581 Ga0501047_0055552 Ga0501047_0055552_1633_3426 547
723 3300049583 Ga0501067_0023000 Ga0501067_0023000_572_2335 547
724 3300049822 Ga0501035_0015452 Ga0501035_0015452_1329_3122 547
725 3300049823 Ga0501044_0009760 Ga0501044_0009760_1489_3282 547
726 3300053077 Ga0495601_0018005 Ga0495601_0018005_101_1843 547
727 3300053093 Ga0500651_0000093 Ga0500651_0000093_42214_43944 547
728 3300053134 Ga0500658_0000700 Ga0500658_0000700_2888_4618 547
729 3300005327 Ga0070658_10040342 Ga0070658_100403423 548
730 3300005339 Ga0070660_100077012 Ga0070660_1000770121 548
731 3300005563 Ga0068855_100220376 Ga0068855_1002203761 548
732 3300005842 Ga0068858_100000003 Ga0068858_10000000333 548
733 3300014968 Ga0157379_10001992 Ga0157379_100019923 548
734 3300025909 Ga0207705_10000001 Ga0207705_100000011526 548
735 3300025919 Ga0207657_10035487 Ga0207657_100354872 548
736 3300025932 Ga0207690_10019543 Ga0207690_100195432 548
737 3300025949 Ga0207667_10021231 Ga0207667_100212313 548
738 3300026035 Ga0207703_10000006 Ga0207703_10000006111 548
739 3300028800 Ga0265338_10013142 Ga0265338_100131424 548
740 3300032002 Ga0307416_100146689 Ga0307416_1001466892 548
741 3300037418 Ga0395900_0222184 Ga0395900_0222184_86_1864 548
742 3300041494 Ga0451837_0657235 Ga0451837_0657235_1159_2922 548
743 3300044693 Ga0466961_0049372 Ga0466961_0049372_50_1819 548
744 3300045976 Ga0466967_0016174 Ga0466967_0016174_2544_4304 548
745 3300048904 Ga0496101_0069423 Ga0496101_0069423_735_2510 548
746 3300048905 Ga0496102_0003371 Ga0496102_0003371_3249_4997 548
747 3300048905 Ga0496102_0016668 Ga0496102_0016668_561_2294 548
748 3300048905 Ga0496102_0045926 Ga0496102_0045926_821_2596 548
749 3300048924 Ga0496121_0008036 Ga0496121_0008036_10594_12372 548
750 3300049586 Ga0501070_0074806 Ga0501070_0074806_234_2030 548
751 3300050494 nmdc:mga06z11_1166_c1 nmdc:mga06z11_1166_c1_7397_9172 548
752 3300050495 nmdc:mga04h51_530_c1 nmdc:mga04h51_530_c1_4578_6353 548
753 3300003578 Ga0006562J51391_1053958 Ga0006562J51391_10539582 549
754 3300005471 Ga0070698_100001158 Ga0070698_10000115820 549
755 3300006042 Ga0075368_10004038 Ga0075368_100040383 549
756 3300006048 Ga0075363_100012544 Ga0075363_1000125443 549
757 3300006846 Ga0075430_100021990 Ga0075430_1000219904 549
758 3300006847 Ga0075431_100022382 Ga0075431_1000223827 549
759 3300006852 Ga0075433_10038687 Ga0075433_100386871 549
760 3300006880 Ga0075429_100100345 Ga0075429_1001003452 549
761 3300009094 Ga0111539_10020703 Ga0111539_100207032 549
762 3300009147 Ga0114129_10037355 Ga0114129_100373552 549
763 3300009177 Ga0105248_10000108 Ga0105248_1000010824 549
764 3300025922 Ga0207646_10046390 Ga0207646_100463903 549
765 3300025927 Ga0207687_10042757 Ga0207687_100427571 549
766 3300025941 Ga0207711_10000593 Ga0207711_1000059320 549
767 3300027907 Ga0207428_10021600 Ga0207428_100216004 549
768 3300028563 Ga0265319_1003061 Ga0265319_10030615 549
769 3300028573 Ga0265334_10000091 Ga0265334_1000009130 549
770 3300028653 Ga0265323_10005541 Ga0265323_100055413 549
771 3300028800 Ga0265338_10000233 Ga0265338_1000023341 549
772 3300031240 Ga0265320_10004172 Ga0265320_100041726 549
773 3300031247 Ga0265340_10007133 Ga0265340_100071335 549
774 3300031249 Ga0265339_10022542 Ga0265339_100225423 549
775 3300031595 Ga0265313_10016922 Ga0265313_100169223 549
776 3300031711 Ga0265314_10004372 Ga0265314_100043724 549
777 3300044842 Ga0466957_0002004 Ga0466957_0002004_2643_4394 549
778 3300045836 Ga0466958_0002002 Ga0466958_0002002_566_2317 549
779 3300045976 Ga0466967_0000237 Ga0466967_0000237_7127_8878 549
780 3300048903 Ga0496100_0009015 Ga0496100_0009015_2478_4262 549
781 3300048903 Ga0496100_0013346 Ga0496100_0013346_1800_3584 549
782 3300048904 Ga0496101_0018337 Ga0496101_0018337_368_2152 549
783 3300048905 Ga0496102_0013458 Ga0496102_0013458_1492_3276 549
784 3300048907 Ga0496104_0026269 Ga0496104_0026269_565_2349 549
785 3300048907 Ga0496104_0042691 Ga0496104_0042691_521_2317 549
786 3300048908 Ga0496105_0002299 Ga0496105_0002299_3241_5025 549
787 3300048911 Ga0496108_0011795 Ga0496108_0011795_1650_3446 549
788 3300048912 Ga0496109_0007565 Ga0496109_0007565_3428_5224 549
789 3300048913 Ga0496110_0006086 Ga0496110_0006086_2680_4476 549
790 3300048913 Ga0496110_0136298 Ga0496110_0136298_58_1842 549
791 3300048917 Ga0496114_0008469 Ga0496114_0008469_3565_5349 549
792 3300050492 nmdc:mga0yw44_26353_c1 nmdc:mga0yw44_26353_c1_1213_2982 549
793 3300050492 nmdc:mga0yw44_34279_c1 nmdc:mga0yw44_34279_c1_269_2041 549
794 3300050494 nmdc:mga06z11_4395_c1 nmdc:mga06z11_4395_c1_427_2247 549
795 3300050507 nmdc:mga05p37_2661_c1 nmdc:mga05p37_2661_c1_13426_15186 549
796 3300050509 nmdc:mga0qj67_12131_c1 nmdc:mga0qj67_12131_c1_2605_4365 549
797 3300050510 nmdc:mga06r32_288_c1 nmdc:mga06r32_288_c1_37197_38957 549
798 3300050511 nmdc:mga08y16_54408_c1 nmdc:mga08y16_54408_c1_742_2502 549
799 3300053088 Ga0500644_0005730 Ga0500644_0005730_136_1917 549
800 iso_pu_bacteria 8053945823 8053948065 549
801 3300001989 JGI24739J22299_10003636 JGI24739J22299_100036363 550
802 3300005329 Ga0070683_100026289 Ga0070683_1000262893 550
803 3300005467 Ga0070706_100001268 Ga0070706_10000126812 550
804 3300005614 Ga0068856_100036826 Ga0068856_1000368264 550
805 3300005616 Ga0068852_100064681 Ga0068852_1000646813 550
806 3300005616 Ga0068852_100126261 Ga0068852_1001262612 550
807 3300005843 Ga0068860_100000286 Ga0068860_10000028618 550
808 3300006038 Ga0075365_10014987 Ga0075365_100149873 550
809 3300006048 Ga0075363_100000523 Ga0075363_1000005236 550
810 3300006051 Ga0075364_10003312 Ga0075364_100033122 550
811 3300006178 Ga0075367_10034800 Ga0075367_100348002 550
812 3300006353 Ga0075370_10015790 Ga0075370_100157902 550
813 3300009093 Ga0105240_10037482 Ga0105240_100374825 550
814 3300009147 Ga0114129_10032099 Ga0114129_100320995 550
815 3300009553 Ga0105249_10095806 Ga0105249_100958062 550
816 3300010375 Ga0105239_10036954 Ga0105239_100369545 550
817 3300025910 Ga0207684_10003330 Ga0207684_1000333011 550
818 3300025913 Ga0207695_10034932 Ga0207695_100349323 550
819 3300025920 Ga0207649_10043813 Ga0207649_100438131 550
820 3300025933 Ga0207706_10091931 Ga0207706_100919312 550
821 3300026078 Ga0207702_10016001 Ga0207702_100160015 550
822 3300026142 Ga0207698_10134565 Ga0207698_101345652 550
823 3300028379 Ga0268266_10135855 Ga0268266_101358552 550
824 3300028381 Ga0268264_10000246 Ga0268264_1000024617 550
825 3300031901 Ga0307406_10040519 Ga0307406_100405192 550
826 3300036401 Ga0373937_0070358 Ga0373937_0070358_1320_3110 550
827 3300044684 Ga0466966_0027234 Ga0466966_0027234_1813_3576 550
828 3300044765 Ga0466970_0000767 Ga0466970_0000767_2231_4033 550
829 3300045049 Ga0466959_0047755 Ga0466959_0047755_1175_2938 550
830 3300045976 Ga0466967_0009642 Ga0466967_0009642_3550_5304 550
831 3300045976 Ga0466967_0137789 Ga0466967_0137789_396_2156 550
832 3300046462 Ga0495651_0002692 Ga0495651_0002692_1899_3689 550
833 3300046463 Ga0495653_0009782 Ga0495653_0009782_4431_6221 550
834 3300046529 Ga0495652_0014752 Ga0495652_0014752_668_2458 550
835 3300046536 Ga0495587_0055243 Ga0495587_0055243_439_2229 550
836 3300046559 Ga0495667_0004000 Ga0495667_0004000_1521_3311 550
837 3300047317 Ga0495604_0037243 Ga0495604_0037243_1580_3370 550
838 3300047319 Ga0495674_0049212 Ga0495674_0049212_1782_3572 550
839 3300047320 Ga0495672_0009497 Ga0495672_0009497_2595_4364 550
840 3300047322 Ga0495680_0002145 Ga0495680_0002145_7025_8815 550
841 3300047471 Ga0495684_0074495 Ga0495684_0074495_642_2432 550
842 3300048921 Ga0496118_0006742 Ga0496118_0006742_7445_9175 550
843 3300048922 Ga0496119_0000104 Ga0496119_0000104_21160_22920 550
844 3300048923 Ga0496120_0008685 Ga0496120_0008685_2590_4350 550
845 3300048929 Ga0496126_0028309 Ga0496126_0028309_1382_3133 550
846 3300049822 Ga0501035_0085250 Ga0501035_0085250_459_2219 550
847 3300050490 nmdc:mga03n38_2040_c1 nmdc:mga03n38_2040_c1_3826_5673 550
848 3300050491 nmdc:mga00v17_11769_c1 nmdc:mga00v17_11769_c1_222_2009 550
849 3300050491 nmdc:mga00v17_4667_c1 nmdc:mga00v17_4667_c1_2910_4757 550
850 3300050492 nmdc:mga0yw44_50487_c1 nmdc:mga0yw44_50487_c1_132_1916 550
851 3300050494 nmdc:mga06z11_34918_c1 nmdc:mga06z11_34918_c1_279_2126 550
852 3300050496 nmdc:mga07m45_28936_c1 nmdc:mga07m45_28936_c1_131_1978 550
853 3300053084 Ga0495595_0032678 Ga0495595_0032678_476_2266 550
854 3300053085 Ga0495619_0021621 Ga0495619_0021621_706_2496 550
855 3300053088 Ga0500644_0002035 Ga0500644_0002035_1838_3661 550
856 3300003578 Ga0006562J51391_1099265 Ga0006562J51391_10992652 551
857 3300003578 Ga0006562J51391_1099266 Ga0006562J51391_10992661 551
858 3300003761 Ga0055535_1000522 Ga0055535_100052226 551
859 3300003762 Ga0055542_1000003 Ga0055542_100000381 551
860 3300003771 Ga0055526_1014173 Ga0055526_10141732 551
861 3300003775 Ga0055524_1013525 Ga0055524_10135252 551
862 3300003781 Ga0055536_1001522 Ga0055536_10015224 551
863 3300003784 Ga0055534_1006353 Ga0055534_10063532 551
864 3300003792 Ga0055540_1001603 Ga0055540_10016039 551
865 3300005347 Ga0070668_100075630 Ga0070668_1000756302 551
866 3300009101 Ga0105247_10000016 Ga0105247_10000016113 551
867 3300009101 Ga0105247_10001447 Ga0105247_100014477 551
868 3300009177 Ga0105248_10000890 Ga0105248_1000089016 551
869 3300013102 Ga0157371_10114335 Ga0157371_101143352 551
870 3300013306 Ga0163162_10096158 Ga0163162_100961583 551
871 3300025208 Ga0209436_104146 Ga0209436_1041462 551
872 3300025228 Ga0209672_101287 Ga0209672_1012873 551
873 3300025229 Ga0209147_100657 Ga0209147_1006579 551
874 3300025242 Ga0209258_100015 Ga0209258_100015200 551
875 3300025254 Ga0209148_1000028 Ga0209148_1000028468 551
876 3300025263 Ga0209565_1003093 Ga0209565_10030932 551
877 3300025273 Ga0209673_1001483 Ga0209673_100148316 551
878 3300025284 Ga0209130_1004840 Ga0209130_10048403 551
879 3300025291 Ga0209675_1005987 Ga0209675_10059872 551
880 3300025292 Ga0209676_1000209 Ga0209676_100020938 551
881 3300025295 Ga0209564_1004997 Ga0209564_10049974 551
882 3300025299 Ga0209256_1000304 Ga0209256_100030420 551
883 3300025302 Ga0207426_1000130 Ga0207426_1000130192 551
884 3300025303 Ga0209051_1000156 Ga0209051_100015675 551
885 3300025321 Ga0207656_10026211 Ga0207656_100262112 551
886 3300025900 Ga0207710_10000017 Ga0207710_10000017221 551
887 3300025900 Ga0207710_10000062 Ga0207710_1000006228 551
888 3300025941 Ga0207711_10001430 Ga0207711_100014303 551
889 3300030521 Ga0307511_10008735 Ga0307511_1000873512 551
890 3300031507 Ga0307509_10188955 Ga0307509_101889551 551
891 3300031730 Ga0307516_10093837 Ga0307516_100938371 551
892 3300037418 Ga0395900_0060860 Ga0395900_0060860_2024_3808 551
893 3300037466 Ga0395898_0108430 Ga0395898_0108430_838_2622 551
894 3300038735 Ga0400485_06792 Ga0400485_06792_8606_10405 551
895 3300038742 Ga0400486_28029 Ga0400486_28029_18257_20056 551
