F496129

General Info

Members Datasets Scaffolds Average Seq Length
1948 602 1886 160

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0457017|Ga0501067_0457017_64_627
Length 187
Sequence LDDPHARIRSLPPEGAPGGFGRPSTTGVGANIHFEDWLALTQLYADYASAVDSGNWDLWPEFFTDDCVYRLVPRENHERGFPLATLSFTSKGMLKDRVYGIKDTLFHDPYYQRHVVGAPVLRKVEAGRFECEANYAVFRTKLSEATVVFNVGRYLDVVVRTPAGLKFAERHCIYDSEMIPNSIIYPI

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
5 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2643221570 Acidovorax sp. Root568 Isolate Unclassified
11 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
12 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
13 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
14 2643221652 Acidovorax sp. Root402 Isolate Unclassified
15 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
16 2643221672 Variovorax sp. Root434 Isolate Unclassified
17 2643221683 Variovorax sp. Root473 Isolate Unclassified
18 2643221717 Acidovorax sp. Root267 Isolate Unclassified
19 2738541277 Variovorax sp. GV051 Isolate Unclassified
20 2738541280 Massilia sp. GV090 Isolate Unclassified
21 2738541297 Duganella sp. GV083 Isolate Unclassified
22 2738541307 Variovorax sp. GV008 Isolate Unclassified
23 2738541357 Duganella sp. GV053 Isolate Unclassified
24 2738543003 Duganella sp. GV066 Isolate Unclassified
25 2738543013 Variovorax sp. BT01 Isolate Unclassified
26 2738543019 Variovorax sp. GV040 Isolate Unclassified
27 2738543026 Duganella sp. GV089 Isolate Unclassified
28 2738543029 Duganella sp. GV039 Isolate Unclassified
29 2818991446 Variovorax sp. 1180 Isolate Unclassified
30 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
31 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
32 2842677519 Variovorax sp. R-72495 Isolate Unclassified
33 2842733646 Variovorax sp. R-72446 Isolate Unclassified
34 2842747753 Variovorax sp. R-72060 Isolate Unclassified
35 2885198086 Variovorax sp. 679 Isolate Unclassified
36 2885211737 Variovorax sp. 553 Isolate Unclassified
37 2899924645 Variovorax sp. 369 Isolate Unclassified
38 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
39 2904456579 Variovorax sp. 2002 Isolate Unclassified
40 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
41 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
42 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
43 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
44 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
45 2928037797 Variovorax sp. 1126 Isolate Unclassified
46 2928044640 Variovorax sp. 1128 Isolate Unclassified
47 2928051484 Variovorax sp. 1133 Isolate Unclassified
48 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
49 2928070936 Variovorax gossypii 1167 Isolate Unclassified
50 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
51 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
52 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
53 2929520902 Variovorax beijingensis 502 Isolate Unclassified
54 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
55 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
56 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
57 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
58 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
59 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
60 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
61 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
62 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
63 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
64 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
65 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
66 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
67 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
68 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
69 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
70 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
71 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
72 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
73 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
74 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
75 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
76 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
77 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
78 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
79 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
80 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
81 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
82 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
83 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
84 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
85 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
86 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
87 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
88 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
89 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
90 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
91 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
92 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
93 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
94 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
95 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
96 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
97 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
98 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
99 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
100 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
101 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
102 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
103 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
104 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
105 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
106 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
107 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
108 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
109 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
110 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
111 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
112 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
113 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
114 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
115 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
116 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
117 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
118 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
119 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
120 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
121 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
122 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
123 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
124 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
125 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
126 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
127 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
128 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
129 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
130 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
131 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
132 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
133 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
134 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
135 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
136 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
137 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
138 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
139 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
140 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
141 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
142 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
143 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
144 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
145 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
146 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
147 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
148 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
149 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
150 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
151 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
152 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
153 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
154 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
155 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
156 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
157 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
158 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
159 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
160 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
161 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
162 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
163 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
164 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
165 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
166 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
167 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
168 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
169 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
170 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
171 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
172 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
173 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
174 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
175 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
176 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
177 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
178 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
179 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
180 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
181 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
182 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
183 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
184 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
185 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
186 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
187 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
188 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
189 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
190 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
191 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
192 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
193 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
194 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
195 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
196 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
197 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
198 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
199 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
200 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
201 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
202 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
203 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
204 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
205 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
206 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
207 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
208 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
209 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
214 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
215 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
216 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
219 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
220 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
222 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
223 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
226 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
227 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
228 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
230 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
231 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
293 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
296 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
298 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
302 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
303 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
304 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
305 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
306 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
307 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
308 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
309 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
310 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
311 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
312 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
313 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
314 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
315 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
316 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
317 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
318 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
319 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
320 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
321 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
322 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
323 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
324 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
325 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
326 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
327 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
328 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
329 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
330 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
331 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
332 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
333 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
334 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
335 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
336 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
337 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
338 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
339 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
340 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
341 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
342 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
343 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
344 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
345 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
346 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
347 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
348 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
349 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
350 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
351 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
352 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
353 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
354 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
355 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
356 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
357 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
358 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
359 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
360 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
361 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
362 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
363 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
364 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
365 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
366 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
367 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
368 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
369 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
370 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
371 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
372 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
373 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
374 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
375 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
376 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
377 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
378 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
379 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
380 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
381 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