896 3300039437 Ga0436365_0033839 Ga0436365_0033839_4036_5796 551
897 3300044901 Ga0466960_0010726 Ga0466960_0010726_1428_3158 551
898 3300045976 Ga0466967_0133703 Ga0466967_0133703_354_2186 551
899 3300046455 Ga0495603_0004938 Ga0495603_0004938_5316_7088 551
900 3300047315 Ga0495581_0085038 Ga0495581_0085038_28_1800 551
901 3300047443 Ga0495687_023466 Ga0495687_023466_1133_2905 551
902 3300048922 Ga0496119_0003294 Ga0496119_0003294_592_2376 551
903 3300048923 Ga0496120_0000050 Ga0496120_0000050_139329_141113 551
904 3300049568 Ga0501031_0014136 Ga0501031_0014136_86_1876 551
905 3300049572 Ga0501036_0025584 Ga0501036_0025584_290_2080 551
906 3300049573 Ga0501037_0029094 Ga0501037_0029094_121_1911 551
907 3300049574 Ga0501038_0073731 Ga0501038_0073731_810_2546 551
908 3300049574 Ga0501038_0128080 Ga0501038_0128080_235_2025 551
909 3300049575 Ga0501039_0096230 Ga0501039_0096230_241_2031 551
910 3300049577 Ga0501041_0029039 Ga0501041_0029039_564_2354 551
911 3300049579 Ga0501043_0010923 Ga0501043_0010923_4865_6601 551
912 3300049583 Ga0501067_0004752 Ga0501067_0004752_3230_5008 551
913 3300049587 Ga0501071_0002715 Ga0501071_0002715_2509_4299 551
914 3300049589 Ga0501073_0118326 Ga0501073_0118326_68_1804 551
915 3300049590 Ga0501074_0050534 Ga0501074_0050534_1077_2867 551
916 3300049741 Ga0501079_0037016 Ga0501079_0037016_1279_3057 551
917 3300049741 Ga0501079_0100595 Ga0501079_0100595_317_2107 551
918 3300049742 Ga0501080_0002592 Ga0501080_0002592_2079_3857 551
919 3300049742 Ga0501080_0133129 Ga0501080_0133129_197_1987 551
920 3300049822 Ga0501035_0033775 Ga0501035_0033775_2793_4583 551
921 3300049823 Ga0501044_0108832 Ga0501044_0108832_316_2052 551
922 3300050492 nmdc:mga0yw44_29266_c1 nmdc:mga0yw44_29266_c1_822_2618 551
923 3300050492 nmdc:mga0yw44_9237_c1 nmdc:mga0yw44_9237_c1_2043_3809 551
924 3300053087 Ga0500643_000575 Ga0500643_000575_1342_3093 551
925 3300060353 Ga0501082_0016270 Ga0501082_0016270_2551_4329 551
926 3300060353 Ga0501082_0033651 Ga0501082_0033651_2554_4344 551
927 3300061734 Ga0530510_0096693 Ga0530510_0096693_178_1968 551
928 iso_pu_bacteria 2891395885 2891401705 551
929 3300003781 Ga0055536_1002089 Ga0055536_10020893 552
930 3300003791 Ga0055530_10000773 Ga0055530_100007737 552
931 3300003794 Ga0055531_10016147 Ga0055531_100161472 552
932 3300005327 Ga0070658_10001484 Ga0070658_1000148418 552
933 3300005841 Ga0068863_100000604 Ga0068863_1000006043 552
934 3300005842 Ga0068858_100013685 Ga0068858_1000136855 552
935 3300013104 Ga0157370_10027475 Ga0157370_100274754 552
936 3300013308 Ga0157375_10113808 Ga0157375_101138082 552
937 3300020069 Ga0197907_10217434 Ga0197907_102174342 552
938 3300020080 Ga0206350_10893355 Ga0206350_108933552 552
939 3300025245 Ga0207425_1011324 Ga0207425_10113242 552
940 3300025263 Ga0209565_1002407 Ga0209565_10024076 552
941 3300025292 Ga0209676_1000074 Ga0209676_1000074269 552
942 3300025298 Ga0209050_1000015 Ga0209050_1000015201 552
943 3300025303 Ga0209051_1000010 Ga0209051_1000010201 552
944 3300025304 Ga0209257_1000026 Ga0209257_1000026476 552
945 3300025909 Ga0207705_10070691 Ga0207705_100706912 552
946 3300026041 Ga0207639_10096701 Ga0207639_100967012 552
947 3300026088 Ga0207641_10000357 Ga0207641_1000035733 552
948 3300028556 Ga0265337_1000031 Ga0265337_100003114 552
949 3300031238 Ga0265332_10000006 Ga0265332_10000006264 552
950 3300031239 Ga0265328_10013552 Ga0265328_100135522 552
951 3300031903 Ga0307407_10010042 Ga0307407_100100423 552
952 3300044765 Ga0466970_0021539 Ga0466970_0021539_1048_2853 552
953 3300045976 Ga0466967_0172165 Ga0466967_0172165_14_1810 552
954 3300046457 Ga0495590_0000227 Ga0495590_0000227_20073_21848 552
955 3300046459 Ga0495629_0042180 Ga0495629_0042180_1095_2870 552
956 3300047317 Ga0495604_0055044 Ga0495604_0055044_210_1973 552
957 3300048908 Ga0496105_0062127 Ga0496105_0062127_467_2326 552
958 3300048919 Ga0496116_0000192 Ga0496116_0000192_68735_70504 552
959 3300048920 Ga0496117_0005959 Ga0496117_0005959_9899_11668 552
960 3300048920 Ga0496117_0010513 Ga0496117_0010513_6632_8362 552
961 3300048921 Ga0496118_0000593 Ga0496118_0000593_31079_32848 552
962 3300048922 Ga0496119_0058054 Ga0496119_0058054_216_1985 552
963 3300048924 Ga0496121_0008771 Ga0496121_0008771_3077_4816 552
964 3300048925 Ga0496122_0000115 Ga0496122_0000115_48049_49788 552
965 3300048925 Ga0496122_0049741 Ga0496122_0049741_49_1827 552
966 3300048926 Ga0496123_0000129 Ga0496123_0000129_11802_13541 552
967 3300048928 Ga0496125_0025264 Ga0496125_0025264_2520_4259 552
968 3300049568 Ga0501031_0015152 Ga0501031_0015152_2686_4446 552
969 3300049569 Ga0501032_0008948 Ga0501032_0008948_2267_4027 552
970 3300049569 Ga0501032_0047639 Ga0501032_0047639_479_2236 552
971 3300049574 Ga0501038_0001784 Ga0501038_0001784_4513_6273 552
972 3300049575 Ga0501039_0026880 Ga0501039_0026880_1730_3490 552
973 3300049581 Ga0501047_0007990 Ga0501047_0007990_4721_6481 552
974 3300049582 Ga0501048_0000423 Ga0501048_0000423_13683_15443 552
975 3300049586 Ga0501070_0014476 Ga0501070_0014476_3406_5166 552
976 3300049822 Ga0501035_0008273 Ga0501035_0008273_5744_7504 552
977 3300049823 Ga0501044_0056557 Ga0501044_0056557_795_2555 552
978 3300053080 Ga0500635_0000004 Ga0500635_0000004_82378_84141 552
979 3300053104 Ga0500556_0000560 Ga0500556_0000560_2600_4384 552
980 iso_pu_bacteria 2873314349 2873321972 552
981 iso_pu_bacteria 2895427314 2895428900 552
982 iso_pu_bacteria 2984568884 2984570295 552
983 3300005437 Ga0070710_10047928 Ga0070710_100479282 553
984 3300005439 Ga0070711_100073680 Ga0070711_1000736802 553
985 3300005937 Ga0081455_10015373 Ga0081455_100153732 553
986 3300009177 Ga0105248_10014121 Ga0105248_100141212 553
987 3300025898 Ga0207692_10024588 Ga0207692_100245882 553
988 3300025916 Ga0207663_10063777 Ga0207663_100637772 553
989 3300025939 Ga0207665_10003060 Ga0207665_100030603 553
990 3300025941 Ga0207711_10018109 Ga0207711_100181092 553
991 3300030733 Ga0314311_1181306 Ga0314311_11813061 553
992 3300031616 Ga0307508_10005673 Ga0307508_1000567310 553
993 3300037466 Ga0395898_0099706 Ga0395898_0099706_670_2445 553
994 3300038443 Ga0395901_0004916 Ga0395901_0004916_8930_10705 553
995 3300044658 Ga0466972_0002348 Ga0466972_0002348_4267_6033 553
996 3300044842 Ga0466957_0003511 Ga0466957_0003511_4285_6051 553
997 3300044842 Ga0466957_0051141 Ga0466957_0051141_222_2024 553
998 3300045049 Ga0466959_0003447 Ga0466959_0003447_2698_4464 553
999 3300045976 Ga0466967_0010619 Ga0466967_0010619_3433_5247 553
1000 3300046683 Ga0495658_0072858 Ga0495658_0072858_185_1945 553
1001 3300048914 Ga0496111_0023458 Ga0496111_0023458_1289_3043 553
1002 3300048915 Ga0496112_0084481 Ga0496112_0084481_1192_2946 553
1003 3300048920 Ga0496117_0003700 Ga0496117_0003700_5585_7363 553
1004 3300048921 Ga0496118_0000240 Ga0496118_0000240_51255_53033 553
1005 3300048927 Ga0496124_0000070 Ga0496124_0000070_97952_99730 553
1006 3300049744 Ga0501083_0026752 Ga0501083_0026752_125_1903 553
1007 iso_pu_bacteria 2862382967 2862388201 553
1008 3300001989 JGI24739J22299_10023236 JGI24739J22299_100232362 554
1009 3300001990 JGI24737J22298_10002216 JGI24737J22298_100022168 554
1010 3300002773 JGI25152J39213_1003304 JGI25152J39213_10033043 554
1011 3300002987 JGI25159J45721_1007018 JGI25159J45721_10070182 554
1012 3300003187 JGI25151J46595_10007031 JGI25151J46595_100070313 554
1013 3300003215 JGI25153J46596_10007089 JGI25153J46596_100070893 554
1014 3300003354 JGI25160J50197_1010761 JGI25160J50197_10107612 554
1015 3300003374 JGI25161J50226_1002092 JGI25161J50226_10020924 554
1016 3300003771 Ga0055526_1014242 Ga0055526_10142422 554
1017 3300003773 Ga0055537_1006217 Ga0055537_10062172 554
1018 3300003775 Ga0055524_1013538 Ga0055524_10135382 554
1019 3300003784 Ga0055534_1007404 Ga0055534_10074041 554
1020 3300003794 Ga0055531_10017628 Ga0055531_100176282 554
1021 3300004625 Ga0055543_1001840 Ga0055543_10018403 554
1022 3300005262 Ga0065165_1007043 Ga0065165_10070433 554
1023 3300005548 Ga0070665_100016627 Ga0070665_1000166275 554
1024 3300006847 Ga0075431_100004927 Ga0075431_1000049272 554
1025 3300011119 Ga0105246_10011718 Ga0105246_100117183 554
1026 3300025245 Ga0207425_1000229 Ga0207425_100022919 554
1027 3300025258 Ga0209129_1000049 Ga0209129_1000049204 554
1028 3300025263 Ga0209565_1001437 Ga0209565_10014373 554
1029 3300025272 Ga0209455_1002176 Ga0209455_10021764 554
1030 3300025273 Ga0209673_1005158 Ga0209673_10051583 554
1031 3300025284 Ga0209130_1000974 Ga0209130_100097420 554
1032 3300025291 Ga0209675_1002160 Ga0209675_10021603 554
1033 3300025294 Ga0209025_1001092 Ga0209025_10010923 554
1034 3300025295 Ga0209564_1005012 Ga0209564_10050123 554
1035 3300025297 Ga0209758_1000496 Ga0209758_100049646 554
1036 3300025299 Ga0209256_1000264 Ga0209256_100026420 554
1037 3300025302 Ga0207426_1000108 Ga0207426_1000108210 554
1038 3300025304 Ga0209257_1003207 Ga0209257_10032072 554
1039 3300037853 Ga0436364_0220436 Ga0436364_0220436_162_1949 554
1040 3300044658 Ga0466972_0016390 Ga0466972_0016390_1184_2947 554
1041 3300045976 Ga0466967_0015286 Ga0466967_0015286_1052_2839 554
1042 3300049569 Ga0501032_0014495 Ga0501032_0014495_2502_4472 554
1043 3300049570 Ga0501033_0080555 Ga0501033_0080555_272_2227 554
1044 3300049573 Ga0501037_0043544 Ga0501037_0043544_145_2100 554
1045 3300049574 Ga0501038_0007061 Ga0501038_0007061_228_2183 554
1046 3300049575 Ga0501039_0010500 Ga0501039_0010500_1411_3381 554
1047 3300049576 Ga0501040_0047020 Ga0501040_0047020_279_2048 554
1048 3300049579 Ga0501043_0020300 Ga0501043_0020300_2663_4633 554
1049 3300049580 Ga0501046_0000280 Ga0501046_0000280_49270_51240 554
1050 3300049586 Ga0501070_0024551 Ga0501070_0024551_1765_3735 554
1051 3300049587 Ga0501071_0060812 Ga0501071_0060812_548_2317 554
1052 3300049742 Ga0501080_0046767 Ga0501080_0046767_164_2134 554
1053 3300050510 nmdc:mga06r32_11849_c1 nmdc:mga06r32_11849_c1_4982_6754 554
1054 3300053110 Ga0500571_000456 Ga0500571_000456_3440_5170 554
1055 iso_pu_bacteria 2643221587 2643941768 554
1056 iso_pu_bacteria 2643221670 2644385806 554
1057 iso_pu_bacteria 2643221677 2644428851 554
1058 iso_pu_bacteria 2856741275 2856745239 554
1059 iso_pu_bacteria 2884693830 2884695077 554
1060 iso_pu_bacteria 2891562705 2891567149 554
1061 iso_pu_bacteria 2895442618 2895446239 554
1062 iso_pu_bacteria 2918501144 2918506048 554
1063 iso_pu_bacteria 8048356638 8048360616 554
1064 iso_pu_bacteria 8048369669 8048375241 554
1065 iso_pu_bacteria 8048379754 8048382964 554
1066 3300005366 Ga0070659_100000513 Ga0070659_10000051329 555
1067 3300005937 Ga0081455_10033912 Ga0081455_100339123 555
1068 3300013105 Ga0157369_10179529 Ga0157369_101795292 555
1069 3300025922 Ga0207646_10045671 Ga0207646_100456714 555
1070 3300025932 Ga0207690_10000189 Ga0207690_100001894 555
1071 3300028379 Ga0268266_10005786 Ga0268266_100057867 555
1072 3300044656 Ga0466969_0003237 Ga0466969_0003237_1135_2907 555
1073 3300044658 Ga0466972_0008717 Ga0466972_0008717_3144_4916 555
1074 3300044693 Ga0466961_0011269 Ga0466961_0011269_2323_4095 555
1075 3300044719 Ga0466971_0019127 Ga0466971_0019127_1196_2968 555
1076 3300044735 Ga0466968_0020101 Ga0466968_0020101_423_2195 555
1077 3300045049 Ga0466959_0046007 Ga0466959_0046007_1214_2986 555
1078 3300045976 Ga0466967_0117740 Ga0466967_0117740_78_1880 555
1079 3300045976 Ga0466967_0144086 Ga0466967_0144086_11_1816 555
1080 3300048905 Ga0496102_0116897 Ga0496102_0116897_675_2465 555
1081 3300048919 Ga0496116_0001646 Ga0496116_0001646_19167_20906 555
1082 3300048928 Ga0496125_0008173 Ga0496125_0008173_968_2692 555
1083 3300049570 Ga0501033_0006828 Ga0501033_0006828_2928_4709 555
1084 3300053133 Ga0500655_000269 Ga0500655_000269_1822_3552 555
1085 3300061719 Ga0466962_0028361 Ga0466962_0028361_220_1992 555
1086 iso_pu_bacteria 2582581312 2585296142 555
1087 iso_pu_bacteria 2616644941 2616903016 555
1088 iso_pu_bacteria 2643221578 2643903166 555
1089 iso_pu_bacteria 2643221673 2644404323 555
1090 iso_pu_bacteria 2643221682 2644461953 555
1091 iso_pu_bacteria 2808606982 2811844863 555
1092 iso_pu_bacteria 2818991463 2819695030 555
1093 iso_pu_bacteria 2862178590 2862185099 555
1094 iso_pu_bacteria 2862574272 2862577937 555
1095 iso_pu_bacteria 2867369537 2867373416 555
1096 iso_pu_bacteria 2891554331 2891554782 555
1097 iso_pu_bacteria 2946045630 2946048353 555
1098 iso_pu_bacteria 2966598605 2966601257 555
1099 iso_pu_bacteria 8025530807 8025532407 555
1100 iso_pu_bacteria 8056060235 8056065213 555
1101 iso_pu_bacteria 8056667051 8056670735 555
1102 3300005327 Ga0070658_10016932 Ga0070658_100169324 556
1103 3300005435 Ga0070714_100008719 Ga0070714_1000087192 556
1104 3300005436 Ga0070713_100010863 Ga0070713_1000108632 556
1105 3300005445 Ga0070708_100051587 Ga0070708_1000515873 556
1106 3300005577 Ga0068857_100040492 Ga0068857_1000404922 556
1107 3300005616 Ga0068852_100002359 Ga0068852_10000235911 556
1108 3300005834 Ga0068851_10000001 Ga0068851_10000001218 556
1109 3300006058 Ga0075432_10000101 Ga0075432_1000010110 556
1110 3300006852 Ga0075433_10000832 Ga0075433_100008328 556
1111 3300006871 Ga0075434_100000238 Ga0075434_10000023826 556
1112 3300006914 Ga0075436_100002267 Ga0075436_1000022677 556
1113 3300007076 Ga0075435_100003528 Ga0075435_1000035286 556
1114 3300009093 Ga0105240_10000538 Ga0105240_1000053814 556
1115 3300009094 Ga0111539_10000095 Ga0111539_100000957 556
1116 3300009174 Ga0105241_10000768 Ga0105241_100007686 556
1117 3300009545 Ga0105237_10001702 Ga0105237_100017027 556
1118 3300025254 Ga0209148_1003774 Ga0209148_10037743 556
1119 3300025321 Ga0207656_10000002 Ga0207656_10000002709 556
1120 3300025911 Ga0207654_10000001 Ga0207654_100000011171 556
1121 3300025913 Ga0207695_10012810 Ga0207695_100128107 556
1122 3300025914 Ga0207671_10000002 Ga0207671_100000021003 556
1123 3300025924 Ga0207694_10000022 Ga0207694_10000022171 556
1124 3300026116 Ga0207674_10002541 Ga0207674_100025412 556
1125 3300026142 Ga0207698_10000881 Ga0207698_1000088110 556
1126 3300027907 Ga0207428_10000102 Ga0207428_100001029 556
1127 3300037466 Ga0395898_0000098 Ga0395898_0000098_38731_40494 556
1128 3300045976 Ga0466967_0067148 Ga0466967_0067148_124_1890 556
1129 3300046542 Ga0495597_0001209 Ga0495597_0001209_801_2540 556
1130 3300048915 Ga0496112_0184865 Ga0496112_0184865_182_1948 556
1131 3300048920 Ga0496117_0053468 Ga0496117_0053468_444_2219 556
1132 3300048922 Ga0496119_0003128 Ga0496119_0003128_11373_13148 556
1133 3300048923 Ga0496120_0000586 Ga0496120_0000586_1760_3535 556
1134 3300050511 nmdc:mga08y16_2042_c1 nmdc:mga08y16_2042_c1_5965_7728 556
1135 3300050512 nmdc:mga0n895_3611_c1 nmdc:mga0n895_3611_c1_5556_7319 556
1136 3300050513 nmdc:mga0rr50_2329_c1 nmdc:mga0rr50_2329_c1_5007_6770 556
1137 3300050514 nmdc:mga08x19_600_c1 nmdc:mga08x19_600_c1_16356_18119 556
1138 3300050515 nmdc:mga0a205_228_c1 nmdc:mga0a205_228_c1_29817_31580 556
1139 3300053140 Ga0500573_0000001 Ga0500573_0000001_44868_46601 556
1140 3300053155 Ga0500620_000151 Ga0500620_000151_9266_11041 556
1141 iso_pu_bacteria 2515154155 2515856666 556
1142 iso_pu_bacteria 2758568522 2760304081 556
1143 iso_pu_bacteria 2791355406 2793981519 556
1144 iso_pu_bacteria 2862574272 2862581524 556
1145 iso_pu_bacteria 2990088156 2990088500 556
1146 iso_pu_bacteria 2995726249 2995726635 556
1147 iso_pu_bacteria 8002811521 8002813514 556
1148 iso_pu_bacteria 8047893842 8047903365 556
1149 iso_pu_bacteria 8048356638 8048360295 556
1150 iso_pu_bacteria 8048356638 8048365956 556
1151 iso_pu_bacteria 8048369669 8048375586 556
1152 iso_pu_bacteria 8048369669 8048379195 556
1153 iso_pu_bacteria 8048379754 8048382619 556
1154 iso_pu_bacteria 8048379754 8048388301 556
1155 iso_pu_bacteria 8053945823 8053952477 556
1156 iso_pu_bacteria 8055034563 8055037231 556
1157 iso_pu_bacteria 8055037949 8055039442 556
1158 3300005366 Ga0070659_100004357 Ga0070659_1000043573 557
1159 3300005466 Ga0070685_10001210 Ga0070685_1000121010 557
1160 3300005563 Ga0068855_100002245 Ga0068855_1000022454 557
1161 3300005563 Ga0068855_100020286 Ga0068855_1000202868 557
1162 3300005842 Ga0068858_100000048 Ga0068858_100000048112 557
1163 3300006048 Ga0075363_100007222 Ga0075363_1000072222 557
1164 3300013105 Ga0157369_10073150 Ga0157369_100731502 557
1165 3300025913 Ga0207695_10000983 Ga0207695_1000098339 557
1166 3300025949 Ga0207667_10014198 Ga0207667_100141982 557
1167 3300026035 Ga0207703_10000064 Ga0207703_10000064111 557
1168 3300026078 Ga0207702_10038950 Ga0207702_100389504 557
1169 3300033180 Ga0307510_10027928 Ga0307510_100279281 557
1170 3300037068 Ga0373925_0000008 Ga0373925_0000008_101578_103344 557
1171 3300038741 Ga0400488_30705 Ga0400488_30705_9471_11270 557
1172 3300044693 Ga0466961_0029108 Ga0466961_0029108_1390_3204 557
1173 3300044694 Ga0466963_0000859 Ga0466963_0000859_11907_13646 557
1174 3300044719 Ga0466971_0000394 Ga0466971_0000394_46_1785 557
1175 3300044719 Ga0466971_0025072 Ga0466971_0025072_348_2162 557
1176 3300044842 Ga0466957_0008538 Ga0466957_0008538_4016_5755 557
1177 3300045836 Ga0466958_0009851 Ga0466958_0009851_90_1829 557
1178 3300046463 Ga0495653_0016023 Ga0495653_0016023_4250_6037 557
1179 3300048917 Ga0496114_0002027 Ga0496114_0002027_11095_12882 557
1180 3300048918 Ga0496115_0017134 Ga0496115_0017134_3563_5350 557
1181 3300049568 Ga0501031_0040295 Ga0501031_0040295_1111_2892 557
1182 3300050490 nmdc:mga03n38_14040_c1 nmdc:mga03n38_14040_c1_530_2305 557
1183 3300061719 Ga0466962_0003062 Ga0466962_0003062_2899_4713 557
1184 iso_pu_bacteria 2554235005 2554256574 557
1185 iso_pu_bacteria 2643221681 2644456122 557
1186 iso_pu_bacteria 2767802112 2768643757 557
1187 iso_pu_bacteria 2773857762 2774391850 557
1188 iso_pu_bacteria 2862705112 2862710424 557
1189 iso_pu_bacteria 2867475112 2867475507 557
1190 iso_pu_bacteria 2935390628 2935391758 557
1191 iso_pu_bacteria 2990044586 2990044998 557
1192 iso_pu_bacteria 2990059506 2990059839 557
1193 iso_pu_bacteria 2997451912 2997458054 557
1194 iso_pu_bacteria 3001889506 3001892069 557
1195 iso_pu_bacteria 3006425503 3006429678 557
1196 iso_pu_bacteria 3006486233 3006492054 557
1197 iso_pu_bacteria 8008485437 8008491402 557
1198 iso_pu_bacteria 8008558824 8008567137 557
1199 iso_pu_bacteria 8025524527 8025530732 557
1200 iso_pu_bacteria 8033684223 8033688137 557
1201 iso_pu_bacteria 8053945823 8053948892 557
1202 iso_pu_bacteria 8054160619 8054166858 557
1203 iso_pu_bacteria 8056447290 8056450305 557
1204 3300026116 Ga0207674_10027562 Ga0207674_100275623 558
1205 3300028786 Ga0307517_10014055 Ga0307517_100140554 558
1206 3300028794 Ga0307515_10011010 Ga0307515_1001101015 558
1207 3300028800 Ga0265338_10008722 Ga0265338_100087227 558
1208 3300031241 Ga0265325_10008286 Ga0265325_100082862 558
1209 3300031241 Ga0265325_10041176 Ga0265325_100411762 558
1210 3300031247 Ga0265340_10028204 Ga0265340_100282042 558
1211 3300031711 Ga0265314_10026176 Ga0265314_100261763 558
1212 3300031712 Ga0265342_10007083 Ga0265342_100070837 558
1213 3300044656 Ga0466969_0013550 Ga0466969_0013550_774_2555 558
1214 3300044684 Ga0466966_0084442 Ga0466966_0084442_161_1909 558
1215 3300044765 Ga0466970_0000683 Ga0466970_0000683_14703_16472 558
1216 3300045976 Ga0466967_0071568 Ga0466967_0071568_247_1995 558
1217 3300046459 Ga0495629_0022598 Ga0495629_0022598_739_2511 558
1218 3300046462 Ga0495651_0017144 Ga0495651_0017144_1057_2829 558
1219 3300046642 Ga0495634_0001770 Ga0495634_0001770_9769_11541 558
1220 3300046660 Ga0495625_0027105 Ga0495625_0027105_464_2236 558
1221 3300046674 Ga0495588_0027976 Ga0495588_0027976_197_1969 558
1222 3300046675 Ga0495657_0001890 Ga0495657_0001890_15979_17751 558
1223 3300046680 Ga0495646_0000278 Ga0495646_0000278_59_1831 558
1224 3300046683 Ga0495658_0048348 Ga0495658_0048348_564_2336 558
1225 3300046689 Ga0495613_0006602 Ga0495613_0006602_6867_8639 558
1226 3300046692 Ga0495671_0008689 Ga0495671_0008689_41_1813 558
1227 3300046809 Ga0495600_0029739 Ga0495600_0029739_698_2470 558
1228 3300047319 Ga0495674_0044498 Ga0495674_0044498_30_1802 558
1229 3300047447 Ga0495685_009033 Ga0495685_009033_1311_3062 558
1230 3300047470 Ga0495681_0007141 Ga0495681_0007141_5358_7130 558
1231 3300048088 Ga0495602_0017318 Ga0495602_0017318_40_1812 558
1232 3300048906 Ga0496103_0024195 Ga0496103_0024195_727_2460 558
1233 3300048911 Ga0496108_0043405 Ga0496108_0043405_960_2750 558
1234 3300049569 Ga0501032_0013720 Ga0501032_0013720_2255_4012 558
1235 3300049579 Ga0501043_0006914 Ga0501043_0006914_38_1795 558
1236 3300049581 Ga0501047_0027903 Ga0501047_0027903_2610_4367 558
1237 3300049585 Ga0501069_0024738 Ga0501069_0024738_197_1969 558
1238 3300049586 Ga0501070_0000050 Ga0501070_0000050_39146_40909 558
1239 3300053085 Ga0495619_0055024 Ga0495619_0055024_41_1813 558
1240 3300053107 Ga0500560_006351 Ga0500560_006351_884_2656 558
1241 iso_pu_bacteria 2527291627 2528202551 558
1242 iso_pu_bacteria 2527291629 2528212492 558
1243 iso_pu_bacteria 2546825537 2546947130 558
1244 iso_pu_bacteria 2547132111 2547410804 558
1245 iso_pu_bacteria 2554235227 2555229562 558
1246 iso_pu_bacteria 2576861822 2579747368 558
1247 iso_pu_bacteria 2582581313 2585306101 558
1248 iso_pu_bacteria 2582581314 2585316125 558
1249 iso_pu_bacteria 2622736605 2623502089 558
1250 iso_pu_bacteria 2643221647 2644261317 558
1251 iso_pu_bacteria 2643221678 2644439583 558
1252 iso_pu_bacteria 2643221714 2644633069 558
1253 iso_pu_bacteria 2643221961 2645720608 558
1254 iso_pu_bacteria 2643221962 2645723627 558
1255 iso_pu_bacteria 2654587600 2655031583 558
1256 iso_pu_bacteria 2675903058 2676473536 558
1257 iso_pu_bacteria 2684623036 2686541371 558
1258 iso_pu_bacteria 2710264753 2710602197 558
1259 iso_pu_bacteria 2773857762 2774394418 558