382 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
383 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
384 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
385 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
386 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
387 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
388 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
389 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
390 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
391 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
392 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
393 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
394 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
395 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
396 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
397 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
398 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
399 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
400 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
401 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
402 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
403 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
404 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
405 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
406 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
407 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
408 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
409 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
410 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
411 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
412 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
413 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
414 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
415 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
416 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
417 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
418 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
419 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
420 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
421 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
422 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
423 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
424 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
425 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
426 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
427 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
428 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
429 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
430 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
431 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
432 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
433 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
434 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
435 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
436 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
437 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
438 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
439 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
440 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
441 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
442 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
443 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
444 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
445 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
446 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
447 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
448 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
449 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
450 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
451 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
452 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
453 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
454 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
455 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
456 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
457 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
458 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
459 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
460 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
461 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
462 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
463 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
464 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
465 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
466 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
467 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
468 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
469 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
470 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
471 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
472 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
473 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
474 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
475 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
476 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
477 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
478 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
479 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
480 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
481 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
482 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
483 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
484 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
485 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
486 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
487 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
488 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
489 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
490 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
491 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
492 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
493 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
494 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
495 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
496 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
497 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
498 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
499 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
500 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
501 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
502 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
503 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
504 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
505 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
506 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
507 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
508 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
509 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
510 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
511 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
512 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
513 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
514 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
515 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
516 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
517 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
518 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
519 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
520 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
521 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
522 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
523 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
524 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
525 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
526 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
527 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
528 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
529 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
530 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
531 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
532 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
533 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
534 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
535 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
536 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
537 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
538 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
539 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
540 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
541 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
542 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
543 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
544 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
545 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
546 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
547 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
548 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
549 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
550 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
551 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
552 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
553 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
554 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
555 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
556 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
557 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
558 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
559 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
560 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
561 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
562 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
563 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
564 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
565 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
566 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
567 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
568 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
569 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
570 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
571 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
572 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
573 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
574 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
575 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
576 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
577 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
578 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
579 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
580 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
581 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
582 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
583 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
584 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
585 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
586 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
587 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
588 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
589 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
590 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
591 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
592 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
593 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
594 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
595 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
596 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
597 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
598 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
599 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
600 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
601 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
602 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.77
Metatranscriptomes 0
Isolates 3.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.41
Nodule 0.1
Rhizoplane 3.08
Rhizosphere 66.68
Stem 0
Stem Tuber 0
Unclassified 8.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10014352 3300001979 Bacteria 2924
2 JGI24739J22299_10005780 3300001989 Bacteria 4687
3 JGI25155J39150_1000062 3300002704 Bacteria 70719
4 JGI25156J39149_1000012 3300002705 Bacteria 194393
5 JGI25154J39366_1000029 3300002738 Bacteria 194393
6 JGI25154J39366_1000278 3300002738 Bacteria 31200
7 JGI25158J39367_1004986 3300002739 Bacteria 1962
8 JGI25157J39369_1000014 3300002741 Bacteria 194393
9 JGI25152J39213_1001366 3300002773 Bacteria 10658
10 JGI25152J39213_1006035 3300002773 Bacteria 3387
11 JGI25150J39212_1000869 3300002774 Bacteria 10019
12 JGI25150J39212_1014431 3300002774 Bacteria 1342
13 JGI25159J45721_1000054 3300002987 Bacteria 56576
14 JGI25159J45721_1005152 3300002987 Bacteria 4144
15 JGI25151J46595_10000507 3300003187 Bacteria 36540
16 JGI25151J46595_10002599 3300003187 Bacteria 10658
17 JGI25151J46595_10002870 3300003187 Bacteria 9904
18 JGI25151J46595_10004424 3300003187 Bacteria 7439
19 JGI25151J46595_10006031 3300003187 Bacteria 6171
20 JGI25151J46595_10006574 3300003187 Bacteria 5823
21 JGI25153J46596_10002045 3300003215 Bacteria 11890
22 rootL2_10020233 3300003322 Bacteria 2342
23 rootL2_10167114 3300003322 Bacteria 1191
24 rootH1_10030289 3300003316 Bacteria 4911
25 rootH1_10030289 3300003323 Bacteria 1135
26 JGI25160J50197_1000088 3300003354 Bacteria 93050
27 JGI25160J50197_1000119 3300003354 Bacteria 71366
28 JGI25160J50197_1001065 3300003354 Bacteria 14091
29 JGI25160J50197_1005159 3300003354 Bacteria 5484
30 JGI25160J50197_1037137 3300003354 Bacteria 1171
31 JGI25161J50226_1000056 3300003374 Bacteria 103097
32 JGI25161J50226_1003182 3300003374 Bacteria 3871
33 Ga0055532_1013650 3300003758 Bacteria 923
34 Ga0055525_1000001 3300003759 Bacteria 1016948
35 Ga0055535_1000286 3300003761 Bacteria 53400
36 Ga0055535_1001184 3300003761 Bacteria 15063
37 Ga0055542_1000080 3300003762 Bacteria 129634
38 Ga0055542_1001176 3300003762 Bacteria 15063
39 Ga0055526_1006187 3300003771 Bacteria 6585
40 Ga0055526_1011254 3300003771 Bacteria 4054
41 Ga0055526_1024874 3300003771 Bacteria 1941
42 Ga0055526_1024934 3300003771 Bacteria 1936
43 Ga0055537_1000024 3300003773 Bacteria 111410
44 Ga0055537_1000047 3300003773 Bacteria 88000
45 Ga0055537_1001263 3300003773 Bacteria 10568
46 Ga0055537_1006648 3300003773 Bacteria 2901
47 Ga0055537_1007290 3300003773 Bacteria 2682
48 Ga0055524_1000039 3300003775 Bacteria 159897
49 Ga0055524_1008821 3300003775 Bacteria 4155
50 Ga0055524_1009148 3300003775 Bacteria 4054
51 Ga0055536_1002675 3300003781 Bacteria 9889
52 Ga0055536_1009284 3300003781 Bacteria 4091
53 Ga0055536_1009897 3300003781 Bacteria 3871
54 Ga0055536_1028754 3300003781 Bacteria 1509
55 Ga0055534_1000032 3300003784 Bacteria 118890
56 Ga0055534_1000141 3300003784 Bacteria 53818
57 Ga0055534_1001229 3300003784 Bacteria 10658
58 Ga0055534_1002784 3300003784 Bacteria 5844
59 Ga0055534_1038206 3300003784 Bacteria 715
60 Ga0055528_1002122 3300003790 Bacteria 10944
61 Ga0055528_1002521 3300003790 Bacteria 9752
62 Ga0055528_1002981 3300003790 Bacteria 8769
63 Ga0055528_1009497 3300003790 Bacteria 4054
64 Ga0055530_10000532 3300003791 Bacteria 33030
65 Ga0055530_10002093 3300003791 Bacteria 13335
66 Ga0055530_10004782 3300003791 Bacteria 6802
67 Ga0055530_10022158 3300003791 Bacteria 1855
68 Ga0055530_10024142 3300003791 Bacteria 1731
69 Ga0055530_10053041 3300003791 Bacteria 933
70 Ga0055540_1000047 3300003792 Bacteria 146914
71 Ga0055540_1000365 3300003792 Bacteria 38078
72 Ga0055540_1000440 3300003792 Bacteria 32622
73 Ga0055540_1002293 3300003792 Bacteria 10309
74 Ga0055540_1008010 3300003792 Bacteria 3871
75 Ga0055531_10000454 3300003794 Bacteria 38078
76 Ga0055531_10011051 3300003794 Bacteria 4407
77 Ga0055531_10012021 3300003794 Bacteria 4111
78 Ga0055531_10012911 3300003794 Bacteria 3891
79 Ga0055531_10057654 3300003794 Bacteria 972
80 Ga0055543_1000904 3300004625 Bacteria 13924
81 Ga0055543_1001077 3300004625 Bacteria 11969
82 Ga0055543_1001260 3300004625 Bacteria 10446
83 Ga0065165_1003589 3300005262 Bacteria 10696
84 Ga0065165_1005321 3300005262 Bacteria 7314
85 Ga0065165_1023989 3300005262 Bacteria 2058
86 Ga0065165_1024242 3300005262 Bacteria 2041
87 Ga0065165_1081429 3300005262 Bacteria 840
88 Ga0065714_10066369 3300005288 Bacteria 6992
89 Ga0065715_10244020 3300005293 Bacteria 1189
90 Ga0065707_10087747 3300005295 Bacteria 4904
91 Ga0070658_10125538 3300005327 Bacteria 2135
92 Ga0070658_10176893 3300005327 Bacteria 1795
93 Ga0070676_10004494 3300005328 Bacteria 7341
94 Ga0070676_10032895 3300005328 Bacteria 2973
95 Ga0070676_10203602 3300005328 Bacteria 1299
96 Ga0070676_10285396 3300005328 Bacteria 1114
97 Ga0070683_100131089 3300005329 Bacteria 2372
98 Ga0070683_100154993 3300005329 Bacteria 2172
99 Ga0070690_100037460 3300005330 Bacteria 3056
100 Ga0070690_100165870 3300005330 Bacteria 1517
101 Ga0070690_101040912 3300005330 Bacteria 647
102 Ga0070670_100031372 3300005331 Bacteria 4576
103 Ga0070670_100097851 3300005331 Bacteria 2524
104 Ga0070670_100398756 3300005331 Bacteria 1214
105 Ga0070670_100427560 3300005331 Bacteria 1171
106 Ga0070670_100483723 3300005331 Bacteria 1099
107 Ga0070670_100773935 3300005331 Bacteria 866
108 Ga0070670_101137033 3300005331 Bacteria 713
109 Ga0070677_10020521 3300005333 Bacteria 2408
110 Ga0070677_10096467 3300005333 Bacteria 1295
111 Ga0070677_10284039 3300005333 Bacteria 835
112 Ga0070677_10352729 3300005333 Bacteria 763
113 Ga0068869_100000109 3300005334 Bacteria 39248
114 Ga0068869_100011409 3300005334 Bacteria 5827
115 Ga0068869_100061469 3300005334 Bacteria 2755
116 Ga0068869_100118296 3300005334 Bacteria 2023
117 Ga0068869_100322628 3300005334 Bacteria 1253
118 Ga0068869_100600166 3300005334 Bacteria 930
119 Ga0068869_101125485 3300005334 Bacteria 688
120 Ga0070666_10006231 3300005335 Bacteria 7339
121 Ga0070666_10009271 3300005335 Bacteria 6133
122 Ga0070666_10146619 3300005335 Bacteria 1645
123 Ga0070666_10772301 3300005335 Bacteria 707
124 Ga0070680_100063118 3300005336 Bacteria 3034
125 Ga0070682_100473027 3300005337 Bacteria 965
126 Ga0068868_100000928 3300005338 Bacteria 19961
127 Ga0068868_100002606 3300005338 Bacteria 12501
128 Ga0068868_100009104 3300005338 Bacteria 7128
129 Ga0068868_100043506 3300005338 Bacteria 3508
130 Ga0068868_100068559 3300005338 Bacteria 2825
131 Ga0068868_100094776 3300005338 Bacteria 2408
132 Ga0068868_100327397 3300005338 Bacteria 1307
133 Ga0068868_100618047 3300005338 Bacteria 962
134 Ga0068868_101543346 3300005338 Bacteria 623
135 Ga0070660_100102495 3300005339 Bacteria 2269
136 Ga0070660_100113595 3300005339 Bacteria 2157
137 Ga0070660_101555058 3300005339 Bacteria 563
138 Ga0070687_100121070 3300005343 Bacteria 1497
139 Ga0070661_100071384 3300005344 Bacteria 2555
140 Ga0070661_100098854 3300005344 Bacteria 2167
141 Ga0070661_100098982 3300005344 Bacteria 2166
142 Ga0070661_100760848 3300005344 Bacteria 793
143 Ga0070692_10314546 3300005345 Bacteria 961
144 Ga0070692_10769411 3300005345 Bacteria 655
145 Ga0070668_100005748 3300005347 Bacteria 9200
146 Ga0070668_100493696 3300005347 Bacteria 1059
147 Ga0070668_100612524 3300005347 Bacteria 954
148 Ga0070669_100003867 3300005353 Bacteria 10823
149 Ga0070669_100032291 3300005353 Bacteria 3782
150 Ga0070669_100096210 3300005353 Bacteria 2228
151 Ga0070669_100206889 3300005353 Bacteria 1546
152 Ga0070669_100516365 3300005353 Bacteria 992
153 Ga0070669_101115792 3300005353 Bacteria 679
154 Ga0070675_100000772 3300005354 Bacteria 22339
155 Ga0070675_100018873 3300005354 Bacteria 5491
156 Ga0070675_100038290 3300005354 Bacteria 3907
157 Ga0070675_100145426 3300005354 Bacteria 2029
158 Ga0070675_100224640 3300005354 Bacteria 1636
159 Ga0070675_100348796 3300005354 Bacteria 1312
160 Ga0070675_100485372 3300005354 Bacteria 1112
161 Ga0070671_100006491 3300005355 Bacteria 9355
162 Ga0070671_100011811 3300005355 Bacteria 7026
163 Ga0070671_100030752 3300005355 Bacteria 4431
164 Ga0070671_100127377 3300005355 Bacteria 2144
165 Ga0070671_100249854 3300005355 Bacteria 1506
166 Ga0070671_100411541 3300005355 Bacteria 1157
167 Ga0070671_100422072 3300005355 Bacteria 1142
168 Ga0070674_100014173 3300005356 Bacteria 4949
169 Ga0070674_100146038 3300005356 Bacteria 1780
170 Ga0070673_100007669 3300005364 Bacteria 7138
171 Ga0070673_100077501 3300005364 Bacteria 2686
172 Ga0070673_100086947 3300005364 Bacteria 2547
173 Ga0070673_100129628 3300005364 Bacteria 2114
174 Ga0070673_100229881 3300005364 Bacteria 1609
175 Ga0070673_100316352 3300005364 Bacteria 1378
176 Ga0070673_100434024 3300005364 Bacteria 1179
177 Ga0070673_100496870 3300005364 Bacteria 1103
178 Ga0070673_100653681 3300005364 Bacteria 962
179 Ga0070673_100825658 3300005364 Bacteria 857
180 Ga0070673_100853490 3300005364 Bacteria 843
181 Ga0070673_100926170 3300005364 Bacteria 809
182 Ga0070673_101190219 3300005364 Bacteria 714
183 Ga0070688_100026856 3300005365 Bacteria 3425
184 Ga0070659_100015164 3300005366 Bacteria 5765
185 Ga0070659_100114676 3300005366 Bacteria 2177
186 Ga0070659_100198344 3300005366 Bacteria 1651
187 Ga0070659_101053265 3300005366 Bacteria 716
188 Ga0070667_100005806 3300005367 Bacteria 10301
189 Ga0070667_100007096 3300005367 Bacteria 9313
190 Ga0070667_100064974 3300005367 Bacteria 3097
191 Ga0070667_100125372 3300005367 Bacteria 2237
192 Ga0070667_100188883 3300005367 Bacteria 1824
193 Ga0070667_100484550 3300005367 Bacteria 1132
194 Ga0070667_100999049 3300005367 Bacteria 781
195 Ga0070667_101222092 3300005367 Bacteria 703
196 Ga0070701_10383946 3300005438 Bacteria 886
197 Ga0070708_100135616 3300005445 Bacteria 2280
198 Ga0070663_100003925 3300005455 Bacteria 8673
199 Ga0070663_100313932 3300005455 Bacteria 1258
200 Ga0070663_100371878 3300005455 Bacteria 1162
201 Ga0070678_100004609 3300005456 Bacteria 7833
202 Ga0070678_100035270 3300005456 Bacteria 3491
203 Ga0070678_100420817 3300005456 Bacteria 1164
204 Ga0070678_101010441 3300005456 Bacteria 765
205 Ga0070662_100000552 3300005457 Bacteria 22694
206 Ga0070662_100003920 3300005457 Bacteria 9330
207 Ga0070662_100032880 3300005457 Bacteria 3649
208 Ga0070662_100160037 3300005457 Bacteria 1760
209 Ga0070662_100452663 3300005457 Bacteria 1066
210 Ga0070662_100587568 3300005457 Bacteria 936
211 Ga0068867_100000186 3300005459 Bacteria 41001
212 Ga0068867_100005611 3300005459 Bacteria 8890
213 Ga0068867_100033298 3300005459 Bacteria 3731
214 Ga0068867_100064019 3300005459 Bacteria 2733
215 Ga0068867_100259388 3300005459 Bacteria 1416
216 Ga0068867_100279964 3300005459 Bacteria 1367
217 Ga0068867_100316881 3300005459 Bacteria 1291
218 Ga0068867_100459729 3300005459 Bacteria 1086
219 Ga0068867_100633974 3300005459 Bacteria 936
220 Ga0068867_100832172 3300005459 Bacteria 826
221 Ga0068867_100867902 3300005459 Bacteria 810
222 Ga0068867_100928701 3300005459 Bacteria 785
223 Ga0068867_101856499 3300005459 Bacteria 567
224 Ga0070685_10147935 3300005466 Bacteria 1486
225 Ga0070706_100017115 3300005467 Bacteria 6699
226 Ga0070706_100960143 3300005467 Bacteria 789
227 Ga0070706_101871002 3300005467 Bacteria 545
228 Ga0070707_100064439 3300005468 Bacteria 3519
229 Ga0070707_100154296 3300005468 Bacteria 2237
230 Ga0070699_100116427 3300005518 Bacteria 2349
231 Ga0070679_100003825 3300005530 Bacteria 13821
232 Ga0070684_100023555 3300005535 Bacteria 5153
233 Ga0070684_100248441 3300005535 Bacteria 1626
234 Ga0068853_100011884 3300005539 Bacteria 7080
235 Ga0068853_100059570 3300005539 Bacteria 3299
236 Ga0068853_100189341 3300005539 Bacteria 1869
237 Ga0068853_100437457 3300005539 Bacteria 1229
238 Ga0068853_100898155 3300005539 Bacteria 851
239 Ga0068853_101606701 3300005539 Bacteria 630
240 Ga0070672_100010739 3300005543 Bacteria 6363
241 Ga0070672_100016252 3300005543 Bacteria 5324
242 Ga0070672_100027229 3300005543 Bacteria 4262
243 Ga0070672_100055551 3300005543 Bacteria 3102
244 Ga0070672_100164157 3300005543 Bacteria 1844
245 Ga0070672_100228801 3300005543 Bacteria 1562
246 Ga0070672_100245988 3300005543 Bacteria 1505
247 Ga0070672_100369800 3300005543 Bacteria 1225
248 Ga0070672_100389330 3300005543 Bacteria 1193
249 Ga0070672_100739793 3300005543 Bacteria 863
250 Ga0070672_101241462 3300005543 Bacteria 664
251 Ga0070693_100763512 3300005547 Bacteria 713
252 Ga0070665_100043405 3300005548 Bacteria 4519
253 Ga0070665_100144705 3300005548 Bacteria 2380
254 Ga0070665_100278353 3300005548 Bacteria 1675
255 Ga0070665_100509410 3300005548 Bacteria 1215
256 Ga0070665_100668795 3300005548 Bacteria 1051
257 Ga0068855_100015116 3300005563 Bacteria 9294
258 Ga0068855_100047998 3300005563 Bacteria 5041
259 Ga0068855_100173929 3300005563 Bacteria 2437
260 Ga0070664_100006998 3300005564 Bacteria 9096
261 Ga0070664_100116860 3300005564 Bacteria 2332
262 Ga0070664_100211556 3300005564 Bacteria 1733
263 Ga0070664_100219576 3300005564 Bacteria 1700
264 Ga0070664_100325032 3300005564 Bacteria 1394
265 Ga0070664_100769040 3300005564 Bacteria 899
266 Ga0070664_101313837 3300005564 Bacteria 683
267 Ga0068857_100053902 3300005577 Bacteria 3567
268 Ga0068857_100134323 3300005577 Bacteria 2233
269 Ga0068857_100162697 3300005577 Bacteria 2025
270 Ga0068857_100298227 3300005577 Bacteria 1485
271 Ga0068857_101269641 3300005577 Bacteria 714
272 Ga0068854_100048398 3300005578 Bacteria 3033
273 Ga0068854_100084591 3300005578 Bacteria 2348
274 Ga0068854_100120987 3300005578 Bacteria 1987
275 Ga0068854_100694332 3300005578 Bacteria 878
276 Ga0068854_100841142 3300005578 Bacteria 803
277 Ga0068854_100935849 3300005578 Bacteria 763
278 Ga0068856_100069854 3300005614 Bacteria 3473
279 Ga0068856_100139123 3300005614 Bacteria 2434
280 Ga0068856_100226628 3300005614 Bacteria 1884
281 Ga0068856_101093590 3300005614 Bacteria 815
282 Ga0070702_100026507 3300005615 Bacteria 3115
283 Ga0068852_100012691 3300005616 Bacteria 6410
284 Ga0068852_100014348 3300005616 Bacteria 6095
285 Ga0068852_100018466 3300005616 Bacteria 5495
286 Ga0068852_100097562 3300005616 Bacteria 2644
287 Ga0068852_100227802 3300005616 Bacteria 1775
288 Ga0068852_100250838 3300005616 Bacteria 1696
289 Ga0068852_100274059 3300005616 Bacteria 1624
290 Ga0068852_100517269 3300005616 Bacteria 1190
291 Ga0068852_100913899 3300005616 Bacteria 895
292 Ga0068852_100919057 3300005616 Bacteria 892
293 Ga0068859_100141793 3300005617 Bacteria 2477
294 Ga0068859_100260379 3300005617 Bacteria 1826
295 Ga0068859_100306399 3300005617 Bacteria 1682
296 Ga0068859_100870067 3300005617 Bacteria 987
297 Ga0068864_100000270 3300005618 Bacteria 46170
298 Ga0068864_100010659 3300005618 Bacteria 7598
299 Ga0068864_100053816 3300005618 Bacteria 3473
300 Ga0068864_100065725 3300005618 Bacteria 3146
301 Ga0068864_100207736 3300005618 Bacteria 1801
302 Ga0068864_100837819 3300005618 Bacteria 905
303 Ga0068866_10001571 3300005718 Bacteria 9705
304 Ga0068866_10148194 3300005718 Bacteria 1356
305 Ga0068866_10554989 3300005718 Bacteria 769
306 Ga0068861_100000126 3300005719 Bacteria 39277
307 Ga0068861_100006858 3300005719 Bacteria 7777
308 Ga0068861_100802485 3300005719 Bacteria 883
309 Ga0068851_10012812 3300005834 Bacteria 3960
310 Ga0068851_10019913 3300005834 Bacteria 3244
311 Ga0068851_10072851 3300005834 Bacteria 1781
312 Ga0068851_10090524 3300005834 Bacteria 1610
313 Ga0068851_10325795 3300005834 Bacteria 889
314 Ga0068870_10115031 3300005840 Bacteria 1541
315 Ga0068870_10212735 3300005840 Bacteria 1179
316 Ga0068863_100000679 3300005841 Bacteria 34412
317 Ga0068863_100022577 3300005841 Bacteria 6009
318 Ga0068863_100136576 3300005841 Bacteria 2343
319 Ga0068863_100227727 3300005841 Bacteria 1797
320 Ga0068863_100259471 3300005841 Bacteria 1680
321 Ga0068863_100366894 3300005841 Bacteria 1404
322 Ga0068863_101408982 3300005841 Bacteria 705
323 Ga0068858_100000225 3300005842 Bacteria 61439
324 Ga0068858_100006184 3300005842 Bacteria 11677
325 Ga0068858_100011807 3300005842 Bacteria 8238
326 Ga0068860_100010530 3300005843 Bacteria 9137
327 Ga0068860_100025113 3300005843 Bacteria 5750
328 Ga0068860_100071695 3300005843 Bacteria 3291
329 Ga0068860_100224709 3300005843 Bacteria 1823
330 Ga0068860_100372691 3300005843 Bacteria 1408
331 Ga0068860_100678258 3300005843 Bacteria 1039
332 Ga0068862_100091077 3300005844 Bacteria 2655
333 Ga0068862_100215452 3300005844 Bacteria 1737
334 Ga0068862_100274253 3300005844 Bacteria 1544
335 Ga0068862_100921771 3300005844 Bacteria 860
336 Ga0070717_11108428 3300006028 Bacteria 721
337 Ga0075365_10040246 3300006038 Bacteria 3047
338 Ga0075368_10019359 3300006042 Bacteria 2569
339 Ga0075363_100002613 3300006048 Bacteria 7422
340 Ga0075363_100098285 3300006048 Bacteria 1618
341 Ga0075363_100100513 3300006048 Bacteria 1600
342 Ga0075363_100173312 3300006048 Bacteria 1225
343 Ga0075363_100282609 3300006048 Bacteria 960
344 Ga0075363_100397393 3300006048 Bacteria 810
345 Ga0075364_10154827 3300006051 Bacteria 1546
346 Ga0075432_10028831 3300006058 Bacteria 1916
347 Ga0075432_10186761 3300006058 Bacteria 814
348 Ga0070716_100528969 3300006173 Bacteria 875
349 Ga0075362_10006845 3300006177 Bacteria 4270
350 Ga0075362_10012721 3300006177 Bacteria 3349
351 Ga0075362_10027255 3300006177 Bacteria 2445
352 Ga0075362_10027795 3300006177 Bacteria 2424
353 Ga0075362_10036217 3300006177 Bacteria 2157
354 Ga0075362_10075832 3300006177 Bacteria 1543
355 Ga0075362_10078719 3300006177 Bacteria 1517
356 Ga0075362_10101318 3300006177 Bacteria 1347
357 Ga0075362_10265553 3300006177 Bacteria 846
358 Ga0075362_10268680 3300006177 Bacteria 842
359 Ga0075362_10462436 3300006177 Bacteria 645
360 Ga0075362_10620995 3300006177 Bacteria 560
361 Ga0075367_10003489 3300006178 Bacteria 7504
362 Ga0075367_10023278 3300006178 Bacteria 3483
363 Ga0075367_10065241 3300006178 Bacteria 2180
364 Ga0075367_10086899 3300006178 Bacteria 1898
365 Ga0075367_10485085 3300006178 Bacteria 784
366 Ga0075369_10028290 3300006186 Bacteria 2349
367 Ga0075369_10053864 3300006186 Bacteria 1746
368 Ga0075369_10127102 3300006186 Bacteria 1156
369 Ga0075366_10000903 3300006195 Bacteria 14366
370 Ga0075366_10004367 3300006195 Bacteria 7582
371 Ga0075366_10005063 3300006195 Bacteria 7126
372 Ga0075366_10005254 3300006195 Bacteria 7012
373 Ga0075366_10020888 3300006195 Bacteria 3803
374 Ga0075366_10024928 3300006195 Bacteria 3490
375 Ga0075366_10063986 3300006195 Bacteria 2187
376 Ga0075366_10076436 3300006195 Bacteria 1998
377 Ga0075366_10088553 3300006195 Bacteria 1854
378 Ga0075366_10089581 3300006195 Bacteria 1843
379 Ga0075366_10103288 3300006195 Bacteria 1711
380 Ga0075366_10108492 3300006195 Bacteria 1669
381 Ga0075366_10177989 3300006195 Bacteria 1291
382 Ga0075366_10205769 3300006195 Bacteria 1197
383 Ga0075366_10209479 3300006195 Bacteria 1186
384 Ga0075366_10233960 3300006195 Bacteria 1120
385 Ga0075366_10310856 3300006195 Bacteria 965
386 Ga0075366_10341979 3300006195 Bacteria 918
387 Ga0075366_10408676 3300006195 Bacteria 836
388 Ga0075366_10553356 3300006195 Bacteria 712
389 Ga0075366_10562262 3300006195 Bacteria 706
390 Ga0075366_10938001 3300006195 Bacteria 539
391 Ga0075366_10968446 3300006195 Bacteria 530
392 Ga0097621_100060271 3300006237 Bacteria 3110
393 Ga0097621_100178814 3300006237 Bacteria 1832
394 Ga0097621_100226196 3300006237 Bacteria 1632
395 Ga0097621_100321941 3300006237 Bacteria 1370
396 Ga0097621_100417698 3300006237 Bacteria 1203
397 Ga0097621_100423384 3300006237 Bacteria 1195
398 Ga0075370_10001385 3300006353 Bacteria 10451
399 Ga0075370_10003497 3300006353 Bacteria 7487
400 Ga0075370_10006662 3300006353 Bacteria 5826
401 Ga0075370_10008356 3300006353 Bacteria 5324
402 Ga0075370_10009388 3300006353 Bacteria 5076
403 Ga0075370_10011977 3300006353 Bacteria 4570
404 Ga0075370_10021716 3300006353 Bacteria 3517
405 Ga0075370_10041399 3300006353 Bacteria 2601
406 Ga0075370_10072521 3300006353 Bacteria 1971
407 Ga0075370_10079534 3300006353 Bacteria 1883
408 Ga0075370_10159946 3300006353 Bacteria 1321
409 Ga0075370_10169808 3300006353 Bacteria 1282
410 Ga0075370_10221285 3300006353 Bacteria 1119
411 Ga0075370_10264415 3300006353 Bacteria 1021
412 Ga0075370_10393622 3300006353 Bacteria 831
413 Ga0075370_10518841 3300006353 Bacteria 720
414 Ga0068871_100026429 3300006358 Bacteria 4529
415 Ga0068871_100044440 3300006358 Bacteria 3573
416 Ga0068871_100060141 3300006358 Bacteria 3098
417 Ga0068871_100186123 3300006358 Bacteria 1787
418 Ga0068871_100412930 3300006358 Bacteria 1204
419 Ga0068871_100705121 3300006358 Bacteria 925
420 Ga0068871_100816192 3300006358 Bacteria 860
421 Ga0075430_100464806 3300006846 Bacteria 1044
422 Ga0075430_100742798 3300006846 Bacteria 809
423 Ga0075434_100258587 3300006871 Bacteria 1760
424 Ga0068865_100031632 3300006881 Bacteria 3529
425 Ga0068865_100242195 3300006881 Bacteria 1420
426 Ga0068865_100360419 3300006881 Bacteria 1180
427 Ga0068865_100717727 3300006881 Bacteria 856
428 Ga0097620_100141795 3300006931 Bacteria 2477
429 Ga0097620_100260380 3300006931 Bacteria 1826
430 Ga0097620_100306401 3300006931 Bacteria 1682
431 Ga0097620_100870165 3300006931 Bacteria 987
432 Ga0075435_100684643 3300007076 Bacteria 891
433 Ga0105244_10002369 3300009036 Bacteria 14300
434 Ga0105244_10080538 3300009036 Bacteria 1613
435 Ga0105240_10044244 3300009093 Bacteria 5660
436 Ga0105240_10376389 3300009093 Bacteria 1604
437 Ga0105240_11666270 3300009093 Bacteria 666
438 Ga0111539_10496588 3300009094 Bacteria 1421
439 Ga0111539_11076507 3300009094 Bacteria 934
440 Ga0105245_10011498 3300009098 Bacteria 7709
441 Ga0105245_10044575 3300009098 Bacteria 3959
442 Ga0105245_10429981 3300009098 Bacteria 1325
443 Ga0105245_10478639 3300009098 Bacteria 1258
444 Ga0105245_10578857 3300009098 Bacteria 1147
445 Ga0105245_10587549 3300009098 Bacteria 1139
446 Ga0105245_11031379 3300009098 Bacteria 868
447 Ga0105247_10783640 3300009101 Bacteria 726
448 Ga0105243_10002142 3300009148 Bacteria 16689
449 Ga0105243_10002791 3300009148 Bacteria 14509
450 Ga0105243_10006295 3300009148 Bacteria 9173
451 Ga0105243_10066462 3300009148 Bacteria 2899
452 Ga0105243_10195426 3300009148 Bacteria 1770
453 Ga0105243_10211999 3300009148 Bacteria 1706
454 Ga0105243_10307811 3300009148 Bacteria 1438