1260 iso_pu_bacteria 2773857924 2774868238 558
1261 iso_pu_bacteria 2784132148 2784589963 558
1262 iso_pu_bacteria 2784746768 2785371048 558
1263 iso_pu_bacteria 2786546132 2786672245 558
1264 iso_pu_bacteria 2808606357 2808829886 558
1265 iso_pu_bacteria 2808606359 2808843593 558
1266 iso_pu_bacteria 2808606375 2808913154 558
1267 iso_pu_bacteria 2808606448 2809233644 558
1268 iso_pu_bacteria 2808606448 2809234489 558
1269 iso_pu_bacteria 2811994879 2812356453 558
1270 iso_pu_bacteria 2811994917 2812479196 558
1271 iso_pu_bacteria 2827628540 2827632049 558
1272 iso_pu_bacteria 2852635781 2852640226 558
1273 iso_pu_bacteria 2862281513 2862287261 558
1274 iso_pu_bacteria 2863404153 2863411314 558
1275 iso_pu_bacteria 2867428634 2867433936 558
1276 iso_pu_bacteria 2870622029 2870624649 558
1277 iso_pu_bacteria 2873151551 2873154489 558
1278 iso_pu_bacteria 2877676314 2877679532 558
1279 iso_pu_bacteria 2891968417 2891972818 558
1280 iso_pu_bacteria 2904535858 2904538643 558
1281 iso_pu_bacteria 2912715099 2912718164 558
1282 iso_pu_bacteria 2912723979 2912730566 558
1283 iso_pu_bacteria 2919468124 2919470463 558
1284 iso_pu_bacteria 2939657138 2939660218 558
1285 iso_pu_bacteria 2946064051 2946069408 558
1286 iso_pu_bacteria 2946072368 2946077325 558
1287 iso_pu_bacteria 2947224130 2947227507 558
1288 iso_pu_bacteria 2954002825 2954005000 558
1289 iso_pu_bacteria 2954380949 2954384432 558
1290 iso_pu_bacteria 2954673503 2954678521 558
1291 iso_pu_bacteria 2954682443 2954685634 558
1292 iso_pu_bacteria 2954691527 2954695293 558
1293 iso_pu_bacteria 2954691527 2954696920 558
1294 iso_pu_bacteria 2954701450 2954705215 558
1295 iso_pu_bacteria 2954701450 2954710484 558
1296 iso_pu_bacteria 2954711539 2954714731 558
1297 iso_pu_bacteria 2954721474 2954724677 558
1298 iso_pu_bacteria 2954731030 2954737143 558
1299 iso_pu_bacteria 2954740390 2954743600 558
1300 iso_pu_bacteria 2954749733 2954755994 558
1301 iso_pu_bacteria 2954759201 2954762552 558
1302 iso_pu_bacteria 3002998708 3003001456 558
1303 iso_pu_bacteria 3006393351 3006397248 558
1304 iso_pu_bacteria 3006493962 3006496832 558
1305 iso_pu_bacteria 3006493962 3006496868 558
1306 iso_pu_bacteria 637000116 637878031 558
1307 iso_pu_bacteria 8008574985 8008577570 558
1308 iso_pu_bacteria 8023623736 8023625803 558
1309 iso_pu_bacteria 8025413630 8025415451 558
1310 iso_pu_bacteria 8048406513 8048406896 558
1311 iso_pu_bacteria 8054609563 8054610631 558
1312 iso_pu_bacteria 8056829672 8056837384 558
1313 3300005937 Ga0081455_10000683 Ga0081455_100006834 559
1314 3300032002 Ga0307416_100120896 Ga0307416_1001208961 559
1315 3300037312 Ga0395899_0001686 Ga0395899_0001686_11075_12814 559
1316 3300042993 Ga0439440_0003562 Ga0439440_0003562_411_2159 559
1317 3300044735 Ga0466968_0002141 Ga0466968_0002141_679_2415 559
1318 3300046455 Ga0495603_0001010 Ga0495603_0001010_2040_3794 559
1319 3300046455 Ga0495603_0006758 Ga0495603_0006758_1693_3447 559
1320 3300046459 Ga0495629_0004235 Ga0495629_0004235_72_1826 559
1321 3300046492 Ga0495585_0025941 Ga0495585_0025941_1201_2955 559
1322 3300046499 Ga0495594_0004245 Ga0495594_0004245_717_2471 559
1323 3300046538 Ga0495609_0049091 Ga0495609_0049091_75_1829 559
1324 3300046557 Ga0495622_0003240 Ga0495622_0003240_4886_6640 559
1325 3300046689 Ga0495613_0034771 Ga0495613_0034771_1935_3689 559
1326 3300047318 Ga0495636_0016968 Ga0495636_0016968_952_2706 559
1327 3300047321 Ga0495676_0050630 Ga0495676_0050630_812_2566 559
1328 3300047323 Ga0495683_0028087 Ga0495683_0028087_21_1775 559
1329 3300047447 Ga0495685_004937 Ga0495685_004937_1553_3307 559
1330 3300048089 Ga0495614_0012492 Ga0495614_0012492_1925_3679 559
1331 3300049568 Ga0501031_0006974 Ga0501031_0006974_4927_6699 559
1332 3300049570 Ga0501033_0030583 Ga0501033_0030583_1782_3554 559
1333 3300049571 Ga0501034_0000070 Ga0501034_0000070_109352_111097 559
1334 3300049573 Ga0501037_0022974 Ga0501037_0022974_515_2287 559
1335 3300049574 Ga0501038_0022377 Ga0501038_0022377_3402_5174 559
1336 3300049575 Ga0501039_0054778 Ga0501039_0054778_492_2264 559
1337 3300049577 Ga0501041_0003618 Ga0501041_0003618_2255_4027 559
1338 3300049578 Ga0501042_0063273 Ga0501042_0063273_701_2461 559
1339 3300049579 Ga0501043_0008585 Ga0501043_0008585_4520_6292 559
1340 3300049580 Ga0501046_0000883 Ga0501046_0000883_10380_12320 559
1341 3300049580 Ga0501046_0008738 Ga0501046_0008738_4781_6553 559
1342 3300049581 Ga0501047_0000005 Ga0501047_0000005_212477_214237 559
1343 3300049581 Ga0501047_0016530 Ga0501047_0016530_752_2524 559
1344 3300049582 Ga0501048_0008037 Ga0501048_0008037_4585_6357 559
1345 3300049583 Ga0501067_0006662 Ga0501067_0006662_53_1825 559
1346 3300049584 Ga0501068_0001758 Ga0501068_0001758_4871_6643 559
1347 3300049587 Ga0501071_0002468 Ga0501071_0002468_4669_6441 559
1348 3300049588 Ga0501072_0011940 Ga0501072_0011940_4805_6577 559
1349 3300049592 Ga0501076_0011709 Ga0501076_0011709_4303_6075 559
1350 3300049741 Ga0501079_0020468 Ga0501079_0020468_563_2335 559
1351 3300049742 Ga0501080_0014782 Ga0501080_0014782_4520_6292 559
1352 3300049744 Ga0501083_0002947 Ga0501083_0002947_4714_6486 559
1353 3300049822 Ga0501035_0023796 Ga0501035_0023796_2295_4067 559
1354 3300049823 Ga0501044_0008754 Ga0501044_0008754_4781_6553 559
1355 3300049823 Ga0501044_0166508 Ga0501044_0166508_299_2059 559
1356 3300054114 Ga0501084_0028165 Ga0501084_0028165_294_2066 559
1357 3300060353 Ga0501082_0019185 Ga0501082_0019185_3162_4934 559
1358 3300061734 Ga0530510_0017884 Ga0530510_0017884_2454_4226 559
1359 iso_pu_bacteria 2547132424 2548693334 559
1360 iso_pu_bacteria 2579778521 2579853673 559
1361 iso_pu_bacteria 2619618881 2619854241 559
1362 iso_pu_bacteria 2619619003 2620349960 559
1363 iso_pu_bacteria 2626541554 2626636031 559
1364 iso_pu_bacteria 2643221601 2644014298 559
1365 iso_pu_bacteria 2643221617 2644098716 559
1366 iso_pu_bacteria 2643221620 2644116077 559
1367 iso_pu_bacteria 2643221631 2644175735 559
1368 iso_pu_bacteria 2739367898 2740167324 559
1369 iso_pu_bacteria 2786546132 2786674480 559
1370 iso_pu_bacteria 2808606439 2809194726 559
1371 iso_pu_bacteria 2811994874 2812330811 559
1372 iso_pu_bacteria 2811994878 2812352242 559
1373 iso_pu_bacteria 2811994878 2812353038 559
1374 iso_pu_bacteria 2818991472 2819742450 559
1375 iso_pu_bacteria 2831935698 2831940468 559
1376 iso_pu_bacteria 2852643534 2852646323 559
1377 iso_pu_bacteria 2857733635 2857736015 559
1378 iso_pu_bacteria 2912715099 2912720244 559
1379 iso_pu_bacteria 2946024296 2946025056 559
1380 iso_pu_bacteria 2954673503 2954680924 559
1381 iso_pu_bacteria 2954682443 2954683233 559
1382 iso_pu_bacteria 2995463766 2995467719 559
1383 iso_pu_bacteria 3006321560 3006324121 559
1384 iso_pu_bacteria 8048127548 8048128197 559
1385 iso_pu_bacteria 8054609563 8054613990 559
1386 iso_pu_bacteria 8054913762 8054917093 559
1387 iso_pu_bacteria 8054920844 8054922205 559
1388 3300003578 Ga0006562J51391_1094765 Ga0006562J51391_10947654 560
1389 3300005937 Ga0081455_10001546 Ga0081455_1000154620 560
1390 3300025898 Ga0207692_10004777 Ga0207692_100047772 560
1391 3300031548 Ga0307408_100003857 Ga0307408_1000038572 560
1392 3300031911 Ga0307412_10002071 Ga0307412_100020717 560
1393 3300046452 Ga0495617_019271 Ga0495617_019271_226_1983 560
1394 3300046462 Ga0495651_0077856 Ga0495651_0077856_63_1895 560
1395 3300046529 Ga0495652_0023514 Ga0495652_0023514_3584_5416 560
1396 3300046533 Ga0495640_0005210 Ga0495640_0005210_4907_6739 560
1397 3300046642 Ga0495634_0016111 Ga0495634_0016111_1281_3113 560
1398 3300046660 Ga0495625_0082704 Ga0495625_0082704_224_1981 560
1399 3300046675 Ga0495657_0084082 Ga0495657_0084082_45_1877 560
1400 3300046689 Ga0495613_0063948 Ga0495613_0063948_786_2618 560
1401 3300047321 Ga0495676_0104458 Ga0495676_0104458_44_1876 560
1402 3300048903 Ga0496100_0008684 Ga0496100_0008684_1651_3414 560
1403 3300048904 Ga0496101_0036802 Ga0496101_0036802_240_2003 560
1404 3300048905 Ga0496102_0055400 Ga0496102_0055400_1606_3369 560
1405 3300048907 Ga0496104_0072403 Ga0496104_0072403_366_2129 560
1406 3300048908 Ga0496105_0080500 Ga0496105_0080500_41_1804 560
1407 3300048929 Ga0496126_0000335 Ga0496126_0000335_12979_14703 560
1408 3300053098 Ga0500650_0004010 Ga0500650_0004010_932_2680 560
1409 3300053140 Ga0500573_0007564 Ga0500573_0007564_872_2623 560
1410 3300053140 Ga0500573_0008128 Ga0500573_0008128_3288_5039 560
1411 3300053140 Ga0500573_0011354 Ga0500573_0011354_1620_3371 560
1412 3300053140 Ga0500573_0064686 Ga0500573_0064686_83_1831 560
1413 iso_pu_bacteria 2643221641 2644231576 560
1414 iso_pu_bacteria 2643221697 2644538373 560
1415 iso_pu_bacteria 2751185734 2753074263 560
1416 iso_pu_bacteria 2808606439 2809197344 560
1417 iso_pu_bacteria 2811994882 2812375641 560
1418 iso_pu_bacteria 2818991462 2819691967 560
1419 iso_pu_bacteria 2818991469 2819729710 560
1420 iso_pu_bacteria 2867507094 2867509454 560
1421 iso_pu_bacteria 2868088558 2868092775 560
1422 iso_pu_bacteria 2883821847 2883823304 560
1423 iso_pu_bacteria 2919446982 2919447702 560
1424 iso_pu_bacteria 2984592036 2984595644 560
1425 iso_pu_bacteria 8003830390 8003835677 560
1426 iso_pu_bacteria 8055157932 8055160020 560
1427 3300005937 Ga0081455_10000144 Ga0081455_1000014436 561
1428 3300014326 Ga0157380_10123417 Ga0157380_101234172 561
1429 3300025302 Ga0207426_1006087 Ga0207426_10060872 561
1430 3300025302 Ga0207426_1006196 Ga0207426_10061962 561
1431 3300031649 Ga0307514_10001437 Ga0307514_100014374 561
1432 3300031731 Ga0307405_10032042 Ga0307405_100320422 561
1433 3300031852 Ga0307410_10025312 Ga0307410_100253122 561
1434 3300031901 Ga0307406_10033406 Ga0307406_100334063 561
1435 3300031903 Ga0307407_10003910 Ga0307407_100039103 561
1436 3300032002 Ga0307416_100028502 Ga0307416_1000285022 561
1437 3300032126 Ga0307415_100000050 Ga0307415_10000005046 561
1438 3300042876 Ga0451577_0008355 Ga0451577_0008355_2612_4345 561
1439 3300044712 Ga0453684_0028691 Ga0453684_0028691_2054_3787 561
1440 3300046455 Ga0495603_0000669 Ga0495603_0000669_6959_8731 561
1441 3300046648 Ga0495611_0006045 Ga0495611_0006045_42_1817 561
1442 3300047321 Ga0495676_0065324 Ga0495676_0065324_168_1940 561
1443 3300048912 Ga0496109_0027727 Ga0496109_0027727_1472_3262 561
1444 3300048913 Ga0496110_0042296 Ga0496110_0042296_1396_3186 561
1445 3300048920 Ga0496117_0004915 Ga0496117_0004915_9574_11298 561
1446 3300053136 Ga0500559_0000210 Ga0500559_0000210_31190_32944 561
1447 iso_pu_bacteria 2508501039 2508670519 561
1448 iso_pu_bacteria 2517572101 2517762642 561
1449 iso_pu_bacteria 2643221567 2643852826 561
1450 iso_pu_bacteria 2643221624 2644135335 561
1451 iso_pu_bacteria 2643221649 2644277620 561
1452 iso_pu_bacteria 2643221711 2644611244 561
1453 iso_pu_bacteria 2675902999 2676199361 561
1454 iso_pu_bacteria 2687453737 2689962538 561
1455 iso_pu_bacteria 2773857921 2774843939 561