455 Ga0105243_10529961 3300009148 Bacteria 1122
456 Ga0105243_10626920 3300009148 Bacteria 1039
457 Ga0105243_10824709 3300009148 Bacteria 916
458 Ga0105243_11023162 3300009148 Bacteria 830
459 Ga0105241_10207015 3300009174 Bacteria 1642
460 Ga0105241_10680647 3300009174 Bacteria 937
461 Ga0105241_11448252 3300009174 Bacteria 659
462 Ga0105242_10179763 3300009176 Bacteria 1866
463 Ga0105242_10785592 3300009176 Bacteria 941
464 Ga0105242_10798183 3300009176 Bacteria 934
465 Ga0105242_11464865 3300009176 Bacteria 712
466 Ga0105248_10020776 3300009177 Bacteria 7274
467 Ga0105248_10069162 3300009177 Bacteria 3964
468 Ga0105248_10103800 3300009177 Bacteria 3204
469 Ga0105248_10140104 3300009177 Bacteria 2728
470 Ga0105248_10223348 3300009177 Bacteria 2120
471 Ga0105248_10381645 3300009177 Bacteria 1587
472 Ga0105248_11065491 3300009177 Bacteria 913
473 Ga0105248_11365687 3300009177 Bacteria 802
474 Ga0105237_10038448 3300009545 Bacteria 4831
475 Ga0105237_10210367 3300009545 Bacteria 1945
476 Ga0105237_10211438 3300009545 Bacteria 1940
477 Ga0105237_10584019 3300009545 Bacteria 1124
478 Ga0105237_11719452 3300009545 Bacteria 635
479 Ga0105238_10007445 3300009551 Bacteria 10968
480 Ga0105238_10237419 3300009551 Bacteria 1800
481 Ga0105238_10554246 3300009551 Bacteria 1154
482 Ga0105238_10765782 3300009551 Bacteria 980
483 Ga0105238_12092877 3300009551 Bacteria 600
484 Ga0105249_10020223 3300009553 Bacteria 5950
485 Ga0105249_10255488 3300009553 Bacteria 1739
486 Ga0105249_10511243 3300009553 Bacteria 1247
487 Ga0105239_10008553 3300010375 Bacteria 11619
488 Ga0105239_10014688 3300010375 Bacteria 8684
489 Ga0105239_10178863 3300010375 Bacteria 2373
490 Ga0105239_11428694 3300010375 Bacteria 799
491 Ga0105239_11885533 3300010375 Bacteria 693
492 Ga0105246_10116212 3300011119 Bacteria 1974
493 Ga0105246_10261339 3300011119 Bacteria 1379
494 Ga0105246_11072474 3300011119 Bacteria 734
495 Ga0105246_11128730 3300011119 Bacteria 717
496 Ga0157347_1007959 3300012502 Bacteria 1069
497 Ga0157373_10000764 3300013100 Bacteria 24891
498 Ga0157373_10073883 3300013100 Bacteria 2406
499 Ga0157373_10289715 3300013100 Bacteria 1161
500 Ga0157371_10102848 3300013102 Bacteria 2027
501 Ga0157371_10524539 3300013102 Bacteria 876
502 Ga0157371_10891869 3300013102 Bacteria 674
503 Ga0157370_10005548 3300013104 Bacteria 14147
504 Ga0157370_10925268 3300013104 Bacteria 791
505 Ga0157374_10149927 3300013296 Bacteria 2267
506 Ga0157374_10576304 3300013296 Bacteria 1134
507 Ga0157374_11938732 3300013296 Bacteria 615
508 Ga0157378_10204597 3300013297 Bacteria 1869
509 Ga0157378_10702504 3300013297 Bacteria 1031
510 Ga0163162_10010080 3300013306 Bacteria 9185
511 Ga0163162_10077396 3300013306 Bacteria 3390
512 Ga0163162_10093880 3300013306 Bacteria 3086
513 Ga0163162_10203206 3300013306 Bacteria 2110
514 Ga0163162_10242856 3300013306 Bacteria 1932
515 Ga0163162_10909509 3300013306 Bacteria 993
516 Ga0157372_10024604 3300013307 Bacteria 6544
517 Ga0157372_10276250 3300013307 Bacteria 1953
518 Ga0157375_10010897 3300013308 Bacteria 8016
519 Ga0157375_10014628 3300013308 Bacteria 7009
520 Ga0157375_10051979 3300013308 Bacteria 4027
521 Ga0157375_10159166 3300013308 Bacteria 2399
522 Ga0157375_10277498 3300013308 Bacteria 1839
523 Ga0157375_10364097 3300013308 Bacteria 1612
524 Ga0157375_10404100 3300013308 Bacteria 1532
525 Ga0157375_10524196 3300013308 Bacteria 1348
526 Ga0157375_10626044 3300013308 Bacteria 1234
527 Ga0157375_10688444 3300013308 Bacteria 1176
528 Ga0163163_10004422 3300014325 Bacteria 11982
529 Ga0163163_10961423 3300014325 Bacteria 917
530 Ga0157380_10001564 3300014326 Bacteria 15067
531 Ga0157380_10016118 3300014326 Bacteria 5505
532 Ga0157380_10343089 3300014326 Bacteria 1394
533 Ga0157380_11397059 3300014326 Bacteria 750
534 Ga0182008_10000794 3300014497 Bacteria 22137
535 Ga0182008_10043908 3300014497 Bacteria 2224
536 Ga0182008_10053057 3300014497 Bacteria 2008
537 Ga0157377_10000464 3300014745 Bacteria 17471
538 Ga0157377_10074914 3300014745 Bacteria 1965
539 Ga0157377_10124000 3300014745 Bacteria 1569
540 Ga0157379_10005033 3300014968 Bacteria 11338
541 Ga0157379_10012124 3300014968 Bacteria 7527
542 Ga0157379_10040104 3300014968 Bacteria 4178
543 Ga0157379_10304460 3300014968 Bacteria 1453
544 Ga0157376_10001974 3300014969 Bacteria 13725
545 Ga0157376_10012956 3300014969 Bacteria 6209
546 Ga0157376_10787806 3300014969 Bacteria 962
547 Ga0157376_11260089 3300014969 Bacteria 769
548 Ga0157376_11488441 3300014969 Bacteria 710
549 Ga0157376_11808905 3300014969 Bacteria 647
550 Ga0182006_1000690 3300015261 Bacteria 23537
551 Ga0182007_10004716 3300015262 Bacteria 6133
552 Ga0182007_10006853 3300015262 Bacteria 4845
553 Ga0182007_10394058 3300015262 Bacteria 527
554 Ga0182005_1027614 3300015265 Bacteria 1547
555 Ga0182005_1082344 3300015265 Bacteria 889
556 Ga0183362_10002 3300015683 Bacteria 1432711
557 Ga0163161_10000161 3300017792 Bacteria 61815
558 Ga0163161_10016112 3300017792 Bacteria 5218
559 Ga0163161_10039405 3300017792 Bacteria 3392
560 Ga0163161_10067154 3300017792 Bacteria 2619
561 Ga0163161_10071647 3300017792 Bacteria 2536
562 Ga0163161_10341235 3300017792 Bacteria 1188
563 Ga0163161_10352220 3300017792 Bacteria 1171
564 Ga0163161_10851943 3300017792 Bacteria 769
565 Ga0213874_10130485 3300021377 Bacteria 862
566 Ga0213876_10101220 3300021384 Bacteria 1528
567 Ga0209435_100002 3300025206 Bacteria 794178
568 Ga0209436_103397 3300025208 Bacteria 4252
569 Ga0209436_106002 3300025208 Bacteria 2713
570 Ga0209672_100711 3300025228 Bacteria 16556
571 Ga0209672_101238 3300025228 Bacteria 10251
572 Ga0209147_100450 3300025229 Bacteria 25862
573 Ga0209147_103013 3300025229 Bacteria 3586
574 Ga0209563_100007 3300025230 Bacteria 1579402
575 Ga0209258_100093 3300025242 Bacteria 223559
576 Ga0209258_100519 3300025242 Bacteria 37071
577 Ga0207425_1001011 3300025245 Bacteria 13170
578 Ga0207425_1001306 3300025245 Bacteria 10745
579 Ga0207425_1004714 3300025245 Bacteria 4025
580 Ga0207425_1022335 3300025245 Bacteria 1334
581 Ga0207425_1023670 3300025245 Bacteria 1283
582 Ga0207425_1038846 3300025245 Bacteria 913
583 Ga0207425_1053424 3300025245 Bacteria 731
584 Ga0209646_1000001 3300025246 Bacteria 3092932
585 Ga0209646_1000023 3300025246 Bacteria 441100
586 Ga0209026_1000040 3300025250 Bacteria 277470
587 Ga0209026_1013794 3300025250 Bacteria 1365
588 Ga0209677_109163 3300025253 Bacteria 1812
589 Ga0209148_1000007 3300025254 Bacteria 1592273
590 Ga0209148_1000067 3300025254 Bacteria 338678
591 Ga0209148_1000440 3300025254 Bacteria 45707
592 Ga0209759_1000001 3300025256 Bacteria 2799452
593 Ga0209129_1000024 3300025258 Bacteria 417268
594 Ga0209129_1001645 3300025258 Bacteria 12118
595 Ga0209129_1008680 3300025258 Bacteria 2792
596 Ga0209129_1016572 3300025258 Bacteria 1474
597 Ga0209129_1017663 3300025258 Bacteria 1393
598 Ga0209129_1035134 3300025258 Bacteria 817
599 Ga0209565_1000039 3300025263 Bacteria 278026
600 Ga0209565_1000080 3300025263 Bacteria 156999
601 Ga0209565_1000583 3300025263 Bacteria 24687
602 Ga0209565_1000645 3300025263 Bacteria 22597
603 Ga0209565_1000876 3300025263 Bacteria 16569
604 Ga0209673_1000088 3300025273 Bacteria 204629
605 Ga0209673_1000284 3300025273 Bacteria 94932
606 Ga0209673_1001443 3300025273 Bacteria 22597
607 Ga0209673_1002254 3300025273 Bacteria 13894
608 Ga0209130_1000040 3300025284 Bacteria 262926
609 Ga0209130_1000346 3300025284 Bacteria 53329
610 Ga0209130_1000757 3300025284 Bacteria 28010
611 Ga0209130_1001429 3300025284 Bacteria 15870
612 Ga0209675_1000030 3300025291 Bacteria 278026
613 Ga0209675_1000133 3300025291 Bacteria 101207
614 Ga0209675_1000471 3300025291 Bacteria 30899
615 Ga0209675_1000695 3300025291 Bacteria 23368
616 Ga0209675_1001131 3300025291 Bacteria 16273
617 Ga0209675_1004254 3300025291 Bacteria 6449
618 Ga0209675_1020620 3300025291 Bacteria 1780
619 Ga0209676_1000028 3300025292 Bacteria 559745
620 Ga0209676_1000073 3300025292 Bacteria 305947
621 Ga0209676_1000142 3300025292 Bacteria 175752
622 Ga0209676_1000317 3300025292 Bacteria 94105
623 Ga0209676_1000383 3300025292 Bacteria 81259
624 Ga0209676_1013166 3300025292 Bacteria 3196
625 Ga0209676_1042675 3300025292 Bacteria 1257
626 Ga0209025_1000088 3300025294 Bacteria 255087
627 Ga0209025_1000104 3300025294 Bacteria 226895
628 Ga0209025_1001526 3300025294 Bacteria 29626
629 Ga0209025_1002084 3300025294 Bacteria 22602
630 Ga0209025_1004730 3300025294 Bacteria 11596
631 Ga0209025_1006776 3300025294 Bacteria 8785
632 Ga0209025_1011727 3300025294 Bacteria 5724
633 Ga0209025_1013516 3300025294 Bacteria 5123
634 Ga0209025_1040081 3300025294 Bacteria 2032
635 Ga0209025_1095901 3300025294 Bacteria 954
636 Ga0209025_1095980 3300025294 Bacteria 954
637 Ga0209564_1000313 3300025295 Bacteria 95224
638 Ga0209564_1000823 3300025295 Bacteria 42196
639 Ga0209564_1001505 3300025295 Bacteria 23368
640 Ga0209564_1002447 3300025295 Bacteria 14665
641 Ga0209564_1005212 3300025295 Bacteria 7521
642 Ga0209758_1000510 3300025297 Bacteria 62591
643 Ga0209758_1000679 3300025297 Bacteria 50729
644 Ga0209758_1003918 3300025297 Bacteria 12990
645 Ga0209758_1005216 3300025297 Bacteria 10191
646 Ga0209758_1050082 3300025297 Bacteria 1468
647 Ga0209050_1000008 3300025298 Bacteria 1144179
648 Ga0209050_1000072 3300025298 Bacteria 293619
649 Ga0209050_1000786 3300025298 Bacteria 45131
650 Ga0209050_1000952 3300025298 Bacteria 37637
651 Ga0209050_1001577 3300025298 Bacteria 23647
652 Ga0209050_1005629 3300025298 Bacteria 7769
653 Ga0209050_1015985 3300025298 Bacteria 3103
654 Ga0209050_1034091 3300025298 Bacteria 1531
655 Ga0209256_1000096 3300025299 Bacteria 204629
656 Ga0209256_1000151 3300025299 Bacteria 145299
657 Ga0209256_1000256 3300025299 Bacteria 94699
658 Ga0209256_1040804 3300025299 Bacteria 1183
659 Ga0209256_1056004 3300025299 Bacteria 934
660 Ga0207426_1000049 3300025302 Bacteria 401954
661 Ga0207426_1000188 3300025302 Bacteria 153510
662 Ga0207426_1000315 3300025302 Bacteria 94699
663 Ga0207426_1001354 3300025302 Bacteria 20775
664 Ga0209051_1000005 3300025303 Bacteria 1142353
665 Ga0209051_1000015 3300025303 Bacteria 546798
666 Ga0209051_1000056 3300025303 Bacteria 271616
667 Ga0209051_1000161 3300025303 Bacteria 125704
668 Ga0209051_1000259 3300025303 Bacteria 88311
669 Ga0209051_1000416 3300025303 Bacteria 58872
670 Ga0209051_1084184 3300025303 Bacteria 906
671 Ga0209051_1136246 3300025303 Bacteria 598
672 Ga0209257_1000031 3300025304 Bacteria 688770
673 Ga0209257_1000037 3300025304 Bacteria 612915
674 Ga0209257_1000116 3300025304 Bacteria 228733
675 Ga0209257_1002902 3300025304 Bacteria 15869
676 Ga0209257_1004513 3300025304 Bacteria 10710
677 Ga0209257_1022591 3300025304 Bacteria 2238
678 Ga0207697_10046109 3300025315 Bacteria 1794
679 Ga0207697_10070620 3300025315 Bacteria 1463
680 Ga0207656_10020678 3300025321 Bacteria 2619
681 Ga0207656_10027516 3300025321 Bacteria 2326
682 Ga0207656_10103921 3300025321 Bacteria 1305
683 Ga0207656_10234090 3300025321 Bacteria 896
684 Ga0207656_10328922 3300025321 Bacteria 760
685 Ga0207655_1015947 3300025728 Bacteria 4141
686 Ga0207682_10032758 3300025893 Bacteria 2089
687 Ga0207682_10044699 3300025893 Bacteria 1816
688 Ga0207682_10247434 3300025893 Bacteria 829
689 Ga0207642_10006015 3300025899 Bacteria 4005
690 Ga0207642_10024373 3300025899 Bacteria 2432
691 Ga0207688_10078411 3300025901 Bacteria 1883
692 Ga0207688_10188104 3300025901 Bacteria 1234
693 Ga0207688_10652489 3300025901 Bacteria 664
694 Ga0207680_10028766 3300025903 Bacteria 3113
695 Ga0207680_10191237 3300025903 Bacteria 1389
696 Ga0207647_10357268 3300025904 Bacteria 827
697 Ga0207645_10004614 3300025907 Bacteria 10153
698 Ga0207645_10041857 3300025907 Bacteria 2931
699 Ga0207645_10309051 3300025907 Bacteria 1053
700 Ga0207643_10009830 3300025908 Bacteria 5138
701 Ga0207643_10166620 3300025908 Bacteria 1328
702 Ga0207643_10252977 3300025908 Bacteria 1086
703 Ga0207705_10164082 3300025909 Bacteria 1670
704 Ga0207684_10119778 3300025910 Bacteria 2256
705 Ga0207654_10402338 3300025911 Bacteria 952
706 Ga0207695_10130175 3300025913 Bacteria 2474
707 Ga0207695_10145157 3300025913 Bacteria 2318
708 Ga0207671_10075823 3300025914 Bacteria 2516
709 Ga0207671_10219270 3300025914 Bacteria 1490
710 Ga0207671_10494572 3300025914 Bacteria 975
711 Ga0207660_10026081 3300025917 Bacteria 3976
712 Ga0207662_10013391 3300025918 Bacteria 4587
713 Ga0207662_10089116 3300025918 Bacteria 1895
714 Ga0207657_10038426 3300025919 Bacteria 4261
715 Ga0207657_10082664 3300025919 Bacteria 2696
716 Ga0207657_10308033 3300025919 Bacteria 1254
717 Ga0207657_10320421 3300025919 Bacteria 1226
718 Ga0207649_10314732 3300025920 Bacteria 1148
719 Ga0207649_10762319 3300025920 Bacteria 753
720 Ga0207649_10792593 3300025920 Bacteria 739
721 Ga0207652_10073735 3300025921 Bacteria 2970
722 Ga0207646_10015873 3300025922 Bacteria 7087
723 Ga0207681_10000826 3300025923 Bacteria 20436
724 Ga0207681_10008765 3300025923 Bacteria 6178
725 Ga0207681_10114005 3300025923 Bacteria 1971
726 Ga0207681_10243304 3300025923 Bacteria 1401
727 Ga0207694_10041437 3300025924 Bacteria 3548
728 Ga0207694_10111689 3300025924 Bacteria 2175
729 Ga0207694_10164283 3300025924 Bacteria 1795
730 Ga0207694_10603891 3300025924 Bacteria 923
731 Ga0207650_10120072 3300025925 Bacteria 2045
732 Ga0207650_10204515 3300025925 Bacteria 1583
733 Ga0207650_10224507 3300025925 Bacteria 1513
734 Ga0207650_10315573 3300025925 Bacteria 1279
735 Ga0207650_10512274 3300025925 Bacteria 1003
736 Ga0207650_10576954 3300025925 Bacteria 944
737 Ga0207659_10001869 3300025926 Bacteria 12468
738 Ga0207659_10029827 3300025926 Bacteria 3721
739 Ga0207659_10839328 3300025926 Bacteria 790
740 Ga0207659_11273276 3300025926 Bacteria 631
741 Ga0207687_10013703 3300025927 Bacteria 5293
742 Ga0207687_10056676 3300025927 Bacteria 2749
743 Ga0207687_10211834 3300025927 Bacteria 1521
744 Ga0207687_10421403 3300025927 Bacteria 1102
745 Ga0207644_10000223 3300025931 Bacteria 39200
746 Ga0207644_10008993 3300025931 Bacteria 6545
747 Ga0207644_10065196 3300025931 Bacteria 2648
748 Ga0207644_10070563 3300025931 Bacteria 2554
749 Ga0207644_10347830 3300025931 Bacteria 1203
750 Ga0207644_10382331 3300025931 Bacteria 1148
751 Ga0207644_10672504 3300025931 Bacteria 862
752 Ga0207690_10032585 3300025932 Bacteria 3345
753 Ga0207690_10456255 3300025932 Bacteria 1028
754 Ga0207690_10664135 3300025932 Bacteria 855
755 Ga0207706_10000736 3300025933 Bacteria 34115
756 Ga0207706_10012885 3300025933 Bacteria 7611
757 Ga0207706_10172590 3300025933 Bacteria 1900
758 Ga0207706_10379576 3300025933 Bacteria 1227
759 Ga0207706_10573407 3300025933 Bacteria 970
760 Ga0207706_10720062 3300025933 Bacteria 852
761 Ga0207706_10830020 3300025933 Bacteria 784
762 Ga0207706_10850399 3300025933 Bacteria 773
763 Ga0207686_10030421 3300025934 Bacteria 3196
764 Ga0207686_10088915 3300025934 Bacteria 2034
765 Ga0207686_10476777 3300025934 Bacteria 964
766 Ga0207709_10000771 3300025935 Bacteria 25177
767 Ga0207709_10001444 3300025935 Bacteria 16592
768 Ga0207709_10011940 3300025935 Bacteria 4789
769 Ga0207709_10012398 3300025935 Bacteria 4698
770 Ga0207709_10039692 3300025935 Bacteria 2813
771 Ga0207709_10076505 3300025935 Bacteria 2143
772 Ga0207709_10157185 3300025935 Bacteria 1582
773 Ga0207709_10616933 3300025935 Bacteria 860
774 Ga0207709_10650558 3300025935 Bacteria 839
775 Ga0207669_10002159 3300025937 Bacteria 8340
776 Ga0207669_10636871 3300025937 Bacteria 870
777 Ga0207669_11385823 3300025937 Bacteria 598
778 Ga0207704_10002371 3300025938 Bacteria 8463
779 Ga0207704_10205529 3300025938 Bacteria 1445
780 Ga0207704_10221663 3300025938 Bacteria 1400
781 Ga0207704_10262680 3300025938 Bacteria 1303
782 Ga0207704_10376209 3300025938 Bacteria 1113
783 Ga0207704_10404880 3300025938 Bacteria 1078
784 Ga0207665_10140128 3300025939 Bacteria 1724
785 Ga0207691_10002576 3300025940 Bacteria 17721
786 Ga0207691_10023739 3300025940 Bacteria 5773
787 Ga0207691_10075275 3300025940 Bacteria 3044
788 Ga0207691_10081432 3300025940 Bacteria 2910
789 Ga0207691_10087282 3300025940 Bacteria 2799
790 Ga0207691_10153924 3300025940 Bacteria 2020
791 Ga0207691_10337776 3300025940 Bacteria 1290
792 Ga0207691_10363434 3300025940 Bacteria 1237
793 Ga0207711_10002181 3300025941 Bacteria 17610
794 Ga0207711_10008423 3300025941 Bacteria 8624
795 Ga0207711_10093737 3300025941 Bacteria 2645
796 Ga0207711_10205036 3300025941 Bacteria 1800
797 Ga0207711_10501111 3300025941 Bacteria 1132
798 Ga0207711_10666528 3300025941 Bacteria 970
799 Ga0207689_10000259 3300025942 Bacteria 47474
800 Ga0207689_10006174 3300025942 Bacteria 10604
801 Ga0207689_10018504 3300025942 Bacteria 5877
802 Ga0207689_10120756 3300025942 Bacteria 2156
803 Ga0207689_10180386 3300025942 Bacteria 1741
804 Ga0207689_10202186 3300025942 Bacteria 1640
805 Ga0207689_10202319 3300025942 Bacteria 1639
806 Ga0207689_10269083 3300025942 Bacteria 1411
807 Ga0207689_10644972 3300025942 Bacteria 892
808 Ga0207689_10983709 3300025942 Bacteria 712
809 Ga0207661_10025802 3300025944 Bacteria 4471
810 Ga0207661_10151431 3300025944 Bacteria 2005
811 Ga0207679_10044865 3300025945 Bacteria 3193
812 Ga0207679_10134308 3300025945 Bacteria 1990
813 Ga0207679_10212816 3300025945 Bacteria 1622
814 Ga0207679_10548238 3300025945 Bacteria 1037
815 Ga0207679_11094158 3300025945 Bacteria 731
816 Ga0207667_10110625 3300025949 Bacteria 2834
817 Ga0207651_10005547 3300025960 Bacteria 6494
818 Ga0207651_10100796 3300025960 Bacteria 2141
819 Ga0207651_10128082 3300025960 Bacteria 1938