1456 iso_pu_bacteria 2784132109 2784472802 561
1457 iso_pu_bacteria 2808606365 2808875268 561
1458 iso_pu_bacteria 2818991318 2819424508 561
1459 iso_pu_bacteria 2818991458 2819668100 561
1460 iso_pu_bacteria 2857481737 2857485659 561
1461 iso_pu_bacteria 2870721527 2870727316 561
1462 iso_pu_bacteria 2946041624 2946044820 561
1463 iso_pu_bacteria 8002775197 8002779898 561
1464 iso_pu_bacteria 8002784119 8002788642 561
1465 iso_pu_bacteria 8004212874 8004213530 561
1466 3300003578 Ga0006562J51391_1101838 Ga0006562J51391_11018382 562
1467 3300005329 Ga0070683_100020474 Ga0070683_1000204742 562
1468 3300005337 Ga0070682_100007546 Ga0070682_1000075462 562
1469 3300005338 Ga0068868_100121629 Ga0068868_1001216291 562
1470 3300005366 Ga0070659_100047517 Ga0070659_1000475172 562
1471 3300005441 Ga0070700_100061722 Ga0070700_1000617221 562
1472 3300005539 Ga0068853_100052939 Ga0068853_1000529393 562
1473 3300005616 Ga0068852_100093836 Ga0068852_1000938362 562
1474 3300005718 Ga0068866_10016443 Ga0068866_100164432 562
1475 3300005719 Ga0068861_100016118 Ga0068861_1000161184 562
1476 3300005937 Ga0081455_10005669 Ga0081455_100056694 562
1477 3300006881 Ga0068865_100015082 Ga0068865_1000150823 562
1478 3300009098 Ga0105245_10161910 Ga0105245_101619102 562
1479 3300009148 Ga0105243_10011876 Ga0105243_100118762 562
1480 3300009148 Ga0105243_10022266 Ga0105243_100222664 562
1481 3300009551 Ga0105238_10037448 Ga0105238_100374484 562
1482 3300009553 Ga0105249_10022400 Ga0105249_100224004 562
1483 3300010375 Ga0105239_10030862 Ga0105239_100308624 562
1484 3300013306 Ga0163162_10180635 Ga0163162_101806352 562
1485 3300014497 Ga0182008_10000566 Ga0182008_1000056615 562
1486 3300014497 Ga0182008_10001782 Ga0182008_100017827 562
1487 3300014497 Ga0182008_10012848 Ga0182008_100128482 562
1488 3300015262 Ga0182007_10001078 Ga0182007_100010789 562
1489 3300015688 Ga0183367_1002 Ga0183367_1002505 562
1490 3300025297 Ga0209758_1006882 Ga0209758_10068827 562
1491 3300025901 Ga0207688_10048179 Ga0207688_100481792 562
1492 3300025927 Ga0207687_10043672 Ga0207687_100436721 562
1493 3300025935 Ga0207709_10036449 Ga0207709_100364491 562
1494 3300025944 Ga0207661_10029768 Ga0207661_100297682 562
1495 3300025961 Ga0207712_10024793 Ga0207712_100247933 562
1496 3300026041 Ga0207639_10058457 Ga0207639_100584571 562
1497 3300026075 Ga0207708_10019229 Ga0207708_100192294 562
1498 3300026118 Ga0207675_100017737 Ga0207675_1000177375 562
1499 3300026142 Ga0207698_10062208 Ga0207698_100622082 562
1500 3300027866 Ga0209813_10003346 Ga0209813_100033462 562
1501 3300028794 Ga0307515_10068065 Ga0307515_100680652 562
1502 3300028794 Ga0307515_10075891 Ga0307515_100758912 562
1503 3300030522 Ga0307512_10007694 Ga0307512_100076949 562
1504 3300031456 Ga0307513_10014769 Ga0307513_100147693 562
1505 3300031649 Ga0307514_10004905 Ga0307514_100049055 562
1506 3300031649 Ga0307514_10019860 Ga0307514_100198603 562
1507 3300031649 Ga0307514_10026254 Ga0307514_100262542 562
1508 3300032002 Ga0307416_100010993 Ga0307416_1000109934 562
1509 3300033180 Ga0307510_10088495 Ga0307510_100884952 562
1510 3300038443 Ga0395901_0048675 Ga0395901_0048675_1136_2905 562
1511 3300041404 Ga0439436_0001748 Ga0439436_0001748_1689_3461 562
1512 3300041999 Ga0439433_0004729 Ga0439433_0004729_560_2332 562
1513 3300042005 Ga0439448_0004385 Ga0439448_0004385_67_1839 562
1514 3300042014 Ga0439457_000316 Ga0439457_000316_1637_3409 562
1515 3300042131 Ga0450894_000053 Ga0450894_000053_1652_3448 562
1516 3300042135 Ga0450899_001598 Ga0450899_001598_640_2436 562
1517 3300044656 Ga0466969_0027170 Ga0466969_0027170_115_1887 562
1518 3300044683 Ga0466965_0001118 Ga0466965_0001118_6556_8328 562
1519 3300044684 Ga0466966_0002982 Ga0466966_0002982_3977_5749 562
1520 3300044684 Ga0466966_0082728 Ga0466966_0082728_91_1863 562
1521 3300044693 Ga0466961_0003814 Ga0466961_0003814_3977_5749 562
1522 3300044694 Ga0466963_0000177 Ga0466963_0000177_5610_7382 562
1523 3300044694 Ga0466963_0001380 Ga0466963_0001380_8069_9841 562
1524 3300044719 Ga0466971_0001709 Ga0466971_0001709_2854_4626 562
1525 3300044719 Ga0466971_0005419 Ga0466971_0005419_2467_4239 562
1526 3300044765 Ga0466970_0000599 Ga0466970_0000599_9087_10859 562
1527 3300044842 Ga0466957_0000564 Ga0466957_0000564_441_2213 562
1528 3300045049 Ga0466959_0003694 Ga0466959_0003694_3830_5602 562
1529 3300046455 Ga0495603_0002872 Ga0495603_0002872_302_2074 562
1530 3300046462 Ga0495651_0020354 Ga0495651_0020354_654_2429 562
1531 3300046472 Ga0495580_0004763 Ga0495580_0004763_5809_7542 562
1532 3300046475 Ga0495639_0014844 Ga0495639_0014844_722_2494 562
1533 3300046476 Ga0495662_0051892 Ga0495662_0051892_195_1967 562
1534 3300046515 Ga0495620_0009619 Ga0495620_0009619_46_1818 562
1535 3300046528 Ga0495642_0042216 Ga0495642_0042216_34_1806 562
1536 3300046543 Ga0495645_0054733 Ga0495645_0054733_249_2021 562
1537 3300046674 Ga0495588_0023001 Ga0495588_0023001_118_1890 562
1538 3300046679 Ga0495623_0002383 Ga0495623_0002383_10692_12464 562
1539 3300046794 Ga0495589_0029548 Ga0495589_0029548_980_2752 562
1540 3300047318 Ga0495636_0005765 Ga0495636_0005765_2000_3772 562
1541 3300047318 Ga0495636_0021053 Ga0495636_0021053_45_1817 562
1542 3300047447 Ga0495685_009324 Ga0495685_009324_753_2525 562
1543 3300047472 Ga0495686_0018267 Ga0495686_0018267_2814_4586 562
1544 3300048089 Ga0495614_0022327 Ga0495614_0022327_603_2378 562
1545 3300048912 Ga0496109_0047585 Ga0496109_0047585_764_2551 562
1546 3300048912 Ga0496109_0054036 Ga0496109_0054036_1189_2961 562
1547 3300048913 Ga0496110_0070365 Ga0496110_0070365_539_2341 562
1548 3300048925 Ga0496122_0000032 Ga0496122_0000032_78328_80052 562
1549 3300048925 Ga0496122_0009163 Ga0496122_0009163_578_2338 562
1550 3300048926 Ga0496123_0000093 Ga0496123_0000093_165629_167353 562
1551 3300048927 Ga0496124_0109359 Ga0496124_0109359_408_2168 562
1552 3300048928 Ga0496125_0000041 Ga0496125_0000041_125493_127217 562
1553 3300049568 Ga0501031_0001297 Ga0501031_0001297_6504_8252 562
1554 3300049568 Ga0501031_0040799 Ga0501031_0040799_199_1971 562
1555 3300049570 Ga0501033_0007862 Ga0501033_0007862_734_2482 562
1556 3300049571 Ga0501034_0018363 Ga0501034_0018363_2299_4047 562
1557 3300049572 Ga0501036_0009116 Ga0501036_0009116_1621_3369 562
1558 3300049573 Ga0501037_0000782 Ga0501037_0000782_18603_20351 562
1559 3300049574 Ga0501038_0002773 Ga0501038_0002773_14472_16244 562
1560 3300049574 Ga0501038_0024154 Ga0501038_0024154_2403_4151 562
1561 3300049575 Ga0501039_0016742 Ga0501039_0016742_2343_4091 562
1562 3300049576 Ga0501040_0039799 Ga0501040_0039799_957_2705 562
1563 3300049579 Ga0501043_0139824 Ga0501043_0139824_24_1796 562
1564 3300049580 Ga0501046_0001159 Ga0501046_0001159_2098_3846 562
1565 3300049581 Ga0501047_0038804 Ga0501047_0038804_2787_4559 562
1566 3300049581 Ga0501047_0041053 Ga0501047_0041053_1069_2817 562
1567 3300049582 Ga0501048_0006060 Ga0501048_0006060_4714_6462 562
1568 3300049583 Ga0501067_0000245 Ga0501067_0000245_15555_17339 562
1569 3300049583 Ga0501067_0002205 Ga0501067_0002205_7891_9639 562
1570 3300049585 Ga0501069_0016615 Ga0501069_0016615_1489_3237 562
1571 3300049586 Ga0501070_0001113 Ga0501070_0001113_1927_3675 562
1572 3300049586 Ga0501070_0002662 Ga0501070_0002662_2908_4692 562
1573 3300049589 Ga0501073_0014852 Ga0501073_0014852_1601_3385 562
1574 3300049589 Ga0501073_0026706 Ga0501073_0026706_167_1915 562
1575 3300049590 Ga0501074_0002415 Ga0501074_0002415_5735_7519 562
1576 3300049590 Ga0501074_0006017 Ga0501074_0006017_2323_4071 562
1577 3300049741 Ga0501079_0035356 Ga0501079_0035356_111_1895 562
1578 3300049742 Ga0501080_0000318 Ga0501080_0000318_22952_24736 562
1579 3300049744 Ga0501083_0008405 Ga0501083_0008405_4538_6286 562
1580 3300049822 Ga0501035_0006710 Ga0501035_0006710_1069_2817 562
1581 3300049822 Ga0501035_0012536 Ga0501035_0012536_4374_6146 562
1582 3300049823 Ga0501044_0004786 Ga0501044_0004786_87_1859 562
1583 3300049823 Ga0501044_0054689 Ga0501044_0054689_983_2755 562
1584 3300050495 nmdc:mga04h51_3426_c1 nmdc:mga04h51_3426_c1_555_2327 562
1585 3300053136 Ga0500559_0003977 Ga0500559_0003977_4899_6668 562
1586 3300054114 Ga0501084_0002835 Ga0501084_0002835_2341_4089 562
1587 3300060353 Ga0501082_0007249 Ga0501082_0007249_2803_4587 562
1588 3300061719 Ga0466962_0000868 Ga0466962_0000868_5463_7235 562
1589 3300061719 Ga0466962_0008985 Ga0466962_0008985_213_1985 562
1590 iso_pu_bacteria 2554235227 2555229715 562
1591 iso_pu_bacteria 2558860280 2559428997 562
1592 iso_pu_bacteria 2585428157 2588106818 562
1593 iso_pu_bacteria 2643221542 2643735071 562
1594 iso_pu_bacteria 2643221546 2643753099 562
1595 iso_pu_bacteria 2643221553 2643786709 562
1596 iso_pu_bacteria 2643221561 2643824100 562
1597 iso_pu_bacteria 2643221566 2643846420 562
1598 iso_pu_bacteria 2643221575 2643888436 562
1599 iso_pu_bacteria 2643221576 2643892448 562
1600 iso_pu_bacteria 2643221590 2643961500 562
1601 iso_pu_bacteria 2643221597 2643996544 562
1602 iso_pu_bacteria 2643221604 2644032432 562
1603 iso_pu_bacteria 2643221615 2644090496 562
1604 iso_pu_bacteria 2643221616 2644095010 562
1605 iso_pu_bacteria 2643221630 2644173233 562
1606 iso_pu_bacteria 2643221632 2644181003 562
1607 iso_pu_bacteria 2643221657 2644323376 562
1608 iso_pu_bacteria 2643221696 2644533406 562
1609 iso_pu_bacteria 2643221724 2644681390 562
1610 iso_pu_bacteria 2654587600 2655031739 562
1611 iso_pu_bacteria 2728369380 2730230177 562
1612 iso_pu_bacteria 2738541305 2738870615 562
1613 iso_pu_bacteria 2747842429 2747951633 562
1614 iso_pu_bacteria 2773857763 2774400328 562
1615 iso_pu_bacteria 2808606368 2808884980 562
1616 iso_pu_bacteria 2811994872 2812322363 562
1617 iso_pu_bacteria 2821268502 2821269283 562
1618 iso_pu_bacteria 2833709550 2833710190 562
1619 iso_pu_bacteria 2844841374 2844841491 562
1620 iso_pu_bacteria 2852632344 2852632979 562
1621 iso_pu_bacteria 2852646457 2852649529 562
1622 iso_pu_bacteria 2852663356 2852665614 562
1623 iso_pu_bacteria 2855386786 2855389117 562
1624 iso_pu_bacteria 2857720070 2857722273 562
1625 iso_pu_bacteria 2857723135 2857725021 562
1626 iso_pu_bacteria 2857729791 2857732145 562
1627 iso_pu_bacteria 2862993130 2862994689 562
1628 iso_pu_bacteria 2866552031 2866555021 562
1629 iso_pu_bacteria 2870628048 2870629653 562
1630 iso_pu_bacteria 2884763398 2884764391 562
1631 iso_pu_bacteria 2893684298 2893685025 562
1632 iso_pu_bacteria 2904509784 2904510120 562
1633 iso_pu_bacteria 2906799679 2906801962 562
1634 iso_pu_bacteria 2908678064 2908678658 562
1635 iso_pu_bacteria 2919069694 2919071009 562
1636 iso_pu_bacteria 2919395869 2919396749 562
1637 iso_pu_bacteria 2919523602 2919527192 562
1638 iso_pu_bacteria 2928090899 2928091118 562
1639 iso_pu_bacteria 2928121344 2928124957 562
1640 iso_pu_bacteria 2928153084 2928154912 562