820 Ga0207651_10140033 3300025960 Bacteria 1867
821 Ga0207651_10184316 3300025960 Bacteria 1659
822 Ga0207651_10317868 3300025960 Bacteria 1300
823 Ga0207651_10330439 3300025960 Bacteria 1277
824 Ga0207651_10656942 3300025960 Bacteria 921
825 Ga0207651_11063547 3300025960 Bacteria 724
826 Ga0207712_10013171 3300025961 Bacteria 5301
827 Ga0207712_10375071 3300025961 Bacteria 1189
828 Ga0207712_10391396 3300025961 Bacteria 1166
829 Ga0207668_10030116 3300025972 Bacteria 3563
830 Ga0207668_10524630 3300025972 Bacteria 1022
831 Ga0207640_10072192 3300025981 Bacteria 2327
832 Ga0207640_11067399 3300025981 Bacteria 713
833 Ga0207658_10002825 3300025986 Bacteria 12451
834 Ga0207658_10005834 3300025986 Bacteria 8423
835 Ga0207658_10013147 3300025986 Bacteria 5654
836 Ga0207658_10411655 3300025986 Bacteria 1190
837 Ga0207658_10742933 3300025986 Bacteria 888
838 Ga0207658_10804600 3300025986 Bacteria 853
839 Ga0207658_11137489 3300025986 Bacteria 713
840 Ga0207658_11537809 3300025986 Bacteria 608
841 Ga0207677_10001179 3300026023 Bacteria 14211
842 Ga0207677_10001436 3300026023 Bacteria 12666
843 Ga0207677_10015394 3300026023 Bacteria 4498
844 Ga0207677_10040367 3300026023 Bacteria 3076
845 Ga0207677_10117791 3300026023 Bacteria 1991
846 Ga0207677_10260398 3300026023 Bacteria 1414
847 Ga0207677_10426178 3300026023 Bacteria 1131
848 Ga0207703_10000408 3300026035 Bacteria 45772
849 Ga0207703_10018563 3300026035 Bacteria 5430
850 Ga0207703_10036310 3300026035 Bacteria 3922
851 Ga0207703_10037004 3300026035 Bacteria 3887
852 Ga0207703_11561808 3300026035 Bacteria 635
853 Ga0207639_10043276 3300026041 Bacteria 3380
854 Ga0207639_10278290 3300026041 Bacteria 1471
855 Ga0207639_10811434 3300026041 Bacteria 872
856 Ga0207639_11560680 3300026041 Bacteria 619
857 Ga0207678_10005998 3300026067 Bacteria 10813
858 Ga0207678_10049813 3300026067 Bacteria 3620
859 Ga0207678_10171827 3300026067 Bacteria 1850
860 Ga0207678_10641644 3300026067 Bacteria 932
861 Ga0207702_10037491 3300026078 Bacteria 4058
862 Ga0207702_10248514 3300026078 Bacteria 1669
863 Ga0207702_10979134 3300026078 Bacteria 839
864 Ga0207702_11659806 3300026078 Bacteria 632
865 Ga0207641_10002065 3300026088 Bacteria 19074
866 Ga0207641_10004421 3300026088 Bacteria 12179
867 Ga0207641_10037985 3300026088 Bacteria 4024
868 Ga0207641_10135068 3300026088 Bacteria 2220
869 Ga0207641_10136517 3300026088 Bacteria 2208
870 Ga0207641_10188888 3300026088 Bacteria 1892
871 Ga0207648_10000686 3300026089 Bacteria 37954
872 Ga0207648_10012681 3300026089 Bacteria 7879
873 Ga0207648_10017873 3300026089 Bacteria 6435
874 Ga0207648_10019036 3300026089 Bacteria 6200
875 Ga0207648_10044650 3300026089 Bacteria 3888
876 Ga0207648_10292659 3300026089 Bacteria 1458
877 Ga0207648_10322549 3300026089 Bacteria 1388
878 Ga0207648_10400077 3300026089 Bacteria 1244
879 Ga0207648_10516637 3300026089 Bacteria 1094
880 Ga0207648_10522031 3300026089 Bacteria 1088
881 Ga0207648_11580882 3300026089 Bacteria 616
882 Ga0207676_10000269 3300026095 Bacteria 45280
883 Ga0207676_10054658 3300026095 Bacteria 3130
884 Ga0207676_10065398 3300026095 Bacteria 2895
885 Ga0207676_10161348 3300026095 Bacteria 1942
886 Ga0207676_11046571 3300026095 Bacteria 805
887 Ga0207676_11577421 3300026095 Bacteria 654
888 Ga0207674_10016515 3300026116 Bacteria 8077
889 Ga0207674_10029563 3300026116 Bacteria 5769
890 Ga0207674_10038674 3300026116 Bacteria 4948
891 Ga0207674_10139045 3300026116 Bacteria 2389
892 Ga0207674_10411475 3300026116 Bacteria 1307
893 Ga0207674_10604400 3300026116 Bacteria 1059
894 Ga0207674_10921920 3300026116 Bacteria 842
895 Ga0207674_11470051 3300026116 Bacteria 651
896 Ga0207675_100000307 3300026118 Bacteria 46857
897 Ga0207675_100001416 3300026118 Bacteria 24021
898 Ga0207675_100076361 3300026118 Bacteria 3137
899 Ga0207675_100466401 3300026118 Bacteria 1253
900 Ga0207683_10001051 3300026121 Bacteria 25171
901 Ga0207683_10066755 3300026121 Bacteria 3173
902 Ga0207683_10237209 3300026121 Bacteria 1663
903 Ga0207683_10385382 3300026121 Bacteria 1289
904 Ga0207683_10416789 3300026121 Bacteria 1237
905 Ga0207683_10564333 3300026121 Bacteria 1053
906 Ga0207683_10569559 3300026121 Bacteria 1048
907 Ga0207683_11007022 3300026121 Bacteria 773
908 Ga0207683_11075958 3300026121 Bacteria 746
909 Ga0207698_10037962 3300026142 Bacteria 3553
910 Ga0207698_10090847 3300026142 Bacteria 2498
911 Ga0207698_10104934 3300026142 Bacteria 2353
912 Ga0207698_10109147 3300026142 Bacteria 2315
913 Ga0207698_10196658 3300026142 Bacteria 1802
914 Ga0207698_10210647 3300026142 Bacteria 1748
915 Ga0207698_10337349 3300026142 Bacteria 1418
916 Ga0207698_10402939 3300026142 Bacteria 1308
917 Ga0207698_10411559 3300026142 Bacteria 1295
918 Ga0207698_10421196 3300026142 Bacteria 1281
919 Ga0207698_10425227 3300026142 Bacteria 1276
920 Ga0207698_10549355 3300026142 Bacteria 1132
921 Ga0207698_10899207 3300026142 Bacteria 892
922 Ga0207698_11212884 3300026142 Bacteria 769
923 Ga0207698_11341165 3300026142 Bacteria 730
924 Ga0209996_1001867 3300027395 Bacteria 2584
925 Ga0209968_1000702 3300027526 Bacteria 5159
926 Ga0209282_1011860 3300027666 Bacteria 5539
927 Ga0209966_1000040 3300027695 Bacteria 54404
928 Ga0209998_10021105 3300027717 Bacteria 1397
929 Ga0209813_10023158 3300027866 Bacteria 1764
930 Ga0209813_10222054 3300027866 Bacteria 708
931 Ga0209974_10006173 3300027876 Bacteria 4198
932 Ga0207428_10578269 3300027907 Bacteria 811
933 Ga0268266_10010170 3300028379 Bacteria 8244
934 Ga0268266_10061450 3300028379 Bacteria 3240
935 Ga0268266_10317098 3300028379 Bacteria 1458
936 Ga0268266_10455050 3300028379 Bacteria 1217
937 Ga0268266_10817657 3300028379 Bacteria 900
938 Ga0268265_10087552 3300028380 Bacteria 2478
939 Ga0268265_10179219 3300028380 Bacteria 1819
940 Ga0268265_10260150 3300028380 Bacteria 1542
941 Ga0268265_10260891 3300028380 Bacteria 1540
942 Ga0268265_10268500 3300028380 Bacteria 1520
943 Ga0268265_11578579 3300028380 Bacteria 661
944 Ga0268264_10004973 3300028381 Bacteria 11260
945 Ga0268264_10019709 3300028381 Bacteria 5510
946 Ga0268264_10077625 3300028381 Bacteria 2830
947 Ga0268264_10180300 3300028381 Bacteria 1917
948 Ga0268264_10269302 3300028381 Bacteria 1591
949 Ga0268264_10275052 3300028381 Bacteria 1575
950 Ga0268264_10825647 3300028381 Bacteria 927
951 Ga0307517_10000160 3300028786 Bacteria 108370
952 Ga0307517_10000395 3300028786 Bacteria 74663
953 Ga0307517_10074719 3300028786 Bacteria 2985
954 Ga0307517_10179818 3300028786 Bacteria 1368
955 Ga0307515_10000006 3300028794 Bacteria 725810
956 Ga0307515_10000160 3300028794 Bacteria 164789
957 Ga0307515_10000332 3300028794 Bacteria 116126
958 Ga0307515_10000893 3300028794 Bacteria 68669
959 Ga0307515_10001283 3300028794 Bacteria 57022
960 Ga0307515_10007639 3300028794 Bacteria 21327
961 Ga0307515_10012223 3300028794 Bacteria 16171
962 Ga0307515_10022830 3300028794 Bacteria 11008
963 Ga0307515_10033807 3300028794 Bacteria 8403
964 Ga0307515_10060601 3300028794 Bacteria 5392
965 Ga0307515_10080735 3300028794 Bacteria 4235
966 Ga0307515_10147322 3300028794 Bacteria 2485
967 Ga0307515_10179656 3300028794 Bacteria 2072
968 Ga0307515_10206740 3300028794 Bacteria 1820
969 Ga0307515_10223497 3300028794 Bacteria 1694
970 Ga0307515_10281623 3300028794 Bacteria 1369
971 Ga0307515_10364123 3300028794 Bacteria 1085
972 Ga0307515_10635715 3300028794 Bacteria 679
973 Ga0307511_10013142 3300030521 Bacteria 8095
974 Ga0307512_10041345 3300030522 Bacteria 3833
975 Ga0307512_10102024 3300030522 Bacteria 1938
976 Ga0307512_10139063 3300030522 Bacteria 1492
977 Ga0307512_10289617 3300030522 Bacteria 774
978 Ga0316177_1091352 3300030731 Bacteria 2470
979 Ga0316176_1071075 3300030732 Bacteria 1595
980 Ga0314311_1059274 3300030733 Bacteria 9245
981 Ga0316179_1119471 3300030734 Bacteria 2059
982 Ga0316178_1094522 3300030735 Bacteria 3317
983 Ga0316180_1037515 3300030736 Bacteria 1162
984 Ga0316183_1042467 3300030742 Bacteria 3746
985 Ga0316181_1174890 3300030744 Bacteria 3015
986 Ga0316182_1176401 3300030745 Bacteria 2996
987 Ga0316182_1440727 3300030745 Bacteria 2006
988 Ga0265327_10002595 3300031251 Bacteria 18697
989 Ga0307513_10003528 3300031456 Bacteria 21162
990 Ga0307513_10020560 3300031456 Bacteria 7826
991 Ga0307513_10037147 3300031456 Bacteria 5423
992 Ga0307513_10097939 3300031456 Bacteria 2966
993 Ga0307513_10215434 3300031456 Bacteria 1747
994 Ga0307513_11091140 3300031456 Bacteria 510
995 Ga0307509_10000212 3300031507 Bacteria 92922
996 Ga0307509_10000317 3300031507 Bacteria 79032
997 Ga0307509_10001515 3300031507 Bacteria 39177
998 Ga0307509_10002052 3300031507 Bacteria 33147
999 Ga0307509_10057914 3300031507 Bacteria 4105
1000 Ga0307509_10117990 3300031507 Bacteria 2638
1001 Ga0307509_10161551 3300031507 Bacteria 2136
1002 Ga0307509_10250752 3300031507 Bacteria 1554
1003 Ga0307509_10478928 3300031507 Bacteria 933
1004 Ga0307509_10529824 3300031507 Bacteria 858
1005 Ga0307408_100026572 3300031548 Bacteria 3979
1006 Ga0307408_100073052 3300031548 Bacteria 2540
1007 Ga0307408_100113754 3300031548 Bacteria 2083
1008 Ga0307408_100199041 3300031548 Bacteria 1620
1009 Ga0307408_100225286 3300031548 Bacteria 1532
1010 Ga0307408_100323704 3300031548 Bacteria 1299
1011 Ga0307408_100912915 3300031548 Bacteria 804
1012 Ga0307508_10000097 3300031616 Bacteria 103662
1013 Ga0307508_10000332 3300031616 Bacteria 57039
1014 Ga0307508_10001697 3300031616 Bacteria 24440
1015 Ga0307508_10005499 3300031616 Bacteria 12042
1016 Ga0307508_10006375 3300031616 Bacteria 11096
1017 Ga0307508_10118737 3300031616 Bacteria 2246
1018 Ga0307508_10191308 3300031616 Bacteria 1647
1019 Ga0307508_10394920 3300031616 Bacteria 974
1020 Ga0307514_10000795 3300031649 Bacteria 52015
1021 Ga0307514_10003838 3300031649 Bacteria 14140
1022 Ga0307514_10005414 3300031649 Bacteria 11411
1023 Ga0307514_10026427 3300031649 Bacteria 4694
1024 Ga0307514_10066783 3300031649 Bacteria 2718
1025 Ga0307514_10176693 3300031649 Bacteria 1384
1026 Ga0307516_10006132 3300031730 Bacteria 14171
1027 Ga0307516_10126756 3300031730 Bacteria 2337
1028 Ga0307516_10166406 3300031730 Bacteria 1949
1029 Ga0307516_10269308 3300031730 Bacteria 1390
1030 Ga0307516_10307928 3300031730 Bacteria 1258
1031 Ga0307516_10513847 3300031730 Bacteria 852
1032 Ga0307405_10008706 3300031731 Bacteria 5157
1033 Ga0307405_10044351 3300031731 Bacteria 2719
1034 Ga0307405_10199037 3300031731 Bacteria 1453
1035 Ga0307405_10510250 3300031731 Bacteria 965
1036 Ga0307405_10542540 3300031731 Bacteria 939
1037 Ga0307405_10948442 3300031731 Bacteria 731
1038 Ga0307405_11726206 3300031731 Bacteria 555
1039 Ga0307413_10709507 3300031824 Bacteria 836
1040 Ga0307413_10984130 3300031824 Bacteria 722
1041 Ga0307410_10450209 3300031852 Bacteria 1050
1042 Ga0307410_10678872 3300031852 Bacteria 866
1043 Ga0307406_10067497 3300031901 Bacteria 2332
1044 Ga0307406_10083841 3300031901 Bacteria 2126
1045 Ga0307406_10717461 3300031901 Bacteria 836
1046 Ga0307406_11592248 3300031901 Bacteria 577
1047 Ga0307412_10017936 3300031911 Bacteria 4245
1048 Ga0307412_10032642 3300031911 Bacteria 3302
1049 Ga0307412_10096348 3300031911 Bacteria 2082
1050 Ga0307412_10203425 3300031911 Bacteria 1505
1051 Ga0307412_10309707 3300031911 Bacteria 1251
1052 Ga0307412_10625997 3300031911 Bacteria 915
1053 Ga0307412_11142263 3300031911 Bacteria 695
1054 Ga0307409_100005809 3300031995 Bacteria 7159
1055 Ga0307409_101227328 3300031995 Bacteria 774
1056 Ga0307416_100001574 3300032002 Bacteria 12514
1057 Ga0307416_100216574 3300032002 Bacteria 1832
1058 Ga0307416_100360975 3300032002 Bacteria 1475
1059 Ga0307416_100420709 3300032002 Bacteria 1380
1060 Ga0307416_100891181 3300032002 Bacteria 989
1061 Ga0307414_10142492 3300032004 Bacteria 1878
1062 Ga0307414_10173251 3300032004 Bacteria 1727
1063 Ga0307414_11522563 3300032004 Bacteria 623
1064 Ga0307411_10013253 3300032005 Bacteria 4540
1065 Ga0307411_10132222 3300032005 Bacteria 1826
1066 Ga0307411_10780284 3300032005 Bacteria 840
1067 Ga0307415_100007021 3300032126 Bacteria 6125
1068 Ga0307507_10269557 3300033179 Bacteria 1077
1069 Ga0307507_10369216 3300033179 Bacteria 833
1070 Ga0307510_10129347 3300033180 Bacteria 2204
1071 Ga0307510_10262467 3300033180 Bacteria 1208
1072 Ga0307510_10395991 3300033180 Bacteria 824
1073 Ga0307510_10538721 3300033180 Bacteria 613
1074 Ga0373930_0047804 3300034816 Bacteria 927
1075 Ga0373948_0053027 3300034817 Bacteria 875
1076 Ga0373938_0083037 3300034957 Bacteria 783
1077 Ga0373926_0317095 3300035083 Bacteria 610
1078 Ga0373929_0004656 3300035085 Bacteria 2460
1079 Ga0373940_0078320 3300035088 Bacteria 973
1080 Ga0373944_0026045 3300035089 Bacteria 1725
1081 Ga0373923_0056861 3300035111 Bacteria 1653
1082 Ga0373923_0151710 3300035111 Bacteria 1053
1083 Ga0373932_0020198 3300035112 Bacteria 1744
1084 Ga0373932_0059406 3300035112 Bacteria 1158
1085 Ga0373936_0001484 3300035113 Bacteria 8523
1086 Ga0373936_0270213 3300035113 Bacteria 763
1087 Ga0373941_0021775 3300035115 Bacteria 1813
1088 Ga0373956_0089353 3300035119 Bacteria 1420
1089 Ga0373943_0008038 3300035170 Bacteria 4732
1090 Ga0373943_0082489 3300035170 Bacteria 1651
1091 Ga0373946_0124206 3300035171 Bacteria 1181
1092 Ga0373962_0098964 3300035242 Bacteria 907
1093 Ga0373924_0001472 3300035410 Bacteria 7658
1094 Ga0373931_0010336 3300035691 Bacteria 4485
1095 Ga0373935_0166599 3300035692 Bacteria 1505
1096 Ga0373935_0418713 3300035692 Bacteria 964
1097 Ga0373935_0585758 3300035692 Bacteria 815
1098 Ga0373927_0032371 3300035695 Bacteria 3406
1099 Ga0373947_0162803 3300035725 Bacteria 1444
1100 Ga0373947_0732890 3300035725 Bacteria 674
1101 Ga0373937_0171129 3300036401 Bacteria 2038
1102 Ga0373937_0539793 3300036401 Bacteria 1108
1103 Ga0373925_0125496 3300037068 Bacteria 1996
1104 Ga0395899_0000970 3300037312 Bacteria 26551
1105 Ga0395899_0001451 3300037312 Bacteria 20221
1106 Ga0395899_0003277 3300037312 Bacteria 12837
1107 Ga0395899_0115511 3300037312 Bacteria 1926
1108 Ga0395900_0000091 3300037418 Bacteria 167089
1109 Ga0395900_0000602 3300037418 Bacteria 49161
1110 Ga0395900_0006947 3300037418 Bacteria 11742
1111 Ga0395900_0012073 3300037418 Bacteria 8826
1112 Ga0395900_0109955 3300037418 Bacteria 2831
1113 Ga0395900_0313416 3300037418 Bacteria 1551
1114 Ga0395898_0008585 3300037466 Bacteria 10782
1115 Ga0395898_0304421 3300037466 Bacteria 1520
1116 Ga0395898_0310389 3300037466 Bacteria 1504
1117 Ga0395898_0708158 3300037466 Bacteria 949
1118 Ga0395905_0000269 3300037471 Bacteria 77631
1119 Ga0395905_0003396 3300037471 Bacteria 17047
1120 Ga0395905_0008793 3300037471 Bacteria 9926
1121 Ga0395905_0011217 3300037471 Bacteria 8664
1122 Ga0395905_0018561 3300037471 Bacteria 6600
1123 Ga0395905_0115052 3300037471 Bacteria 2527
1124 Ga0395905_0136166 3300037471 Bacteria 2310
1125 Ga0395905_0137658 3300037471 Bacteria 2297
1126 Ga0395905_0237491 3300037471 Bacteria 1703
1127 Ga0395905_0243446 3300037471 Bacteria 1680
1128 Ga0395905_0603517 3300037471 Bacteria 999
1129 Ga0395901_0010721 3300038443 Bacteria 9292
1130 Ga0395901_0085465 3300038443 Bacteria 3298
1131 Ga0395901_0137392 3300038443 Bacteria 2568
1132 Ga0395901_0646484 3300038443 Bacteria 1061
1133 Ga0395901_1085880 3300038443 Bacteria 771
1134 Ga0436365_1128978 3300039437 Bacteria 2310
1135 Ga0436363_1660049 3300039450 Bacteria 3141
1136 Ga0439436_0052251 3300041404 Bacteria 1153
1137 Ga0439439_0039272 3300041406 Bacteria 1223
1138 Ga0439439_0047623 3300041406 Bacteria 1120
1139 Ga0439439_0109082 3300041406 Bacteria 766
1140 Ga0439447_025014 3300041407 Bacteria 1541
1141 Ga0439465_0248345 3300041413 Bacteria 658
1142 Ga0451791_0516807 3300041451 Bacteria 696
1143 Ga0451791_1822013 3300041451 Bacteria 598
1144 Ga0451793_0849783 3300041452 Bacteria 678
1145 Ga0451797_0036350 3300041453 Bacteria 1330
1146 Ga0451795_1156050 3300041456 Bacteria 964
1147 Ga0451798_0365603 3300041458 Bacteria 1186
1148 Ga0451798_0783119 3300041458 Bacteria 665
1149 Ga0451798_1050572 3300041458 Bacteria 596
1150 Ga0451798_1073454 3300041458 Bacteria 536
1151 Ga0451800_0507924 3300041459 Bacteria 1457
1152 Ga0451800_1125983 3300041459 Bacteria 544
1153 Ga0451807_0531094 3300041486 Bacteria 1124
1154 Ga0451807_0955082 3300041486 Bacteria 553
1155 Ga0451833_1039235 3300041491 Bacteria 709
1156 Ga0451839_0995859 3300041496 Bacteria 703
1157 Ga0451845_0395844 3300041501 Bacteria 626
1158 Ga0451847_0890968 3300041503 Bacteria 561
1159 Ga0451849_0455082 3300041505 Bacteria 1100
1160 Ga0451849_0763045 3300041505 Bacteria 597
1161 Ga0451855_0676908 3300041511 Bacteria 544
1162 Ga0451853_0929926 3300041512 Bacteria 1910
1163 Ga0451853_2031670 3300041512 Bacteria 1033
1164 Ga0451853_2256767 3300041512 Bacteria 663
1165 Ga0451853_2771872 3300041512 Bacteria 1332
1166 Ga0439433_0013375 3300041999 Bacteria 1802
1167 Ga0439433_0019350 3300041999 Bacteria 1517
1168 Ga0439442_009722 3300042002 Bacteria 1945
1169 Ga0439445_0055849 3300042004 Bacteria 1073
1170 Ga0439432_075318 3300042006 Bacteria 1025
1171 Ga0439432_200791 3300042006 Bacteria 578
1172 Ga0439449_0001455 3300042007 Bacteria 9260
1173 Ga0439449_0012086 3300042007 Bacteria 3245
1174 Ga0439452_031211 3300042010 Bacteria 1308
1175 Ga0439455_0003947 3300042012 Bacteria 2893
1176 Ga0439457_067024 3300042014 Bacteria 816
1177 Ga0439462_0007888 3300042015 Bacteria 2673
1178 Ga0439462_0010211 3300042015 Bacteria 2378
1179 Ga0450921_001983 3300042123 Bacteria 1313
1180 Ga0450923_003206 3300042125 Bacteria 2442
1181 Ga0450923_020511 3300042125 Bacteria 1281
1182 Ga0450923_035316 3300042125 Bacteria 1034
1183 Ga0450897_008249 3300042128 Bacteria 965
1184 Ga0450896_007410 3300042133 Bacteria 1514
1185 Ga0450898_005481 3300042134 Bacteria 1919
1186 Ga0450898_020412 3300042134 Bacteria 1161
1187 Ga0450905_056568 3300042142 Bacteria 648
1188 Ga0450910_025753 3300042147 Bacteria 906
1189 Ga0439446_0011968 3300042156 Bacteria 2365
1190 Ga0439446_0194101 3300042156 Bacteria 683
1191 Ga0439458_0006040 3300042157 Bacteria 2707
1192 Ga0450908_011589 3300042184 Bacteria 1612
1193 Ga0450908_030358 3300042184 Bacteria 939
1194 Ga0450909_037887 3300042185 Bacteria 739
1195 Ga0439434_0104381 3300042435 Bacteria 915
1196 Ga0439434_0115615 3300042435 Bacteria 872
1197 Ga0450893_0005187 3300042532 Bacteria 2085
1198 Ga0450893_0019015 3300042532 Bacteria 1173
1199 Ga0451577_0012109 3300042876 Bacteria 8113
1200 Ga0451577_0694118 3300042876 Bacteria 922
1201 Ga0466969_0194702 3300044656 Bacteria 925
1202 Ga0466972_0026237 3300044658 Bacteria 2887
1203 Ga0466965_0124831 3300044683 Bacteria 1331
1204 Ga0466961_0965815 3300044693 Bacteria 507
1205 Ga0466963_0387885 3300044694 Bacteria 985
1206 Ga0466964_0070136 3300044706 Bacteria 1480
1207 Ga0453684_0009557 3300044712 Bacteria 16927
1208 Ga0453684_0067062 3300044712 Bacteria 4566
1209 Ga0466968_0578281 3300044735 Bacteria 565
1210 Ga0466960_0187524 3300044901 Bacteria 1124
1211 Ga0451576_0035144 3300045051 Bacteria 5319
1212 Ga0451576_0804264 3300045051 Bacteria 987
1213 Ga0451576_0993627 3300045051 Bacteria 880
1214 Ga0466958_0525569 3300045836 Bacteria 768
1215 Ga0495627_049188 3300046453 Bacteria 1273
1216 Ga0495627_143442 3300046453 Bacteria 668
1217 Ga0495592_0000175 3300046454 Bacteria 56416
1218 Ga0495592_0003711 3300046454 Bacteria 11010
1219 Ga0495603_0337394 3300046455 Bacteria 865
1220 Ga0495590_0000001 3300046457 Bacteria 762984
1221 Ga0495590_0014398 3300046457 Bacteria 2886
1222 Ga0495590_0015858 3300046457 Bacteria 2726
1223 Ga0495590_0151583 3300046457 Bacteria 840
1224 Ga0495638_0002754 3300046460 Bacteria 14123
1225 Ga0495638_0005353 3300046460 Bacteria 9568
1226 Ga0495638_0086048 3300046460 Bacteria 1900
1227 Ga0495638_0105756 3300046460 Bacteria 1677
1228 Ga0495638_0421708 3300046460 Bacteria 688
1229 Ga0495641_0300235 3300046461 Bacteria 724
1230 Ga0495653_0000009 3300046463 Bacteria 304207
1231 Ga0495653_0316734 3300046463 Bacteria 1012
1232 Ga0495653_0406350 3300046463 Bacteria 864
1233 Ga0495650_0000001 3300046471 Bacteria 1085492
1234 Ga0495650_0000051 3300046471 Bacteria 318297
1235 Ga0495650_0000213 3300046471 Bacteria 123910
1236 Ga0495650_0009697 3300046471 Bacteria 5456
1237 Ga0495650_0030124 3300046471 Bacteria 2462
1238 Ga0495580_0355786 3300046472 Bacteria 991
1239 Ga0495580_0685529 3300046472 Bacteria 672
1240 Ga0495605_0000040 3300046474 Bacteria 193955
1241 Ga0495605_0024096 3300046474 Bacteria 3189
1242 Ga0495605_0049002 3300046474 Bacteria 2065
1243 Ga0495605_0284035 3300046474 Bacteria 703
1244 Ga0495605_0386324 3300046474 Bacteria 583
1245 Ga0495639_0021593 3300046475 Bacteria 2819
1246 Ga0495639_0127151 3300046475 Bacteria 1218
1247 Ga0495639_0457425 3300046475 Bacteria 649
1248 Ga0495639_0629862 3300046475 Bacteria 552
1249 Ga0495662_0401925 3300046476 Bacteria 673
1250 Ga0495584_0015103 3300046491 Bacteria 3935
1251 Ga0495584_0047944 3300046491 Bacteria 2155
1252 Ga0495584_0084559 3300046491 Bacteria 1598
1253 Ga0495584_0269858 3300046491 Bacteria 865
1254 Ga0495585_0000587 3300046492 Bacteria 34126
1255 Ga0495585_0005376 3300046492 Bacteria 8082
1256 Ga0495585_0292387 3300046492 Bacteria 803
1257 Ga0495596_0000029 3300046500 Bacteria 103615
1258 Ga0495596_0000177 3300046500 Bacteria 44496
1259 Ga0495596_0000309 3300046500 Bacteria 32084
1260 Ga0495596_0002217 3300046500 Bacteria 10590
1261 Ga0495596_0002850 3300046500 Bacteria 9022
1262 Ga0495596_0003951 3300046500 Bacteria 7334
1263 Ga0495596_0006338 3300046500 Bacteria 5459
1264 Ga0495596_0032721 3300046500 Bacteria 2072
1265 Ga0495596_0046851 3300046500 Bacteria 1697
1266 Ga0495607_0000867 3300046501 Bacteria 28348
1267 Ga0495607_0003055 3300046501 Bacteria 13021
1268 Ga0495607_0035858 3300046501 Bacteria 2995
1269 Ga0495607_0035916 3300046501 Bacteria 2992
1270 Ga0495607_0058891 3300046501 Bacteria 2193
1271 Ga0495607_0060055 3300046501 Bacteria 2165
1272 Ga0495607_0095182 3300046501 Bacteria 1605
1273 Ga0495583_0000127 3300046506 Bacteria 127780
1274 Ga0495583_0002687 3300046506 Bacteria 14789
1275 Ga0495583_0003009 3300046506 Bacteria 13477
1276 Ga0495583_0009275 3300046506 Bacteria 5895
1277 Ga0495583_0016689 3300046506 Bacteria 3935
1278 Ga0495583_0018534 3300046506 Bacteria 3661
1279 Ga0495583_0108944 3300046506 Bacteria 1175
1280 Ga0495583_0259338 3300046506 Bacteria 696
1281 Ga0495606_0019807 3300046507 Bacteria 4985
1282 Ga0495606_0163844 3300046507 Bacteria 1295
1283 Ga0495606_0316167 3300046507 Bacteria 841
1284 Ga0495610_0000008 3300046512 Bacteria 622732
1285 Ga0495610_0001018 3300046512 Bacteria 25838
1286 Ga0495610_0081480 3300046512 Bacteria 1485
1287 Ga0495610_0119289 3300046512 Bacteria 1158
1288 Ga0495616_0000034 3300046513 Bacteria 129394
1289 Ga0495616_0000071 3300046513 Bacteria 89053
1290 Ga0495616_0000294 3300046513 Bacteria 40512
1291 Ga0495616_0002129 3300046513 Bacteria 13266
1292 Ga0495616_0004940 3300046513 Bacteria 8327
1293 Ga0495616_0008342 3300046513 Bacteria 6143
1294 Ga0495616_0014033 3300046513 Bacteria 4501
1295 Ga0495616_0132029 3300046513 Bacteria 1143
1296 Ga0495616_0221478 3300046513 Bacteria 823
1297 Ga0495620_0031646 3300046515 Bacteria 2422
1298 Ga0495620_0061356 3300046515 Bacteria 1564
1299 Ga0495620_0072090 3300046515 Bacteria 1411
1300 Ga0495620_0224872 3300046515 Bacteria 718
1301 Ga0495628_0377451 3300046516 Bacteria 1039
1302 Ga0495630_0225575 3300046517 Bacteria 1431
1303 Ga0495630_0288158 3300046517 Bacteria 1255
1304 Ga0495631_0000042 3300046518 Bacteria 78766
1305 Ga0495631_0000408 3300046518 Bacteria 29643
1306 Ga0495631_0001648 3300046518 Bacteria 13280
1307 Ga0495631_0037703 3300046518 Bacteria 2152
1308 Ga0495631_0042931 3300046518 Bacteria 1996
1309 Ga0495631_0321971 3300046518 Bacteria 658
1310 Ga0495632_0000033 3300046519 Bacteria 164240
1311 Ga0495632_0000086 3300046519 Bacteria 95327
1312 Ga0495632_0000321 3300046519 Bacteria 46253
1313 Ga0495632_0001237 3300046519 Bacteria 21665
1314 Ga0495632_0005196 3300046519 Bacteria 8683
1315 Ga0495632_0008164 3300046519 Bacteria 6468
1316 Ga0495632_0028978 3300046519 Bacteria 2886
1317 Ga0495632_0112266 3300046519 Bacteria 1279
1318 Ga0495632_0204880 3300046519 Bacteria 897
1319 Ga0495637_0003831 3300046520 Bacteria 7897
1320 Ga0495637_0005223 3300046520 Bacteria 6648
1321 Ga0495637_0018995 3300046520 Bacteria 3183
1322 Ga0495637_0020863 3300046520 Bacteria 3007
1323 Ga0495637_0052143 3300046520 Bacteria 1709
1324 Ga0495637_0052357 3300046520 Bacteria 1704
1325 Ga0495637_0068682 3300046520 Bacteria 1435
1326 Ga0495637_0097785 3300046520 Bacteria 1151
1327 Ga0495637_0193181 3300046520 Bacteria 750
1328 Ga0495643_0000044 3300046522 Bacteria 226211
1329 Ga0495643_0000096 3300046522 Bacteria 146041
1330 Ga0495643_0000398 3300046522 Bacteria 57089
1331 Ga0495643_0000760 3300046522 Bacteria 36247
1332 Ga0495643_0001857 3300046522 Bacteria 17930
1333 Ga0495643_0024026 3300046522 Bacteria 3460
1334 Ga0495643_0035116 3300046522 Bacteria 2761
1335 Ga0495643_0048354 3300046522 Bacteria 2299
1336 Ga0495643_0063146 3300046522 Bacteria 1959
1337 Ga0495643_0068006 3300046522 Bacteria 1875
1338 Ga0495643_0084857 3300046522 Bacteria 1643
1339 Ga0495643_0197664 3300046522 Bacteria 967
1340 Ga0495643_0274842 3300046522 Bacteria 777
1341 Ga0495644_0000030 3300046523 Bacteria 66319
1342 Ga0495644_0033198 3300046523 Bacteria 1950
1343 Ga0495648_0000001 3300046524 Bacteria 696872
1344 Ga0495648_0000505 3300046524 Bacteria 41982
1345 Ga0495648_0001508 3300046524 Bacteria 22794
1346 Ga0495648_0011019 3300046524 Bacteria 6850
1347 Ga0495648_0016203 3300046524 Bacteria 5377
1348 Ga0495648_0020401 3300046524 Bacteria 4623
1349 Ga0495648_0024378 3300046524 Bacteria 4122
1350 Ga0495648_0036767 3300046524 Bacteria 3153
1351 Ga0495648_0041837 3300046524 Bacteria 2889
1352 Ga0495648_0054396 3300046524 Bacteria 2418
1353 Ga0495648_0115262 3300046524 Bacteria 1454
1354 Ga0495648_0292683 3300046524 Bacteria 766
1355 Ga0495642_0000246 3300046528 Bacteria 30547
1356 Ga0495642_0000273 3300046528 Bacteria 29188
1357 Ga0495642_0000401 3300046528 Bacteria 23277
1358 Ga0495642_0003450 3300046528 Bacteria 6228
1359 Ga0495642_0054844 3300046528 Bacteria 1644
1360 Ga0495642_0063629 3300046528 Bacteria 1533
1361 Ga0495642_0099496 3300046528 Bacteria 1237
1362 Ga0495642_0218528 3300046528 Bacteria 832
1363 Ga0495654_0000058 3300046530 Bacteria 139884
1364 Ga0495654_0001164 3300046530 Bacteria 18772
1365 Ga0495654_0002363 3300046530 Bacteria 12189
1366 Ga0495654_0008964 3300046530 Bacteria 5495
1367 Ga0495654_0020402 3300046530 Bacteria 3454
1368 Ga0495654_0045998 3300046530 Bacteria 2151
1369 Ga0495654_0054787 3300046530 Bacteria 1933
1370 Ga0495654_0058094 3300046530 Bacteria 1867
1371 Ga0495654_0174153 3300046530 Bacteria 936
1372 Ga0495654_0205785 3300046530 Bacteria 839
1373 Ga0495586_0509190 3300046535 Bacteria 695
1374 Ga0495587_0200705 3300046536 Bacteria 1128
1375 Ga0495587_0292480 3300046536 Bacteria 912
1376 Ga0495598_0069329 3300046537 Bacteria 1107
1377 Ga0495609_0000044 3300046538 Bacteria 161642
1378 Ga0495609_0000628 3300046538 Bacteria 27456
1379 Ga0495609_0000913 3300046538 Bacteria 21398
1380 Ga0495609_0000919 3300046538 Bacteria 21337
1381 Ga0495609_0002371 3300046538 Bacteria 11615
1382 Ga0495609_0002960 3300046538 Bacteria 10046
1383 Ga0495609_0005079 3300046538 Bacteria 7015
1384 Ga0495609_0034221 3300046538 Bacteria 2304
1385 Ga0495609_0094690 3300046538 Bacteria 1297
1386 Ga0495609_0199349 3300046538 Bacteria 837
1387 Ga0495621_0041382 3300046539 Bacteria 1618
1388 Ga0495621_0098758 3300046539 Bacteria 1109
1389 Ga0495621_0099677 3300046539 Bacteria 1104
1390 Ga0495621_0100499 3300046539 Bacteria 1100
1391 Ga0495597_0000115 3300046542 Bacteria 72325
1392 Ga0495597_0000996 3300046542 Bacteria 21725
1393 Ga0495597_0001025 3300046542 Bacteria 21374
1394 Ga0495597_0003730 3300046542 Bacteria 8697
1395 Ga0495597_0030025 3300046542 Bacteria 2479
1396 Ga0495597_0041564 3300046542 Bacteria 2053
1397 Ga0495597_0084653 3300046542 Bacteria 1352
1398 Ga0495597_0100640 3300046542 Bacteria 1219
1399 Ga0495597_0157684 3300046542 Bacteria 928
1400 Ga0495645_0181194 3300046543 Bacteria 1443
1401 Ga0495622_0051350 3300046557 Bacteria 1913
1402 Ga0495622_0063469 3300046557 Bacteria 1709
1403 Ga0495633_0000521 3300046558 Bacteria 38447
1404 Ga0495633_0003990 3300046558 Bacteria 9560
1405 Ga0495633_0019390 3300046558 Bacteria 3441
1406 Ga0495633_0044952 3300046558 Bacteria 2092
1407 Ga0495633_0073496 3300046558 Bacteria 1594
1408 Ga0495633_0111838 3300046558 Bacteria 1266
1409 Ga0495633_0243430 3300046558 Bacteria 821
1410 Ga0495633_0249677 3300046558 Bacteria 810
1411 Ga0495633_0310676 3300046558 Bacteria 716
1412 Ga0495667_0081116 3300046559 Bacteria 2109
1413 Ga0495656_0001972 3300046615 Bacteria 6773
1414 Ga0495656_0006352 3300046615 Bacteria 4144
1415 Ga0495668_0000045 3300046616 Bacteria 225145
1416 Ga0495668_0000193 3300046616 Bacteria 89740
1417 Ga0495668_0000669 3300046616 Bacteria 41269
1418 Ga0495668_0013890 3300046616 Bacteria 4736
1419 Ga0495668_0051691 3300046616 Bacteria 2275
1420 Ga0495668_0123854 3300046616 Bacteria 1414
1421 Ga0495668_0133597 3300046616 Bacteria 1358
1422 Ga0495668_0255204 3300046616 Bacteria 960
1423 Ga0495668_0312677 3300046616 Bacteria 861
1424 Ga0495668_0373975 3300046616 Bacteria 782
1425 Ga0495668_0375524 3300046616 Bacteria 781
1426 Ga0495634_0293425 3300046642 Bacteria 985
1427 Ga0495634_0438806 3300046642 Bacteria 772
1428 Ga0495611_0000439 3300046648 Bacteria 25620
1429 Ga0495611_0179729 3300046648 Bacteria 989
1430 Ga0495611_0192884 3300046648 Bacteria 951
1431 Ga0495625_0000065 3300046660 Bacteria 173230
1432 Ga0495625_0000224 3300046660 Bacteria 89521
1433 Ga0495625_0001600 3300046660 Bacteria 26768
1434 Ga0495625_0004383 3300046660 Bacteria 13387
1435 Ga0495625_0010559 3300046660 Bacteria 7627
1436 Ga0495625_0010801 3300046660 Bacteria 7516
1437 Ga0495625_0021731 3300046660 Bacteria 4933
1438 Ga0495625_0027912 3300046660 Bacteria 4239
1439 Ga0495625_0054514 3300046660 Bacteria 2855
1440 Ga0495625_0080161 3300046660 Bacteria 2274
1441 Ga0495625_0083807 3300046660 Bacteria 2215
1442 Ga0495625_0114980 3300046660 Bacteria 1836
1443 Ga0495625_0147503 3300046660 Bacteria 1583
1444 Ga0495625_0227577 3300046660 Bacteria 1219
1445 Ga0495625_0385197 3300046660 Bacteria 879
1446 Ga0495625_0451389 3300046660 Bacteria 794
1447 Ga0495625_0592313 3300046660 Bacteria 667
1448 Ga0495635_0418108 3300046663 Bacteria 889
1449 Ga0495659_0000041 3300046664 Bacteria 59124
1450 Ga0495659_0002529 3300046664 Bacteria 5904
1451 Ga0495661_0000049 3300046665 Bacteria 144060
1452 Ga0495661_0000170 3300046665 Bacteria 77754
1453 Ga0495661_0000325 3300046665 Bacteria 52324
1454 Ga0495661_0000843 3300046665 Bacteria 28565
1455 Ga0495661_0001206 3300046665 Bacteria 22434
1456 Ga0495661_0002108 3300046665 Bacteria 15613
1457 Ga0495661_0005969 3300046665 Bacteria 8595
1458 Ga0495661_0024188 3300046665 Bacteria 3932
1459 Ga0495661_0040999 3300046665 Bacteria 2867
1460 Ga0495661_0049889 3300046665 Bacteria 2536
1461 Ga0495661_0062830 3300046665 Bacteria 2198
1462 Ga0495661_0126875 3300046665 Bacteria 1403
1463 Ga0495661_0166230 3300046665 Bacteria 1180
1464 Ga0495661_0217644 3300046665 Bacteria 991
1465 Ga0495661_0478153 3300046665 Bacteria 596
1466 Ga0495588_0020475 3300046674 Bacteria 3252
1467 Ga0495588_0026306 3300046674 Bacteria 2904
1468 Ga0495588_0191695 3300046674 Bacteria 1080
1469 Ga0495588_0218584 3300046674 Bacteria 1006
1470 Ga0495657_0274252 3300046675 Bacteria 1011
1471 Ga0495646_0005993 3300046680 Bacteria 7705
1472 Ga0495646_0284957 3300046680 Bacteria 877
1473 Ga0495647_0116960 3300046681 Bacteria 1118
1474 Ga0495647_0122974 3300046681 Bacteria 1093
1475 Ga0495647_0150415 3300046681 Bacteria 998
1476 Ga0495647_0157311 3300046681 Bacteria 977
1477 Ga0495658_0010460 3300046683 Bacteria 4642
1478 Ga0495658_0037225 3300046683 Bacteria 2688
1479 Ga0495658_0068835 3300046683 Bacteria 2050
1480 Ga0495658_0180529 3300046683 Bacteria 1309
1481 Ga0495658_0327932 3300046683 Bacteria 971
1482 Ga0495658_0525918 3300046683 Bacteria 757
1483 Ga0495669_0000091 3300046684 Bacteria 59795
1484 Ga0495669_0015836 3300046684 Bacteria 3228
1485 Ga0495669_0029860 3300046684 Bacteria 2392
1486 Ga0495669_0256211 3300046684 Bacteria 840
1487 Ga0495613_0387219 3300046689 Bacteria 955
1488 Ga0495670_0024393 3300046691 Bacteria 2989
1489 Ga0495670_0030552 3300046691 Bacteria 2676
1490 Ga0495670_0038070 3300046691 Bacteria 2397
1491 Ga0495670_0257154 3300046691 Bacteria 932
1492 Ga0495670_0492896 3300046691 Bacteria 665
1493 Ga0495671_0000002 3300046692 Bacteria 1136189
1494 Ga0495671_0000131 3300046692 Bacteria 67432
1495 Ga0495671_0000198 3300046692 Bacteria 52877
1496 Ga0495671_0001101 3300046692 Bacteria 18664
1497 Ga0495671_0062030 3300046692 Bacteria 1843
1498 Ga0495671_0241127 3300046692 Bacteria 873
1499 Ga0495671_0334160 3300046692 Bacteria 727
1500 Ga0495649_0000303 3300046694 Bacteria 43094
1501 Ga0495649_0001551 3300046694 Bacteria 17244
1502 Ga0495649_0007850 3300046694 Bacteria 6459
1503 Ga0495649_0076699 3300046694 Bacteria 1789
1504 Ga0495649_0077226 3300046694 Bacteria 1783
1505 Ga0495649_0152523 3300046694 Bacteria 1213
1506 Ga0495649_0287073 3300046694 Bacteria 840
1507 Ga0495649_0497529 3300046694 Bacteria 606
1508 Ga0495589_0000035 3300046794 Bacteria 161642
1509 Ga0495589_0000219 3300046794 Bacteria 48510
1510 Ga0495589_0004514 3300046794 Bacteria 7395
1511 Ga0495589_0014524 3300046794 Bacteria 4053
1512 Ga0495589_0086051 3300046794 Bacteria 1527
1513 Ga0495589_0145767 3300046794 Bacteria 1132
1514 Ga0495589_0157520 3300046794 Bacteria 1082
1515 Ga0495589_0294625 3300046794 Bacteria 753
1516 Ga0495600_0177981 3300046809 Bacteria 1371
1517 Ga0495600_0459836 3300046809 Bacteria 786
1518 Ga0495660_0002312 3300046810 Bacteria 12220
1519 Ga0495660_0004863 3300046810 Bacteria 8088
1520 Ga0495660_0012822 3300046810 Bacteria 4861
1521 Ga0495660_0018326 3300046810 Bacteria 4024
1522 Ga0495660_0027191 3300046810 Bacteria 3237
1523 Ga0495660_0027838 3300046810 Bacteria 3195
1524 Ga0495660_0030060 3300046810 Bacteria 3062
1525 Ga0495660_0092147 3300046810 Bacteria 1573
1526 Ga0495660_0128877 3300046810 Bacteria 1271
1527 Ga0495660_0134626 3300046810 Bacteria 1236
1528 Ga0495660_0141449 3300046810 Bacteria 1197
1529 Ga0495604_0413231 3300047317 Bacteria 887
1530 Ga0495636_0000537 3300047318 Bacteria 13950
1531 Ga0495636_0005816 3300047318 Bacteria 4835
1532 Ga0495636_0037481 3300047318 Bacteria 2002
1533 Ga0495672_0000031 3300047320 Bacteria 298258
1534 Ga0495672_0000685 3300047320 Bacteria 37744
1535 Ga0495672_0001603 3300047320 Bacteria 22074
1536 Ga0495672_0005983 3300047320 Bacteria 9528
1537 Ga0495672_0021488 3300047320 Bacteria 4209
1538 Ga0495676_0000398 3300047321 Bacteria 35184
1539 Ga0495676_0030096 3300047321 Bacteria 4614
1540 Ga0495676_0069402 3300047321 Bacteria 2719
1541 Ga0495680_0509407 3300047322 Bacteria 816
1542 Ga0495683_0003254 3300047323 Bacteria 9489
1543 Ga0495683_0072619 3300047323 Bacteria 1688
1544 Ga0495683_0116569 3300047323 Bacteria 1271
1545 Ga0495683_0432777 3300047323 Bacteria 542
1546 Ga0495687_000002 3300047443 Bacteria 1085770
1547 Ga0495687_000066 3300047443 Bacteria 161642