1641 iso_pu_bacteria 2946033335 2946036928 562
1642 iso_pu_bacteria 2946080515 2946084553 562
1643 iso_pu_bacteria 2966921586 2966921901 562
1644 iso_pu_bacteria 2977228692 2977230557 562
1645 iso_pu_bacteria 2977264416 2977265824 562
1646 iso_pu_bacteria 2984542743 2984542855 562
1647 iso_pu_bacteria 2984576629 2984579840 562
1648 iso_pu_bacteria 2984580707 2984582122 562
1649 iso_pu_bacteria 2990256926 2990257446 562
1650 iso_pu_bacteria 8004182704 8004185708 562
1651 iso_pu_bacteria 8045830549 8045832813 562
1652 iso_pu_bacteria 8047710418 8047719840 562
1653 iso_pu_bacteria 8056037122 8056040794 562
1654 3300005327 Ga0070658_10010283 Ga0070658_100102834 563
1655 3300005543 Ga0070672_100012309 Ga0070672_1000123093 563
1656 3300005616 Ga0068852_100003937 Ga0068852_1000039373 563
1657 3300005937 Ga0081455_10000960 Ga0081455_1000096014 563
1658 3300005937 Ga0081455_10007554 Ga0081455_100075546 563
1659 3300005937 Ga0081455_10017647 Ga0081455_100176474 563
1660 3300005981 Ga0081538_10000350 Ga0081538_1000035010 563
1661 3300014325 Ga0163163_10094123 Ga0163163_100941232 563
1662 3300025940 Ga0207691_10076862 Ga0207691_100768623 563
1663 3300025941 Ga0207711_10004915 Ga0207711_100049156 563
1664 3300026142 Ga0207698_10000744 Ga0207698_100007444 563
1665 3300031456 Ga0307513_10140542 Ga0307513_101405422 563
1666 3300031548 Ga0307408_100005598 Ga0307408_1000055984 563
1667 3300031548 Ga0307408_100007559 Ga0307408_1000075594 563
1668 3300031548 Ga0307408_100019305 Ga0307408_1000193052 563
1669 3300031665 Ga0316575_10000018 Ga0316575_1000001829 563
1670 3300031731 Ga0307405_10001845 Ga0307405_100018453 563
1671 3300031731 Ga0307405_10015727 Ga0307405_100157273 563
1672 3300031824 Ga0307413_10001911 Ga0307413_100019116 563
1673 3300031852 Ga0307410_10000323 Ga0307410_1000032310 563
1674 3300031852 Ga0307410_10048087 Ga0307410_100480871 563
1675 3300031901 Ga0307406_10001419 Ga0307406_100014196 563
1676 3300031901 Ga0307406_10004754 Ga0307406_100047544 563
1677 3300031903 Ga0307407_10015535 Ga0307407_100155353 563
1678 3300031903 Ga0307407_10028232 Ga0307407_100282322 563
1679 3300031911 Ga0307412_10005539 Ga0307412_100055395 563
1680 3300031911 Ga0307412_10008137 Ga0307412_100081374 563
1681 3300031995 Ga0307409_100002136 Ga0307409_1000021367 563
1682 3300031995 Ga0307409_100002325 Ga0307409_1000023254 563
1683 3300031995 Ga0307409_100036390 Ga0307409_1000363903 563
1684 3300032002 Ga0307416_100000046 Ga0307416_10000004612 563
1685 3300032002 Ga0307416_100015813 Ga0307416_1000158133 563
1686 3300032002 Ga0307416_100028464 Ga0307416_1000284643 563
1687 3300032005 Ga0307411_10000436 Ga0307411_1000043611 563
1688 3300037853 Ga0436364_0214533 Ga0436364_0214533_6002_7774 563
1689 3300044693 Ga0466961_0027590 Ga0466961_0027590_443_2197 563
1690 3300044765 Ga0466970_0026285 Ga0466970_0026285_291_2066 563
1691 3300044842 Ga0466957_0092920 Ga0466957_0092920_81_1856 563
1692 3300045836 Ga0466958_0010462 Ga0466958_0010462_1373_3127 563
1693 3300046476 Ga0495662_0018560 Ga0495662_0018560_988_2763 563
1694 3300046675 Ga0495657_0005519 Ga0495657_0005519_7617_9392 563
1695 3300046689 Ga0495613_0028816 Ga0495613_0028816_1439_3214 563
1696 3300048924 Ga0496121_0000025 Ga0496121_0000025_276210_277982 563
1697 3300048925 Ga0496122_0032946 Ga0496122_0032946_1811_3604 563
1698 3300048926 Ga0496123_0013793 Ga0496123_0013793_616_2409 563
1699 3300048929 Ga0496126_0000565 Ga0496126_0000565_66410_68170 563
1700 3300049569 Ga0501032_0049949 Ga0501032_0049949_430_2202 563
1701 3300049570 Ga0501033_0034771 Ga0501033_0034771_466_2307 563
1702 3300049571 Ga0501034_0001887 Ga0501034_0001887_23945_25708 563
1703 3300049571 Ga0501034_0127799 Ga0501034_0127799_598_2358 563
1704 3300049574 Ga0501038_0107063 Ga0501038_0107063_352_2127 563
1705 3300049574 Ga0501038_0119122 Ga0501038_0119122_39_1880 563
1706 3300049575 Ga0501039_0037589 Ga0501039_0037589_368_2143 563
1707 3300049578 Ga0501042_0088366 Ga0501042_0088366_23_1864 563
1708 3300049579 Ga0501043_0063922 Ga0501043_0063922_822_2594 563
1709 3300049579 Ga0501043_0131504 Ga0501043_0131504_141_1937 563
1710 3300049580 Ga0501046_0055965 Ga0501046_0055965_717_2558 563
1711 3300049581 Ga0501047_0000597 Ga0501047_0000597_29283_31055 563
1712 3300049581 Ga0501047_0006639 Ga0501047_0006639_1568_3328 563
1713 3300049581 Ga0501047_0019762 Ga0501047_0019762_2234_4009 563
1714 3300049582 Ga0501048_0024811 Ga0501048_0024811_1182_3023 563
1715 3300049586 Ga0501070_0040363 Ga0501070_0040363_1708_3483 563
1716 3300049588 Ga0501072_0020326 Ga0501072_0020326_811_2571 563
1717 3300049589 Ga0501073_0011920 Ga0501073_0011920_1240_3000 563
1718 3300049742 Ga0501080_0000592 Ga0501080_0000592_2074_3834 563
1719 3300049822 Ga0501035_0004251 Ga0501035_0004251_4264_6036 563
1720 3300049823 Ga0501044_0003079 Ga0501044_0003079_4995_6767 563
1721 3300053080 Ga0500635_0002469 Ga0500635_0002469_782_2557 563
1722 3300054114 Ga0501084_0135333 Ga0501084_0135333_137_1978 563
1723 iso_pu_bacteria 2643221635 2644197110 563
1724 iso_pu_bacteria 2791354901 2791917229 563
1725 iso_pu_bacteria 2808606447 2809226760 563
1726 iso_pu_bacteria 2863067949 2863073318 563
1727 iso_pu_bacteria 8056207758 8056209609 563
1728 iso_pu_bacteria 8057345674 8057345818 563
1729 3300002067 JGI24735J21928_10007117 JGI24735J21928_100071171 564
1730 3300003214 JGI25165J46597_1000044 JGI25165J46597_1000044197 564
1731 3300003578 Ga0006562J51391_1022179 Ga0006562J51391_10221791 564
1732 3300003578 Ga0006562J51391_1059279 Ga0006562J51391_10592793 564
1733 3300003752 Ga0055539_1000027 Ga0055539_1000027210 564
1734 3300003756 Ga0055533_1000020 Ga0055533_1000020210 564
1735 3300003759 Ga0055525_1000151 Ga0055525_100015178 564
1736 3300003760 Ga0055527_1000005 Ga0055527_1000005472 564
1737 3300003762 Ga0055542_1000006 Ga0055542_1000006472 564
1738 3300003763 Ga0055529_1000400 Ga0055529_100040025 564
1739 3300003841 Ga0055541_1000508 Ga0055541_10005087 564
1740 3300006051 Ga0075364_10004093 Ga0075364_100040934 564
1741 3300006946 Ga0079104_1000016 Ga0079104_1000016225 564
1742 3300009036 Ga0105244_10054775 Ga0105244_100547751 564
1743 3300009092 Ga0105250_10009500 Ga0105250_100095002 564
1744 3300009148 Ga0105243_10085039 Ga0105243_100850391 564
1745 3300013105 Ga0157369_10092031 Ga0157369_100920313 564
1746 3300013250 Ga0171462_1001 Ga0171462_1001362 564
1747 3300015262 Ga0182007_10009441 Ga0182007_100094414 564
1748 3300020082 Ga0206353_10548390 Ga0206353_105483905 564
1749 3300025225 Ga0209566_100043 Ga0209566_100043121 564
1750 3300025226 Ga0209674_100001 Ga0209674_1000013689 564
1751 3300025228 Ga0209672_100003 Ga0209672_100003814 564
1752 3300025229 Ga0209147_100285 Ga0209147_10028517 564
1753 3300025230 Ga0209563_100001 Ga0209563_1000013689 564
1754 3300025230 Ga0209563_100222 Ga0209563_1002226 564
1755 3300025231 Ga0207427_100077 Ga0207427_10007730 564
1756 3300025233 Ga0209437_101291 Ga0209437_1012915 564
1757 3300025242 Ga0209258_102017 Ga0209258_1020173 564
1758 3300025246 Ga0209646_1000209 Ga0209646_100020917 564
1759 3300025253 Ga0209677_100001 Ga0209677_1000013689 564
1760 3300025253 Ga0209677_100723 Ga0209677_1007233 564
1761 3300025254 Ga0209148_1000004 Ga0209148_10000041109 564
1762 3300025261 Ga0209233_1000014 Ga0209233_1000014196 564
1763 3300025272 Ga0209455_1000046 Ga0209455_1000046128 564
1764 3300025934 Ga0207686_10012807 Ga0207686_100128074 564
1765 3300025935 Ga0207709_10001930 Ga0207709_100019301 564
1766 3300025935 Ga0207709_10016612 Ga0207709_100166122 564
1767 3300027111 Ga0209281_1000017 Ga0209281_1000017235 564
1768 3300031901 Ga0307406_10000126 Ga0307406_100001263 564
1769 3300031901 Ga0307406_10002924 Ga0307406_100029246 564
1770 3300031911 Ga0307412_10064512 Ga0307412_100645122 564
1771 3300044658 Ga0466972_0038856 Ga0466972_0038856_124_1887 564
1772 3300044765 Ga0466970_0036219 Ga0466970_0036219_544_2307 564
1773 3300048916 Ga0496113_0022948 Ga0496113_0022948_536_2293 564
1774 3300048920 Ga0496117_0000028 Ga0496117_0000028_92892_94658 564
1775 3300048920 Ga0496117_0000827 Ga0496117_0000827_46091_47857 564
1776 3300048920 Ga0496117_0001658 Ga0496117_0001658_25132_26898 564
1777 3300048920 Ga0496117_0013171 Ga0496117_0013171_2604_4367 564
1778 3300048922 Ga0496119_0001365 Ga0496119_0001365_15616_17382 564
1779 3300048922 Ga0496119_0003323 Ga0496119_0003323_4075_5841 564
1780 3300048922 Ga0496119_0015916 Ga0496119_0015916_667_2433 564
1781 3300048922 Ga0496119_0018005 Ga0496119_0018005_1714_3480 564
1782 3300048923 Ga0496120_0000622 Ga0496120_0000622_32941_34707 564
1783 3300048923 Ga0496120_0001791 Ga0496120_0001791_12323_14089 564
1784 3300048923 Ga0496120_0034461 Ga0496120_0034461_325_2091 564
1785 3300048925 Ga0496122_0000020 Ga0496122_0000020_297405_299171 564
1786 3300048925 Ga0496122_0000522 Ga0496122_0000522_12638_14404 564
1787 3300048925 Ga0496122_0106083 Ga0496122_0106083_56_1822 564
1788 3300048926 Ga0496123_0000003 Ga0496123_0000003_512529_514295 564
1789 3300048926 Ga0496123_0000251 Ga0496123_0000251_100953_102719 564
1790 3300048926 Ga0496123_0003958 Ga0496123_0003958_3983_5749 564
1791 3300048927 Ga0496124_0001543 Ga0496124_0001543_1034_2800 564
1792 3300048927 Ga0496124_0009389 Ga0496124_0009389_5933_7699 564
1793 3300048927 Ga0496124_0023563 Ga0496124_0023563_1509_3275 564
1794 3300048928 Ga0496125_0004896 Ga0496125_0004896_3112_4878 564
1795 3300048928 Ga0496125_0006622 Ga0496125_0006622_3329_5095 564
1796 3300048928 Ga0496125_0006849 Ga0496125_0006849_165_1931 564
1797 3300048928 Ga0496125_0025735 Ga0496125_0025735_3152_4918 564
1798 3300048928 Ga0496125_0099525 Ga0496125_0099525_193_1959 564
1799 3300048929 Ga0496126_0012464 Ga0496126_0012464_5357_7123 564
1800 3300048929 Ga0496126_0030560 Ga0496126_0030560_56_1822 564
1801 3300048929 Ga0496126_0030579 Ga0496126_0030579_2972_4738 564
1802 3300049571 Ga0501034_0049750 Ga0501034_0049750_1770_3539 564
1803 3300049574 Ga0501038_0124322 Ga0501038_0124322_56_1825 564
1804 3300049586 Ga0501070_0000701 Ga0501070_0000701_22411_24177 564
1805 3300050492 nmdc:mga0yw44_11425_c1 nmdc:mga0yw44_11425_c1_2248_4014 564
1806 iso_pu_bacteria 2643221549 2643768205 564
1807 iso_pu_bacteria 2643221619 2644111634 564
1808 iso_pu_bacteria 2721755702 2723642958 564
1809 iso_pu_bacteria 2738541272 2738693100 564
1810 iso_pu_bacteria 2738543027 2739323326 564
1811 iso_pu_bacteria 2773857759 2774383597 564
1812 iso_pu_bacteria 2795385472 2795796384 564
1813 iso_pu_bacteria 2808606306 2808631853 564
1814 iso_pu_bacteria 2808606371 2808895753 564
1815 iso_pu_bacteria 2808606372 2808902945 564
1816 iso_pu_bacteria 2808606700 2810363359 564
1817 iso_pu_bacteria 2816332119 2816423748 564
1818 iso_pu_bacteria 2816332305 2817509613 564
1819 iso_pu_bacteria 2857632687 2857635073 564
1820 iso_pu_bacteria 2870804320 2870806122 564
1821 iso_pu_bacteria 2905926851 2905929718 564
1822 iso_pu_bacteria 2919443155 2919443517 564
1823 iso_pu_bacteria 2920879853 2920883593 564
1824 iso_pu_bacteria 2928104781 2928105931 564
1825 iso_pu_bacteria 2935409751 2935412268 564
1826 iso_pu_bacteria 2946059875 2946063499 564
1827 iso_pu_bacteria 8056579771 8056580801 564
1828 3300006846 Ga0075430_100079552 Ga0075430_1000795521 565
1829 3300006880 Ga0075429_100081459 Ga0075429_1000814593 565
1830 3300009176 Ga0105242_10001582 Ga0105242_100015828 565
1831 3300025935 Ga0207709_10004881 Ga0207709_100048816 565
1832 3300025945 Ga0207679_10078159 Ga0207679_100781592 565
1833 3300031852 Ga0307410_10017434 Ga0307410_100174343 565
1834 3300032126 Ga0307415_100031243 Ga0307415_1000312433 565
1835 3300044683 Ga0466965_0028398 Ga0466965_0028398_474_2240 565
1836 3300048904 Ga0496101_0006147 Ga0496101_0006147_831_2600 565
1837 3300048905 Ga0496102_0011485 Ga0496102_0011485_5700_7469 565
1838 3300048906 Ga0496103_0009243 Ga0496103_0009243_3920_5689 565
1839 3300048907 Ga0496104_0092129 Ga0496104_0092129_198_1967 565
1840 3300048910 Ga0496107_0028614 Ga0496107_0028614_72_1841 565
1841 3300048912 Ga0496109_0051803 Ga0496109_0051803_342_2111 565
1842 3300048915 Ga0496112_0081252 Ga0496112_0081252_357_2126 565
1843 3300048918 Ga0496115_0034135 Ga0496115_0034135_683_2452 565
1844 3300048918 Ga0496115_0047192 Ga0496115_0047192_1362_3131 565
1845 3300048920 Ga0496117_0000084 Ga0496117_0000084_212229_214022 565
1846 3300048920 Ga0496117_0009224 Ga0496117_0009224_244_1974 565
1847 3300048927 Ga0496124_0058064 Ga0496124_0058064_272_2002 565
1848 3300048928 Ga0496125_0035820 Ga0496125_0035820_2250_3980 565
1849 3300050496 nmdc:mga07m45_1731_c1 nmdc:mga07m45_1731_c1_3932_5662 565
1850 iso_pu_bacteria 2738543005 2739202970 565
1851 iso_pu_bacteria 2738543011 2739236528 565
1852 iso_pu_bacteria 2751185788 2753302607 565
1853 iso_pu_bacteria 2775506735 2775656341 565
1854 iso_pu_bacteria 2808606357 2808830542 565
1855 iso_pu_bacteria 2808606360 2808851737 565
1856 iso_pu_bacteria 2811994871 2812321902 565
1857 iso_pu_bacteria 2844849076 2844852090 565
1858 iso_pu_bacteria 2857479173 2857480526 565
1859 iso_pu_bacteria 2866612099 2866618838 565
1860 iso_pu_bacteria 2889300758 2889306014 565
1861 iso_pu_bacteria 2899370129 2899375115 565
1862 iso_pu_bacteria 2904501621 2904503902 565
1863 iso_pu_bacteria 2908674828 2908676868 565
1864 iso_pu_bacteria 2909074476 2909076942 565
1865 iso_pu_bacteria 2919039151 2919039551 565
1866 iso_pu_bacteria 2919042368 2919042950 565
1867 iso_pu_bacteria 2928142448 2928142809 565
1868 iso_pu_bacteria 2928500415 2928502010 565
1869 iso_pu_bacteria 2939598168 2939599858 565
1870 iso_pu_bacteria 2939743619 2939744151 565
1871 iso_pu_bacteria 2945916053 2945919772 565
1872 iso_pu_bacteria 2953998280 2954001138 565
1873 iso_pu_bacteria 8004021418 8004023959 565
1874 iso_pu_bacteria 8004025490 8004028795 565
1875 3300006186 Ga0075369_10001262 Ga0075369_100012626 566
1876 3300011119 Ga0105246_10051663 Ga0105246_100516631 566
1877 3300026118 Ga0207675_100021530 Ga0207675_1000215304 566
1878 3300050516 nmdc:mga0sz30_2197_c2 nmdc:mga0sz30_2197_c2_327_2102 566
1879 iso_pu_bacteria 2565956761 2566991958 566
1880 iso_pu_bacteria 2582580736 2583152394 566
1881 iso_pu_bacteria 2738541308 2738887266 566
1882 iso_pu_bacteria 2744054611 2744956940 566
1883 iso_pu_bacteria 2808606370 2808894804 566
1884 iso_pu_bacteria 2899359706 2899366776 566
1885 iso_pu_bacteria 2917736166 2917737593 566
1886 iso_pu_bacteria 2922554459 2922559371 566
1887 iso_pu_bacteria 2932398195 2932398332 566
1888 iso_pu_bacteria 2945920336 2945924326 566
1889 iso_pu_bacteria 2945941187 2945943956 566
1890 iso_pu_bacteria 2946037020 2946039910 566
1891 iso_pu_bacteria 3007872151 3007873750 566
1892 iso_pu_bacteria 8003314358 8003323314 566
1893 iso_pu_bacteria 2523231044 2523385719 567
1894 iso_pu_bacteria 2585427649 2586064271 567
1895 iso_pu_bacteria 2643221683 2644466496 567
1896 iso_pu_bacteria 2643221692 2644515145 567
1897 iso_pu_bacteria 2738541277 2738721888 567
1898 iso_pu_bacteria 2738543019 2739282252 567
1899 iso_pu_bacteria 2808606522 2809586479 567
1900 iso_pu_bacteria 2857479173 2857479858 567
1901 iso_pu_bacteria 2857632687 2857634456 567
1902 iso_pu_bacteria 2857740372 2857740404 567
1903 iso_pu_bacteria 2870801768 2870803133 567
1904 iso_pu_bacteria 2870804320 2870805188 567
1905 iso_pu_bacteria 2891373044 2891376019 567
1906 iso_pu_bacteria 2904497146 2904499473 567
1907 iso_pu_bacteria 2904776348 2904778564 567
1908 iso_pu_bacteria 2919059106 2919060631 567
1909 iso_pu_bacteria 2919538618 2919538861 567
1910 iso_pu_bacteria 2932422444 2932422830 567
1911 iso_pu_bacteria 2933418574 2933418953 567
1912 iso_pu_bacteria 2939647034 2939648099 567
1913 3300003781 Ga0055536_1003520 Ga0055536_10035203 568
1914 3300003792 Ga0055540_1002446 Ga0055540_10024463 568
1915 3300003794 Ga0055531_10001546 Ga0055531_1000154613 568
1916 3300005367 Ga0070667_100034330 Ga0070667_1000343302 568
1917 3300025292 Ga0209676_1000961 Ga0209676_100096117 568
1918 3300025298 Ga0209050_1000884 Ga0209050_100088418 568
1919 3300025303 Ga0209051_1000830 Ga0209051_100083014 568
1920 3300025304 Ga0209257_1000172 Ga0209257_100017218 568
1921 3300025893 Ga0207682_10025978 Ga0207682_100259782 568
1922 3300025986 Ga0207658_10061919 Ga0207658_100619192 568
1923 3300046558 Ga0495633_0000657 Ga0495633_0000657_21901_23625 568
1924 3300046674 Ga0495588_0012941 Ga0495588_0012941_1357_3093 568
1925 3300048903 Ga0496100_0009305 Ga0496100_0009305_2843_4579 568
1926 3300048905 Ga0496102_0021055 Ga0496102_0021055_2398_4134 568
1927 3300048906 Ga0496103_0030937 Ga0496103_0030937_1188_2924 568
1928 3300048907 Ga0496104_0010383 Ga0496104_0010383_5001_6737 568
1929 3300048909 Ga0496106_0030266 Ga0496106_0030266_940_2676 568
1930 3300048916 Ga0496113_0051703 Ga0496113_0051703_1158_2894 568
1931 3300048929 Ga0496126_0000918 Ga0496126_0000918_5125_6861 568
1932 iso_pu_bacteria 2671180115 2671584449 568
1933 iso_pu_bacteria 2738541307 2738882064 568
1934 iso_pu_bacteria 2929160207 2929165892 568
1935 iso_pu_bacteria 2929212328 2929214141 568
1936 iso_pu_bacteria 2941479691 2941481551 568
1937 iso_pu_bacteria 2513020051 2513227555 569
1938 iso_pu_bacteria 2547132424 2548693413 569
1939 iso_pu_bacteria 2551306166 2552106125 569
1940 iso_pu_bacteria 2599185155 2599327355 569
1941 iso_pu_bacteria 2599185214 2599621826 569
1942 iso_pu_bacteria 2599185226 2599670490 569
1943 iso_pu_bacteria 2599185227 2599678980 569
1944 iso_pu_bacteria 2599185229 2599691337 569
1945 iso_pu_bacteria 2643221658 2644327015 569
1946 iso_pu_bacteria 2643221672 2644398816 569
1947 iso_pu_bacteria 2818991446 2819597993 569
1948 iso_pu_bacteria 2826581358 2826585347 569
1949 iso_pu_bacteria 2831265667 2831268985 569
1950 iso_pu_bacteria 2838054893 2838058411 569
1951 iso_pu_bacteria 2842815866 2842820442 569
1952 iso_pu_bacteria 2842849001 2842849054 569
1953 iso_pu_bacteria 2842888712 2842892102 569
1954 iso_pu_bacteria 2885198086 2885203848 569
1955 iso_pu_bacteria 2885211737 2885217817 569
1956 iso_pu_bacteria 2899924645 2899929412 569
1957 iso_pu_bacteria 2902792274 2902799358 569
1958 iso_pu_bacteria 2919713450 2919718527 569
1959 iso_pu_bacteria 2928037797 2928040144 569
1960 iso_pu_bacteria 2928044640 2928047107 569
1961 iso_pu_bacteria 2928051484 2928057689 569
1962 iso_pu_bacteria 2928064002 2928067928 569
1963 iso_pu_bacteria 2928070936 2928072494 569
1964 iso_pu_bacteria 2928084124 2928085691 569
1965 iso_pu_bacteria 8056137416 8056139705 569
1966 iso_pu_bacteria 2513237165 2514041943 570
1967 iso_pu_bacteria 2619619299 2621300000 570
1968 iso_pu_bacteria 2721755523 2722881726 570
1969 iso_pu_bacteria 2738541265 2738670000 570
1970 iso_pu_bacteria 2738541282 2738748393 570
1971 iso_pu_bacteria 2738541303 2738857435 570
1972 iso_pu_bacteria 2816332298 2817491296 570
1973 iso_pu_bacteria 2834641062 2834644366 570
1974 iso_pu_bacteria 2839138175 2839143435 570
1975 iso_pu_bacteria 2842718218 2842718929 570
1976 iso_pu_bacteria 2894023352 2894023849 570
1977 iso_pu_bacteria 2904479285 2904481882 570
1978 iso_pu_bacteria 2945984333 2945990116 570
1979 iso_pu_bacteria 2974320154 2974320215 570
1980 iso_pu_bacteria 2979089926 2979090825 570
1981 iso_pu_bacteria 2979095461 2979096349 570
1982 iso_pu_bacteria 650716007 650843537 570
1983 iso_pu_bacteria 8003400568 8003404232 570
1984 3300003187 JGI25151J46595_10014470 JGI25151J46595_100144701 571
1985 3300009148 Ga0105243_10002952 Ga0105243_100029529 571
1986 3300025294 Ga0209025_1000086 Ga0209025_1000086125 571
1987 3300025935 Ga0207709_10000433 Ga0207709_100004338 571
1988 3300042115 Ga0450911_000036 Ga0450911_000036_19810_21534 571
1989 3300048920 Ga0496117_0020415 Ga0496117_0020415_534_2291 571
1990 3300048927 Ga0496124_0001325 Ga0496124_0001325_8330_10054 571
1991 3300048927 Ga0496124_0097865 Ga0496124_0097865_220_1944 571
1992 3300048928 Ga0496125_0002973 Ga0496125_0002973_16920_18644 571
1993 3300009176 Ga0105242_10088615 Ga0105242_100886151 572
1994 3300025291 Ga0209675_1004266 Ga0209675_10042663 572
1995 3300025294 Ga0209025_1041585 Ga0209025_10415851 572
1996 3300025934 Ga0207686_10106914 Ga0207686_101069142 572
1997 3300048919 Ga0496116_0024962 Ga0496116_0024962_182_1909 572
1998 3300048926 Ga0496123_0020352 Ga0496123_0020352_1349_3076 572
1999 2162886011 MRS1b_contig_5332385 MRS1b_0430.00001960 573
2000 3300005290 Ga0065712_10071676 Ga0065712_100716762 573
2001 3300009036 Ga0105244_10000125 Ga0105244_1000012541 573
2002 3300011119 Ga0105246_10045538 Ga0105246_100455382 573
2003 3300025728 Ga0207655_1010439 Ga0207655_10104394 573
2004 3300027296 Ga0209389_1000059 Ga0209389_100005911 573
2005 3300042137 Ga0450902_000354 Ga0450902_000354_3398_5137 573
2006 3300042142 Ga0450905_003021 Ga0450905_003021_139_1878 573
2007 3300042533 Ga0450901_000013 Ga0450901_000013_3130_4869 573
2008 3300049568 Ga0501031_0003815 Ga0501031_0003815_3392_5128 573
2009 3300013104 Ga0157370_10011155 Ga0157370_100111558 574
2010 3300025294 Ga0209025_1000822 Ga0209025_100082230 574
2011 3300042876 Ga0451577_0020062 Ga0451577_0020062_1794_3527 574
2012 3300044673 Ga0453683_0007877 Ga0453683_0007877_1832_3565 574
2013 3300044712 Ga0453684_0039654 Ga0453684_0039654_2096_3829 574
2014 3300045051 Ga0451576_0018666 Ga0451576_0018666_1618_3351 574
2015 3300048925 Ga0496122_0040836 Ga0496122_0040836_1581_3314 574
2016 3300048926 Ga0496123_0041591 Ga0496123_0041591_376_2115 574
2017 3300048928 Ga0496125_0005318 Ga0496125_0005318_11348_13087 574
2018 3300049571 Ga0501034_0000163 Ga0501034_0000163_119672_121402 574
2019 2162886007 SwRhRL2b_contig_2512745 SwRhRL2b_0748.00004260 575
2020 3300005262 Ga0065165_1000076 Ga0065165_100007693 575
2021 3300005289 Ga0065704_10075631 Ga0065704_100756313 575
2022 3300053153 Ga0500616_0009763 Ga0500616_0009763_924_2663 575