1548 Ga0495687_001099 3300047443 Bacteria 26415
1549 Ga0495687_001273 3300047443 Bacteria 23729
1550 Ga0495687_001453 3300047443 Bacteria 21748
1551 Ga0495687_002257 3300047443 Bacteria 15813
1552 Ga0495687_002986 3300047443 Bacteria 12800
1553 Ga0495687_004333 3300047443 Bacteria 9656
1554 Ga0495687_012673 3300047443 Bacteria 4444
1555 Ga0495687_013163 3300047443 Bacteria 4330
1556 Ga0495687_018635 3300047443 Bacteria 3427
1557 Ga0495687_031321 3300047443 Bacteria 2440
1558 Ga0495677_0000013 3300047445 Bacteria 138372
1559 Ga0495677_0000512 3300047445 Bacteria 16307
1560 Ga0495677_0000550 3300047445 Bacteria 15532
1561 Ga0495677_0002369 3300047445 Bacteria 7408
1562 Ga0495677_0050369 3300047445 Bacteria 1532
1563 Ga0495677_0088148 3300047445 Bacteria 1168
1564 Ga0495677_0148178 3300047445 Bacteria 903
1565 Ga0495677_0202949 3300047445 Bacteria 771
1566 Ga0495677_0302893 3300047445 Bacteria 629
1567 Ga0495679_000296 3300047446 Bacteria 40360
1568 Ga0495679_002037 3300047446 Bacteria 10678
1569 Ga0495679_010136 3300047446 Bacteria 3719
1570 Ga0495679_020858 3300047446 Bacteria 2275
1571 Ga0495679_045256 3300047446 Bacteria 1345
1572 Ga0495685_000307 3300047447 Bacteria 16005
1573 Ga0495685_040375 3300047447 Bacteria 1596
1574 Ga0495673_0000061 3300047469 Bacteria 230647
1575 Ga0495673_0000926 3300047469 Bacteria 26610
1576 Ga0495681_0000016 3300047470 Bacteria 181322
1577 Ga0495681_0022987 3300047470 Bacteria 3324
1578 Ga0495681_0104177 3300047470 Bacteria 1237
1579 Ga0495686_0000054 3300047472 Bacteria 259400
1580 Ga0495686_0000464 3300047472 Bacteria 60897
1581 Ga0495686_0001324 3300047472 Bacteria 27731
1582 Ga0495686_0269510 3300047472 Bacteria 950
1583 Ga0495686_0459673 3300047472 Bacteria 675
1584 Ga0495593_0000083 3300047673 Bacteria 41204
1585 Ga0495593_0017089 3300047673 Bacteria 4083
1586 Ga0495602_0232178 3300048088 Bacteria 1385
1587 Ga0495614_0004378 3300048089 Bacteria 6367
1588 Ga0495614_0010642 3300048089 Bacteria 4053
1589 Ga0495615_0002597 3300048090 Bacteria 2915
1590 Ga0495626_0000011 3300048091 Bacteria 260928
1591 Ga0495626_0000071 3300048091 Bacteria 136767
1592 Ga0495626_0003695 3300048091 Bacteria 9685
1593 Ga0495626_0005258 3300048091 Bacteria 7651
1594 Ga0495626_0008223 3300048091 Bacteria 5745
1595 Ga0495626_0020612 3300048091 Bacteria 3282
1596 Ga0495626_0029974 3300048091 Bacteria 2626
1597 Ga0495626_0031597 3300048091 Bacteria 2547
1598 Ga0495626_0058708 3300048091 Bacteria 1757
1599 Ga0495626_0059441 3300048091 Bacteria 1744
1600 Ga0495626_0065283 3300048091 Bacteria 1647
1601 Ga0495626_0066936 3300048091 Bacteria 1623
1602 Ga0495626_0086231 3300048091 Bacteria 1387
1603 Ga0495626_0090886 3300048091 Bacteria 1342
1604 Ga0495626_0127985 3300048091 Bacteria 1086
1605 Ga0495626_0127989 3300048091 Bacteria 1086
1606 Ga0495626_0399090 3300048091 Bacteria 532
1607 Ga0496100_0002053 3300048903 Bacteria 10102
1608 Ga0496100_0007896 3300048903 Bacteria 5909
1609 Ga0496100_0456306 3300048903 Bacteria 980
1610 Ga0496101_0056761 3300048904 Bacteria 2831
1611 Ga0496101_0067612 3300048904 Bacteria 2609
1612 Ga0496101_0485113 3300048904 Bacteria 976
1613 Ga0496102_0003799 3300048905 Bacteria 12766
1614 Ga0496102_0047264 3300048905 Bacteria 3910
1615 Ga0496102_0191157 3300048905 Bacteria 1929
1616 Ga0496102_0509070 3300048905 Bacteria 1126
1617 Ga0496103_0246927 3300048906 Bacteria 1148
1618 Ga0496104_0004101 3300048907 Bacteria 12642
1619 Ga0496104_0058001 3300048907 Bacteria 3664
1620 Ga0496104_0330733 3300048907 Bacteria 1437
1621 Ga0496104_0657970 3300048907 Bacteria 956
1622 Ga0496105_0043048 3300048908 Bacteria 3724
1623 Ga0496105_0592230 3300048908 Bacteria 861
1624 Ga0496105_0626676 3300048908 Bacteria 832
1625 Ga0496106_0012220 3300048909 Bacteria 6336
1626 Ga0496106_0055120 3300048909 Bacteria 3004
1627 Ga0496107_0130976 3300048910 Bacteria 1851
1628 Ga0496107_0372999 3300048910 Bacteria 1061
1629 Ga0496108_0067782 3300048911 Bacteria 3010
1630 Ga0496108_0254884 3300048911 Bacteria 1526
1631 Ga0496108_0525511 3300048911 Bacteria 1033
1632 Ga0496109_0034590 3300048912 Bacteria 4553
1633 Ga0496109_0069873 3300048912 Bacteria 3222
1634 Ga0496109_1231936 3300048912 Bacteria 685
1635 Ga0496110_0094088 3300048913 Bacteria 2683
1636 Ga0496110_0128599 3300048913 Bacteria 2286
1637 Ga0496110_0158310 3300048913 Bacteria 2052
1638 Ga0496110_0353796 3300048913 Bacteria 1338
1639 Ga0496111_0062777 3300048914 Bacteria 2694
1640 Ga0496111_0252643 3300048914 Bacteria 1308
1641 Ga0496111_0669728 3300048914 Bacteria 756
1642 Ga0496112_0277695 3300048915 Bacteria 1623
1643 Ga0496113_0010989 3300048916 Bacteria 6016
1644 Ga0496113_0122050 3300048916 Bacteria 2038
1645 Ga0496113_0990754 3300048916 Bacteria 662
1646 Ga0496114_0218590 3300048917 Bacteria 1672
1647 Ga0496114_0314115 3300048917 Bacteria 1384
1648 Ga0496114_0341868 3300048917 Bacteria 1323
1649 Ga0496114_0601822 3300048917 Bacteria 969
1650 Ga0496115_0259830 3300048918 Bacteria 1428
1651 Ga0496116_0163029 3300048919 Bacteria 1220
1652 Ga0496116_0166712 3300048919 Bacteria 1200
1653 Ga0496116_0266748 3300048919 Bacteria 840
1654 Ga0496117_0013508 3300048920 Bacteria 7119
1655 Ga0496117_0019516 3300048920 Bacteria 5563
1656 Ga0496117_0052144 3300048920 Bacteria 2884
1657 Ga0496118_0009116 3300048921 Bacteria 10097
1658 Ga0496118_0053625 3300048921 Bacteria 3062
1659 Ga0496121_0045456 3300048924 Bacteria 3772
1660 Ga0496121_0089403 3300048924 Bacteria 2411
1661 Ga0496121_0188861 3300048924 Bacteria 1479
1662 Ga0496122_0000552 3300048925 Bacteria 77275
1663 Ga0496122_0127986 3300048925 Bacteria 1621
1664 Ga0496123_0001585 3300048926 Bacteria 30921
1665 Ga0496123_0025017 3300048926 Bacteria 4515
1666 Ga0496123_0052955 3300048926 Bacteria 2687
1667 Ga0496123_0143032 3300048926 Bacteria 1304
1668 Ga0496124_0089671 3300048927 Bacteria 2510
1669 Ga0496124_0142076 3300048927 Bacteria 1893
1670 Ga0496124_0166873 3300048927 Bacteria 1710
1671 Ga0496124_0189507 3300048927 Bacteria 1575
1672 Ga0496125_0001368 3300048928 Bacteria 35878
1673 Ga0496125_0009166 3300048928 Bacteria 10227
1674 Ga0496125_0034798 3300048928 Bacteria 4432
1675 Ga0496125_0056434 3300048928 Bacteria 3189
1676 Ga0496125_0190126 3300048928 Bacteria 1356
1677 Ga0496125_0256365 3300048928 Bacteria 1099
1678 Ga0496125_0471999 3300048928 Bacteria 713
1679 Ga0496126_0126980 3300048929 Bacteria 2207
1680 Ga0496126_0496667 3300048929 Bacteria 976
1681 Ga0496126_0547004 3300048929 Bacteria 919
1682 Ga0495678_000009 3300049459 Bacteria 373806
1683 Ga0495678_000035 3300049459 Bacteria 200957
1684 Ga0495678_003416 3300049459 Bacteria 9852
1685 Ga0495678_014610 3300049459 Bacteria 3646
1686 Ga0495678_033503 3300049459 Bacteria 2119
1687 Ga0495678_094668 3300049459 Bacteria 1045
1688 Ga0495678_112271 3300049459 Bacteria 927
1689 Ga0495682_0001939 3300049460 Bacteria 10279
1690 Ga0495682_0002609 3300049460 Bacteria 8457
1691 Ga0495682_0007946 3300049460 Bacteria 4194
1692 Ga0495682_0068522 3300049460 Bacteria 1278
1693 Ga0501298_011896 3300049521 Bacteria 1519
1694 Ga0501300_018393 3300049523 Bacteria 1021
1695 Ga0501303_004894 3300049526 Bacteria 1122
1696 Ga0501032_0057759 3300049569 Bacteria 2606
1697 Ga0501034_0735138 3300049571 Bacteria 883
1698 Ga0501043_0010569 3300049579 Bacteria 7226
1699 Ga0501043_0365601 3300049579 Bacteria 1094
1700 Ga0501043_0623108 3300049579 Bacteria 795
1701 Ga0501046_0012537 3300049580 Bacteria 7209
1702 Ga0501047_0015658 3300049581 Bacteria 7226
1703 Ga0501048_0068146 3300049582 Bacteria 2514
1704 Ga0501067_0457017 3300049583 Bacteria 713
1705 Ga0501206_015062 3300049653 Bacteria 1068
1706 Ga0501222_011032 3300049662 Bacteria 1192
1707 Ga0501240_015693 3300049673 Bacteria 1080
1708 Ga0501249_001955 3300049679 Bacteria 4189
1709 Ga0501225_0009720 3300049705 Bacteria 2735
1710 Ga0501079_0898240 3300049741 Bacteria 698
1711 Ga0501262_000333 3300049759 Bacteria 5698
1712 Ga0501264_008911 3300049761 Bacteria 951
1713 Ga0501265_002430 3300049762 Bacteria 2113
1714 Ga0501269_051107 3300049766 Bacteria 569
1715 nmdc:mga03683_100415_c1 3300050489 Bacteria 1271
1716 nmdc:mga03683_11059_c1 3300050489 Bacteria 3253
1717 nmdc:mga03683_121243_c1 3300050489 Bacteria 1163
1718 nmdc:mga03683_176849_c1 3300050489 Bacteria 972
1719 nmdc:mga03683_191079_c1 3300050489 Bacteria 937
1720 nmdc:mga03683_2207_c1 3300050489 Bacteria 6010
1721 nmdc:mga03683_231868_c1 3300050489 Bacteria 854
1722 nmdc:mga03683_312174_c1 3300050489 Bacteria 739
1723 nmdc:mga03683_351698_c1 3300050489 Bacteria 698
1724 nmdc:mga03683_4604_c1 3300050489 Bacteria 4588
1725 nmdc:mga03683_505229_c1 3300050489 Bacteria 586
1726 nmdc:mga03683_52226_c1 3300050489 Bacteria 1708
1727 nmdc:mga03683_558913_c1 3300050489 Bacteria 557
1728 nmdc:mga03683_7947_c2 3300050489 Bacteria 2071
1729 nmdc:mga03n38_132691_c1 3300050490 Bacteria 1236
1730 nmdc:mga03n38_395696_c1 3300050490 Bacteria 760
1731 nmdc:mga03n38_73274_c1 3300050490 Bacteria 1590
1732 nmdc:mga00v17_28836_c1 3300050491 Bacteria 3254
1733 nmdc:mga00v17_309415_c1 3300050491 Bacteria 1026
1734 nmdc:mga00v17_779504_c1 3300050491 Bacteria 610
1735 nmdc:mga0k408_12545_c1 3300050493 Bacteria 4635
1736 nmdc:mga0k408_136604_c1 3300050493 Bacteria 1457
1737 nmdc:mga0k408_143867_c1 3300050493 Bacteria 1419
1738 nmdc:mga0k408_172153_c1 3300050493 Bacteria 1291
1739 nmdc:mga0k408_18003_c1 3300050493 Bacteria 3938
1740 nmdc:mga0k408_1832_c1 3300050493 Bacteria 11407
1741 nmdc:mga0k408_2173_c2 3300050493 Bacteria 6893
1742 nmdc:mga0k408_23489_c1 3300050493 Bacteria 3479
1743 nmdc:mga0k408_2403_c1 3300050493 Bacteria 9962
1744 nmdc:mga0k408_25142_c1 3300050493 Bacteria 3371
1745 nmdc:mga0k408_3264_c1 3300050493 Bacteria 8581
1746 nmdc:mga0k408_366874_c1 3300050493 Bacteria 858
1747 nmdc:mga0k408_374987_c1 3300050493 Bacteria 848
1748 nmdc:mga0k408_38001_c1 3300050493 Bacteria 2764
1749 nmdc:mga0k408_394745_c1 3300050493 Bacteria 824
1750 nmdc:mga0k408_41756_c1 3300050493 Bacteria 2641
1751 nmdc:mga0k408_483053_c1 3300050493 Bacteria 735
1752 nmdc:mga0k408_519125_c1 3300050493 Bacteria 705
1753 nmdc:mga0k408_6625_c1 3300050493 Bacteria 6174
1754 nmdc:mga0k408_69454_c1 3300050493 Bacteria 2056
1755 nmdc:mga0k408_79993_c1 3300050493 Bacteria 1913
1756 nmdc:mga0k408_83142_c1 3300050493 Bacteria 1877
1757 nmdc:mga0k408_83423_c1 3300050493 Bacteria 1873
1758 nmdc:mga0k408_95654_c1 3300050493 Bacteria 1748
1759 nmdc:mga06z11_15676_c1 3300050494 Bacteria 3389
1760 nmdc:mga06z11_251659_c1 3300050494 Bacteria 1040
1761 nmdc:mga06z11_291793_c1 3300050494 Bacteria 968
1762 nmdc:mga06z11_297640_c1 3300050494 Bacteria 959
1763 nmdc:mga06z11_431473_c1 3300050494 Bacteria 795
1764 nmdc:mga06z11_5404_c1 3300050494 Bacteria 5120
1765 nmdc:mga04h51_104660_c1 3300050495 Bacteria 1036
1766 nmdc:mga04h51_257970_c1 3300050495 Bacteria 700
1767 nmdc:mga07m45_10967_c1 3300050496 Bacteria 4749
1768 nmdc:mga07m45_117139_c1 3300050496 Bacteria 1537
1769 nmdc:mga07m45_13780_c1 3300050496 Bacteria 4294
1770 nmdc:mga07m45_142433_c1 3300050496 Bacteria 1388
1771 nmdc:mga07m45_173713_c1 3300050496 Bacteria 1253
1772 nmdc:mga07m45_23347_c2 3300050496 Bacteria 2879
1773 nmdc:mga07m45_257119_c1 3300050496 Bacteria 1016
1774 nmdc:mga07m45_43309_c1 3300050496 Bacteria 2524
1775 nmdc:mga07m45_48119_c1 3300050496 Bacteria 2398
1776 nmdc:mga07m45_6011_c1 3300050496 Bacteria 6108
1777 nmdc:mga07m45_62617_c1 3300050496 Bacteria 2109
1778 nmdc:mga07m45_70336_c1 3300050496 Bacteria 1991
1779 nmdc:mga07m45_88815_c1 3300050496 Bacteria 1769
1780 nmdc:mga0qj67_725633_c1 3300050509 Bacteria 789
1781 nmdc:mga0rr50_902513_c1 3300050513 Bacteria 753
1782 nmdc:mga0sz30_276124_c1 3300050516 Bacteria 749
1783 nmdc:mga0sz30_294999_c1 3300050516 Bacteria 723
1784 Ga0495601_0069985 3300053077 Bacteria 2239
1785 Ga0500610_0000055 3300053079 Bacteria 36032
1786 Ga0500610_0000454 3300053079 Bacteria 12629
1787 Ga0500610_0000509 3300053079 Bacteria 11979
1788 Ga0495655_0078673 3300053083 Bacteria 938
1789 Ga0495595_0056914 3300053084 Bacteria 1823
1790 Ga0495595_0140001 3300053084 Bacteria 1187
1791 Ga0495619_0694758 3300053085 Bacteria 692
1792 Ga0500578_0078098 3300053086 Bacteria 2107
1793 Ga0500578_0168990 3300053086 Bacteria 1353
1794 Ga0500643_011260 3300053087 Bacteria 3272
1795 Ga0500644_0008080 3300053088 Bacteria 2766
1796 Ga0500644_0014654 3300053088 Bacteria 2218
1797 Ga0500644_0018208 3300053088 Bacteria 2053
1798 Ga0500646_0132370 3300053090 Bacteria 812
1799 Ga0500647_0050303 3300053091 Bacteria 2004
1800 Ga0500647_0249347 3300053091 Bacteria 781
1801 Ga0500583_0125474 3300053092 Bacteria 1271
1802 Ga0500583_0318735 3300053092 Bacteria 758
1803 Ga0500583_0334033 3300053092 Bacteria 737
1804 Ga0500651_0000015 3300053093 Bacteria 161416
1805 Ga0500651_0000242 3300053093 Bacteria 33458
1806 Ga0500651_0179287 3300053093 Bacteria 1259
1807 Ga0500566_0030268 3300053094 Bacteria 3157
1808 Ga0500566_0129441 3300053094 Bacteria 1352
1809 Ga0500566_0362801 3300053094 Bacteria 660
1810 Ga0500641_0211130 3300053096 Bacteria 826
1811 Ga0500650_0128252 3300053098 Bacteria 1180
1812 Ga0500650_0260854 3300053098 Bacteria 775
1813 Ga0500560_096383 3300053107 Bacteria 990
1814 Ga0500562_010558 3300053108 Bacteria 2342
1815 Ga0500569_087057 3300053109 Bacteria 1007
1816 Ga0500571_000017 3300053110 Bacteria 64361
1817 Ga0500571_000074 3300053110 Bacteria 31440
1818 Ga0500572_107590 3300053111 Bacteria 895
1819 Ga0500572_210357 3300053111 Bacteria 637
1820 Ga0500572_245004 3300053111 Bacteria 584
1821 Ga0500591_050154 3300053115 Bacteria 1959
1822 Ga0500592_006166 3300053116 Bacteria 1908
1823 Ga0500593_000097 3300053117 Bacteria 32867
1824 Ga0500593_000242 3300053117 Bacteria 22487
1825 Ga0500593_003350 3300053117 Bacteria 6035
1826 Ga0500594_0002529 3300053118 Bacteria 3977
1827 Ga0500594_0021001 3300053118 Bacteria 1633
1828 Ga0500607_000025 3300053121 Bacteria 95473
1829 Ga0500607_000049 3300053121 Bacteria 80941
1830 Ga0500607_019928 3300053121 Bacteria 3791
1831 Ga0500607_135680 3300053121 Bacteria 1166
1832 Ga0500608_012479 3300053122 Bacteria 3727
1833 Ga0500614_156419 3300053123 Bacteria 689
1834 Ga0500618_000173 3300053125 Bacteria 53346
1835 Ga0500618_015894 3300053125 Bacteria 1893
1836 Ga0500618_052678 3300053125 Bacteria 920
1837 Ga0500618_058291 3300053125 Bacteria 869
1838 Ga0500626_009438 3300053128 Bacteria 4058
1839 Ga0500655_000065 3300053133 Bacteria 28630
1840 Ga0500655_002857 3300053133 Bacteria 3137
1841 Ga0500658_0000028 3300053134 Bacteria 105688
1842 Ga0500658_0000054 3300053134 Bacteria 60941
1843 Ga0500658_0003025 3300053134 Bacteria 6449
1844 Ga0500658_0042452 3300053134 Bacteria 1827
1845 Ga0500559_0001694 3300053136 Bacteria 12147
1846 Ga0500559_0004268 3300053136 Bacteria 6837
1847 Ga0500559_0006743 3300053136 Bacteria 5159
1848 Ga0500559_0015080 3300053136 Bacteria 3266
1849 Ga0500559_0025318 3300053136 Bacteria 2525
1850 Ga0500559_0093712 3300053136 Bacteria 1377
1851 Ga0500559_0226043 3300053136 Bacteria 882
1852 Ga0500564_001050 3300053138 Bacteria 9107
1853 Ga0500564_066263 3300053138 Bacteria 1633
1854 Ga0500564_118137 3300053138 Bacteria 1158
1855 Ga0500568_0001518 3300053139 Bacteria 14786
1856 Ga0500568_0068042 3300053139 Bacteria 1367
1857 Ga0500573_0005327 3300053140 Bacteria 6885
1858 Ga0500574_000051 3300053141 Bacteria 13789
1859 Ga0500574_000431 3300053141 Bacteria 5303
1860 Ga0500586_000727 3300053145 Bacteria 6760
1861 Ga0500586_025988 3300053145 Bacteria 1892
1862 Ga0500616_0025694 3300053153 Bacteria 3265
1863 Ga0500616_0041391 3300053153 Bacteria 2473
1864 Ga0500616_0050793 3300053153 Bacteria 2188
1865 Ga0500616_0332006 3300053153 Bacteria 623
1866 Ga0500619_088620 3300053154 Bacteria 1044
1867 Ga0500622_0001109 3300053156 Bacteria 22452
1868 Ga0500622_0008524 3300053156 Bacteria 5727
1869 Ga0500622_0137997 3300053156 Bacteria 1166
1870 Ga0500627_0000171 3300053158 Bacteria 19148
1871 Ga0500630_073077 3300053159 Bacteria 1618
1872 Ga0500633_0087958 3300053160 Bacteria 1132
1873 Ga0500634_0004247 3300053161 Bacteria 6586
1874 Ga0500634_0004851 3300053161 Bacteria 6297
1875 Ga0500634_0063922 3300053161 Bacteria 1945
1876 Ga0500634_0113662 3300053161 Bacteria 1331
1877 Ga0500638_000284 3300053162 Bacteria 11309
1878 Ga0500638_012459 3300053162 Bacteria 3811
1879 Ga0500639_008998 3300053163 Bacteria 5208
1880 Ga0500636_0005829 3300053177 Bacteria 7053
1881 Ga0500636_0221671 3300053177 Bacteria 985
1882 Ga0500567_125390 3300053723 Bacteria 1016
1883 Ga0500565_025083 3300053734 Bacteria 747
1884 Ga0500587_002697 3300053739 Bacteria 2515
1885 Ga0500587_009667 3300053739 Bacteria 1229
1886 Ga0500661_003998 3300055283 Bacteria 2759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049766 Ga0501269_051107 Ga0501269_051107_138_533 130
2 3300046491 Ga0495584_0047944 Ga0495584_0047944_32_511 150
3 3300046518 Ga0495631_0321971 Ga0495631_0321971_162_641 150
4 iso_pu_bacteria 2551306416 2553004589 152
5 iso_pu_bacteria 2599185214 2599620622 152
6 iso_pu_bacteria 2599185226 2599673921 152
7 iso_pu_bacteria 2599185227 2599678762 152
8 iso_pu_bacteria 2599185229 2599690133 152
9 iso_pu_bacteria 2643221570 2643864789 152
10 iso_pu_bacteria 2643221628 2644159027 152
11 iso_pu_bacteria 2643221652 2644293980 152
12 iso_pu_bacteria 2738541277 2738723725 152
13 iso_pu_bacteria 2738543019 2739284456 152
14 iso_pu_bacteria 2818991446 2819601198 152
15 iso_pu_bacteria 2831265667 2831271487 152
16 iso_pu_bacteria 2838054893 2838055386 152
17 iso_pu_bacteria 2885198086 2885201115 152
18 iso_pu_bacteria 2885211737 2885214101 152
19 iso_pu_bacteria 2899924645 2899927455 152