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

171

379

0.99

PF00289

Biotin_carb_N

Biotin carboxylase, N-terminal domain

57

166

0.98

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

569

636

0.98

PF02785

Biotin_carb_C

Biotin carboxylase C-terminal domain

390

505

0.95

PF02222

ATP-grasp

ATP-grasp domain

179

350

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mlk-assembly1.cif.gz_A biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285) 0.9847 2 454
5mlk-assembly1.cif.gz_B biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285) 0.9799 2 454
5mlk-assembly1.cif.gz_A biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285) 0.9782 2 454
3ouu-assembly1.cif.gz_A crystal structure of biotin carboxylase-beta-gamma-atp complex from campylobacter jejuni 0.9738 1 444
5mlk-assembly1.cif.gz_B biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285) 0.9723 2 454
ID Description Score Start End Superfamily
af_P96890_142_212_3.30.1490.20 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 1.002 132 202 3.30.1490.20
af_Q4CS16_606_674_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.991 509 575 2.40.50.100
af_P96890_142_212_3.30.1490.20 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.9885 132 202 3.30.1490.20
5mlkB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.988 202 454 3.30.470.20
5mlkA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9851 87 454 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A6N9Y8D7-F1-model_v4 deleted 0.9937 213 430
AF-A0A2T4S5Z1-F1-model_v4 Acetyl-CoA carboxylase biotin carboxylase subunit 0.989 3 111 GO:0005524
GO:0016874
AF-A0A323V7T1-F1-model_v4 biotin carboxylase (EC 6.3.4.14) 0.9889 2 78 GO:0005524
GO:0016874
AF-A0A2N0SS15-F1-model_v4 biotin carboxylase (EC 6.3.4.14) 0.9877 4 81 GO:0005524
GO:0016874
AF-A0A4Z1CG50-F1-model_v4 Acetyl-CoA carboxylase biotin carboxyl carrier protein subunit 0.9865 501 575

Feature Viewer

pLDDT pTM Quality
89.6 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map