20 iso_pu_bacteria 2904449895 2904453290 152
21 iso_pu_bacteria 2904456579 2904459284 152
22 iso_pu_bacteria 2904530477 2904532422 152
23 iso_pu_bacteria 2923510766 2923515417 152
24 iso_pu_bacteria 2928037797 2928042633 152
25 iso_pu_bacteria 2928044640 2928048940 152
26 iso_pu_bacteria 2928051484 2928051490 152
27 iso_pu_bacteria 2928064002 2928068702 152
28 iso_pu_bacteria 2928070936 2928073330 152
29 iso_pu_bacteria 2929520902 2929523212 152
30 iso_pu_bacteria 2945972063 2945972083 152
31 3300005577 Ga0068857_101269641 Ga0068857_1012696412 153
32 3300026116 Ga0207674_10921920 Ga0207674_109219202 153
33 3300037312 Ga0395899_0003277 Ga0395899_0003277_6053_6526 153
34 3300037418 Ga0395900_0006947 Ga0395900_0006947_6209_6682 153
35 3300037466 Ga0395898_0008585 Ga0395898_0008585_4608_5081 153
36 3300037471 Ga0395905_0011217 Ga0395905_0011217_2290_2763 153
37 3300038443 Ga0395901_0085465 Ga0395901_0085465_491_964 153
38 3300038443 Ga0395901_0646484 Ga0395901_0646484_77_550 153
39 3300041486 Ga0451807_0531094 Ga0451807_0531094_170_643 153
40 3300044656 Ga0466969_0194702 Ga0466969_0194702_297_770 153
41 3300044694 Ga0466963_0387885 Ga0466963_0387885_233_706 153
42 3300045836 Ga0466958_0525569 Ga0466958_0525569_215_688 153
43 iso_pu_bacteria 2738541280 2738739727 153
44 iso_pu_bacteria 2738541297 2738830461 153
45 iso_pu_bacteria 2738541357 2739154257 153
46 iso_pu_bacteria 2738543003 2739196210 153
47 iso_pu_bacteria 2738543026 2739322653 153
48 iso_pu_bacteria 2738543029 2739340894 153
49 3300025297 Ga0209758_1050082 Ga0209758_10500822 154
50 3300042435 Ga0439434_0115615 Ga0439434_0115615_90_569 154
51 3300046460 Ga0495638_0002754 Ga0495638_0002754_4033_4497 154
52 3300046660 Ga0495625_0001600 Ga0495625_0001600_6270_6734 154
53 iso_pu_bacteria 2842677519 2842679996 154
54 iso_pu_bacteria 2919462493 2919466116 154
55 iso_pu_bacteria 2928115317 2928117795 154
56 3300002738 JGI25154J39366_1000278 JGI25154J39366_10002785 155
57 3300005459 Ga0068867_101856499 Ga0068867_1018564991 155
58 3300006048 Ga0075363_100100513 Ga0075363_1001005132 155
59 3300006177 Ga0075362_10075832 Ga0075362_100758322 155
60 3300025246 Ga0209646_1000023 Ga0209646_1000023356 155
61 3300025250 Ga0209026_1013794 Ga0209026_10137943 155
62 3300026089 Ga0207648_11580882 Ga0207648_115808821 155
63 3300041503 Ga0451847_0890968 Ga0451847_0890968_19_501 155
64 3300041511 Ga0451855_0676908 Ga0451855_0676908_15_494 155
65 3300044683 Ga0466965_0124831 Ga0466965_0124831_597_1076 155
66 3300044693 Ga0466961_0965815 Ga0466961_0965815_21_497 155
67 3300046457 Ga0495590_0000001 Ga0495590_0000001_343392_343871 155
68 3300046471 Ga0495650_0000001 Ga0495650_0000001_691482_691961 155
69 3300046501 Ga0495607_0000867 Ga0495607_0000867_11054_11533 155
70 3300046506 Ga0495583_0000127 Ga0495583_0000127_21530_22009 155
71 3300046506 Ga0495583_0002687 Ga0495583_0002687_6142_6621 155
72 3300046506 Ga0495583_0009275 Ga0495583_0009275_1739_2218 155
73 3300046507 Ga0495606_0019807 Ga0495606_0019807_3202_3693 155
74 3300046520 Ga0495637_0018995 Ga0495637_0018995_53_532 155
75 3300046522 Ga0495643_0000044 Ga0495643_0000044_48540_49019 155
76 3300046522 Ga0495643_0063146 Ga0495643_0063146_200_679 155
77 3300046524 Ga0495648_0000001 Ga0495648_0000001_505356_505835 155
78 3300046528 Ga0495642_0000401 Ga0495642_0000401_10647_11126 155
79 3300046538 Ga0495609_0000628 Ga0495609_0000628_11892_12371 155
80 3300046538 Ga0495609_0002960 Ga0495609_0002960_8105_8584 155
81 3300046542 Ga0495597_0000115 Ga0495597_0000115_55049_55528 155
82 3300046542 Ga0495597_0100640 Ga0495597_0100640_343_822 155
83 3300046542 Ga0495597_0157684 Ga0495597_0157684_365_844 155
84 3300046558 Ga0495633_0044952 Ga0495633_0044952_874_1353 155
85 3300046558 Ga0495633_0111838 Ga0495633_0111838_153_632 155
86 3300046558 Ga0495633_0243430 Ga0495633_0243430_284_763 155
87 3300046615 Ga0495656_0001972 Ga0495656_0001972_635_1114 155
88 3300046616 Ga0495668_0000045 Ga0495668_0000045_36333_36812 155
89 3300046616 Ga0495668_0013890 Ga0495668_0013890_2106_2585 155
90 3300046660 Ga0495625_0000065 Ga0495625_0000065_137686_138165 155
91 3300046660 Ga0495625_0027912 Ga0495625_0027912_301_780 155
92 3300046664 Ga0495659_0002529 Ga0495659_0002529_365_844 155
93 3300046665 Ga0495661_0049889 Ga0495661_0049889_1408_1887 155
94 3300046691 Ga0495670_0038070 Ga0495670_0038070_1597_2076 155
95 3300046691 Ga0495670_0492896 Ga0495670_0492896_122_601 155
96 3300046694 Ga0495649_0076699 Ga0495649_0076699_962_1441 155
97 3300046810 Ga0495660_0128877 Ga0495660_0128877_590_1069 155
98 3300047318 Ga0495636_0000537 Ga0495636_0000537_5260_5739 155
99 3300047318 Ga0495636_0005816 Ga0495636_0005816_2643_3122 155
100 3300047318 Ga0495636_0037481 Ga0495636_0037481_317_796 155
101 3300047443 Ga0495687_001099 Ga0495687_001099_7684_8163 155
102 3300047443 Ga0495687_001273 Ga0495687_001273_7679_8158 155
103 3300047443 Ga0495687_002986 Ga0495687_002986_5273_5752 155
104 3300047445 Ga0495677_0002369 Ga0495677_0002369_1760_2239 155
105 3300047445 Ga0495677_0302893 Ga0495677_0302893_138_617 155
106 3300047446 Ga0495679_020858 Ga0495679_020858_1743_2222 155
107 3300047447 Ga0495685_000307 Ga0495685_000307_8478_8957 155
108 3300048090 Ga0495615_0002597 Ga0495615_0002597_1720_2199 155
109 3300048091 Ga0495626_0003695 Ga0495626_0003695_6252_6731 155
110 3300048917 Ga0496114_0314115 Ga0496114_0314115_409_888 155
111 3300049459 Ga0495678_033503 Ga0495678_033503_453_932 155
112 3300049459 Ga0495678_112271 Ga0495678_112271_142_621 155
113 3300049571 Ga0501034_0735138 Ga0501034_0735138_302_775 155
114 3300050489 nmdc:mga03683_100415_c1 nmdc:mga03683_100415_c1_432_911 155
115 3300053094 Ga0500566_0030268 Ga0500566_0030268_122_589 155
116 iso_pu_bacteria 2513020051 2513228680 155
117 iso_pu_bacteria 2643221672 2644400379 155
118 iso_pu_bacteria 2643221683 2644468252 155
119 iso_pu_bacteria 2738541277 2738717815 155
120 iso_pu_bacteria 2738541307 2738879436 155
121 iso_pu_bacteria 2738543013 2739249426 155
122 iso_pu_bacteria 2738543019 2739278501 155
123 iso_pu_bacteria 2904541872 2904548342 155
124 iso_pu_bacteria 2928084124 2928084432 155
125 iso_pu_bacteria 2929160207 2929163332 155
126 3300001979 JGI24740J21852_10014352 JGI24740J21852_100143524 156
127 3300001989 JGI24739J22299_10005780 JGI24739J22299_100057801 156
128 3300002704 JGI25155J39150_1000062 JGI25155J39150_100006253 156
129 3300002705 JGI25156J39149_1000012 JGI25156J39149_1000012157 156
130 3300002738 JGI25154J39366_1000029 JGI25154J39366_100002914 156
131 3300002739 JGI25158J39367_1004986 JGI25158J39367_10049862 156
132 3300002741 JGI25157J39369_1000014 JGI25157J39369_1000014157 156
133 3300002773 JGI25152J39213_1001366 JGI25152J39213_10013662 156
134 3300002773 JGI25152J39213_1006035 JGI25152J39213_10060354 156
135 3300002774 JGI25150J39212_1000869 JGI25150J39212_10008696 156
136 3300002774 JGI25150J39212_1014431 JGI25150J39212_10144312 156
137 3300002987 JGI25159J45721_1000054 JGI25159J45721_100005434 156
138 3300002987 JGI25159J45721_1005152 JGI25159J45721_10051525 156
139 3300003187 JGI25151J46595_10000507 JGI25151J46595_1000050711 156
140 3300003187 JGI25151J46595_10002599 JGI25151J46595_100025992 156
141 3300003187 JGI25151J46595_10002870 JGI25151J46595_100028704 156
142 3300003187 JGI25151J46595_10004424 JGI25151J46595_100044244 156
143 3300003187 JGI25151J46595_10006031 JGI25151J46595_100060315 156
144 3300003187 JGI25151J46595_10006574 JGI25151J46595_100065743 156
145 3300003215 JGI25153J46596_10002045 JGI25153J46596_100020453 156
146 3300003322 rootL2_10020233 rootL2_100202333 156
147 3300003322 rootL2_10167114 rootL2_101671142 156
148 3300003323 rootH1_10030289 rootH1_100302893 156
149 3300003354 JGI25160J50197_1000088 JGI25160J50197_100008863 156
150 3300003354 JGI25160J50197_1000119 JGI25160J50197_100011934 156
151 3300003354 JGI25160J50197_1001065 JGI25160J50197_10010654 156
152 3300003354 JGI25160J50197_1005159 JGI25160J50197_10051592 156
153 3300003354 JGI25160J50197_1037137 JGI25160J50197_10371372 156
154 3300003374 JGI25161J50226_1000056 JGI25161J50226_100005634 156
155 3300003374 JGI25161J50226_1003182 JGI25161J50226_10031824 156
156 3300003758 Ga0055532_1013650 Ga0055532_10136502 156
157 3300003759 Ga0055525_1000001 Ga0055525_1000001883 156
158 3300003761 Ga0055535_1000286 Ga0055535_100028637 156
159 3300003761 Ga0055535_1001184 Ga0055535_100118410 156
160 3300003762 Ga0055542_1000080 Ga0055542_100008037 156
161 3300003762 Ga0055542_1001176 Ga0055542_10011763 156
162 3300003771 Ga0055526_1006187 Ga0055526_10061878 156
163 3300003771 Ga0055526_1011254 Ga0055526_10112542 156
164 3300003771 Ga0055526_1024874 Ga0055526_10248743 156
165 3300003771 Ga0055526_1024934 Ga0055526_10249343 156
166 3300003773 Ga0055537_1000024 Ga0055537_1000024106 156
167 3300003773 Ga0055537_1000047 Ga0055537_100004737 156
168 3300003773 Ga0055537_1001263 Ga0055537_10012639 156
169 3300003773 Ga0055537_1006648 Ga0055537_10066483 156
170 3300003773 Ga0055537_1007290 Ga0055537_10072902 156
171 3300003775 Ga0055524_1000039 Ga0055524_100003943 156
172 3300003775 Ga0055524_1008821 Ga0055524_10088212 156
173 3300003775 Ga0055524_1009148 Ga0055524_10091482 156
174 3300003781 Ga0055536_1002675 Ga0055536_10026757 156
175 3300003781 Ga0055536_1009284 Ga0055536_10092846 156
176 3300003781 Ga0055536_1009897 Ga0055536_10098972 156
177 3300003781 Ga0055536_1028754 Ga0055536_10287542 156
178 3300003784 Ga0055534_1000032 Ga0055534_1000032112 156
179 3300003784 Ga0055534_1000141 Ga0055534_100014124 156
180 3300003784 Ga0055534_1001229 Ga0055534_10012292 156
181 3300003784 Ga0055534_1002784 Ga0055534_10027843 156
182 3300003784 Ga0055534_1038206 Ga0055534_10382061 156
183 3300003790 Ga0055528_1002122 Ga0055528_10021221 156
184 3300003790 Ga0055528_1002521 Ga0055528_10025214 156
185 3300003790 Ga0055528_1002981 Ga0055528_10029816 156
186 3300003790 Ga0055528_1009497 Ga0055528_10094972 156
187 3300003791 Ga0055530_10000532 Ga0055530_1000053232 156
188 3300003791 Ga0055530_10002093 Ga0055530_100020938 156
189 3300003791 Ga0055530_10004782 Ga0055530_100047824 156
190 3300003791 Ga0055530_10022158 Ga0055530_100221582 156
191 3300003791 Ga0055530_10024142 Ga0055530_100241422 156
192 3300003791 Ga0055530_10053041 Ga0055530_100530412 156
193 3300003792 Ga0055540_1000047 Ga0055540_100004733 156
194 3300003792 Ga0055540_1000365 Ga0055540_100036531 156
195 3300003792 Ga0055540_1000440 Ga0055540_100044031 156
196 3300003792 Ga0055540_1002293 Ga0055540_100229313 156
197 3300003792 Ga0055540_1008010 Ga0055540_10080102 156
198 3300003794 Ga0055531_10000454 Ga0055531_1000045411 156
199 3300003794 Ga0055531_10011051 Ga0055531_100110512 156
200 3300003794 Ga0055531_10012021 Ga0055531_100120214 156
201 3300003794 Ga0055531_10012911 Ga0055531_100129112 156
202 3300003794 Ga0055531_10057654 Ga0055531_100576542 156
203 3300004625 Ga0055543_1000904 Ga0055543_10009049 156
204 3300004625 Ga0055543_1001077 Ga0055543_10010775 156
205 3300004625 Ga0055543_1001260 Ga0055543_10012609 156
206 3300005262 Ga0065165_1003589 Ga0065165_10035899 156
207 3300005262 Ga0065165_1005321 Ga0065165_10053213 156
208 3300005262 Ga0065165_1023989 Ga0065165_10239892 156
209 3300005262 Ga0065165_1024242 Ga0065165_10242423 156
210 3300005262 Ga0065165_1081429 Ga0065165_10814292 156
211 3300005288 Ga0065714_10066369 Ga0065714_100663694 156
212 3300005293 Ga0065715_10244020 Ga0065715_102440201 156
213 3300005295 Ga0065707_10087747 Ga0065707_100877475 156
214 3300005327 Ga0070658_10125538 Ga0070658_101255383 156
215 3300005327 Ga0070658_10176893 Ga0070658_101768931 156
216 3300005328 Ga0070676_10004494 Ga0070676_100044942 156
217 3300005328 Ga0070676_10032895 Ga0070676_100328952 156
218 3300005328 Ga0070676_10203602 Ga0070676_102036022 156
219 3300005328 Ga0070676_10285396 Ga0070676_102853962 156
220 3300005329 Ga0070683_100131089 Ga0070683_1001310893 156
221 3300005329 Ga0070683_100154993 Ga0070683_1001549933 156
222 3300005330 Ga0070690_100037460 Ga0070690_1000374603 156
223 3300005330 Ga0070690_100165870 Ga0070690_1001658702 156
224 3300005330 Ga0070690_101040912 Ga0070690_1010409121 156
225 3300005331 Ga0070670_100031372 Ga0070670_1000313723 156
226 3300005331 Ga0070670_100097851 Ga0070670_1000978512 156
227 3300005331 Ga0070670_100398756 Ga0070670_1003987562 156
228 3300005331 Ga0070670_100427560 Ga0070670_1004275602 156
229 3300005331 Ga0070670_100483723 Ga0070670_1004837232 156
230 3300005331 Ga0070670_100773935 Ga0070670_1007739352 156
231 3300005331 Ga0070670_101137033 Ga0070670_1011370332 156
232 3300005333 Ga0070677_10020521 Ga0070677_100205212 156
233 3300005333 Ga0070677_10096467 Ga0070677_100964672 156
234 3300005333 Ga0070677_10284039 Ga0070677_102840391 156
235 3300005333 Ga0070677_10352729 Ga0070677_103527292 156
236 3300005334 Ga0068869_100000109 Ga0068869_10000010923 156
237 3300005334 Ga0068869_100011409 Ga0068869_1000114091 156
238 3300005334 Ga0068869_100061469 Ga0068869_1000614692 156
239 3300005334 Ga0068869_100118296 Ga0068869_1001182962 156
240 3300005334 Ga0068869_100322628 Ga0068869_1003226282 156
241 3300005334 Ga0068869_100600166 Ga0068869_1006001661 156
242 3300005334 Ga0068869_101125485 Ga0068869_1011254851 156
243 3300005335 Ga0070666_10006231 Ga0070666_100062313 156
244 3300005335 Ga0070666_10009271 Ga0070666_100092713 156
245 3300005335 Ga0070666_10146619 Ga0070666_101466191 156
246 3300005335 Ga0070666_10772301 Ga0070666_107723011 156
247 3300005336 Ga0070680_100063118 Ga0070680_1000631183 156
248 3300005337 Ga0070682_100473027 Ga0070682_1004730273 156
249 3300005338 Ga0068868_100000928 Ga0068868_10000092815 156
250 3300005338 Ga0068868_100002606 Ga0068868_1000026063 156
251 3300005338 Ga0068868_100009104 Ga0068868_1000091045 156
252 3300005338 Ga0068868_100043506 Ga0068868_1000435063 156
253 3300005338 Ga0068868_100068559 Ga0068868_1000685592 156
254 3300005338 Ga0068868_100094776 Ga0068868_1000947764 156
255 3300005338 Ga0068868_100327397 Ga0068868_1003273972 156
256 3300005338 Ga0068868_100618047 Ga0068868_1006180472 156
257 3300005338 Ga0068868_101543346 Ga0068868_1015433461 156
258 3300005339 Ga0070660_100102495 Ga0070660_1001024952 156
259 3300005339 Ga0070660_100113595 Ga0070660_1001135952 156
260 3300005339 Ga0070660_101555058 Ga0070660_1015550581 156
261 3300005343 Ga0070687_100121070 Ga0070687_1001210702 156
262 3300005344 Ga0070661_100071384 Ga0070661_1000713844 156
263 3300005344 Ga0070661_100098854 Ga0070661_1000988542 156
264 3300005344 Ga0070661_100098982 Ga0070661_1000989822 156
265 3300005344 Ga0070661_100760848 Ga0070661_1007608482 156
266 3300005345 Ga0070692_10314546 Ga0070692_103145462 156
267 3300005345 Ga0070692_10769411 Ga0070692_107694111 156
268 3300005347 Ga0070668_100005748 Ga0070668_1000057485 156
269 3300005347 Ga0070668_100493696 Ga0070668_1004936962 156
270 3300005347 Ga0070668_100612524 Ga0070668_1006125241 156
271 3300005353 Ga0070669_100003867 Ga0070669_1000038678 156
272 3300005353 Ga0070669_100032291 Ga0070669_1000322915 156
273 3300005353 Ga0070669_100096210 Ga0070669_1000962102 156
274 3300005353 Ga0070669_100206889 Ga0070669_1002068892 156
275 3300005353 Ga0070669_100516365 Ga0070669_1005163651 156
276 3300005353 Ga0070669_101115792 Ga0070669_1011157921 156
277 3300005354 Ga0070675_100000772 Ga0070675_10000077218 156
278 3300005354 Ga0070675_100018873 Ga0070675_1000188732 156
279 3300005354 Ga0070675_100038290 Ga0070675_1000382902 156
280 3300005354 Ga0070675_100145426 Ga0070675_1001454262 156
281 3300005354 Ga0070675_100224640 Ga0070675_1002246402 156
282 3300005354 Ga0070675_100348796 Ga0070675_1003487962 156
283 3300005354 Ga0070675_100485372 Ga0070675_1004853722 156
284 3300005355 Ga0070671_100006491 Ga0070671_1000064917 156
285 3300005355 Ga0070671_100011811 Ga0070671_1000118114 156
286 3300005355 Ga0070671_100030752 Ga0070671_1000307523 156
287 3300005355 Ga0070671_100127377 Ga0070671_1001273772 156
288 3300005355 Ga0070671_100249854 Ga0070671_1002498543 156
289 3300005355 Ga0070671_100411541 Ga0070671_1004115412 156
290 3300005355 Ga0070671_100422072 Ga0070671_1004220722 156
291 3300005356 Ga0070674_100014173 Ga0070674_1000141733 156
292 3300005356 Ga0070674_100146038 Ga0070674_1001460381 156
293 3300005364 Ga0070673_100007669 Ga0070673_1000076694 156
294 3300005364 Ga0070673_100077501 Ga0070673_1000775013 156
295 3300005364 Ga0070673_100086947 Ga0070673_1000869471 156
296 3300005364 Ga0070673_100129628 Ga0070673_1001296281 156
297 3300005364 Ga0070673_100229881 Ga0070673_1002298812 156
298 3300005364 Ga0070673_100316352 Ga0070673_1003163522 156
299 3300005364 Ga0070673_100434024 Ga0070673_1004340241 156
300 3300005364 Ga0070673_100496870 Ga0070673_1004968702 156
301 3300005364 Ga0070673_100653681 Ga0070673_1006536812 156
302 3300005364 Ga0070673_100825658 Ga0070673_1008256582 156
303 3300005364 Ga0070673_100853490 Ga0070673_1008534902 156
304 3300005364 Ga0070673_100926170 Ga0070673_1009261702 156
305 3300005364 Ga0070673_101190219 Ga0070673_1011902192 156
306 3300005365 Ga0070688_100026856 Ga0070688_1000268562 156
307 3300005366 Ga0070659_100015164 Ga0070659_1000151647 156
308 3300005366 Ga0070659_100114676 Ga0070659_1001146763 156
309 3300005366 Ga0070659_100198344 Ga0070659_1001983441 156
310 3300005366 Ga0070659_101053265 Ga0070659_1010532651 156
311 3300005367 Ga0070667_100005806 Ga0070667_1000058061 156
312 3300005367 Ga0070667_100007096 Ga0070667_1000070964 156
313 3300005367 Ga0070667_100064974 Ga0070667_1000649743 156
314 3300005367 Ga0070667_100125372 Ga0070667_1001253723 156
315 3300005367 Ga0070667_100188883 Ga0070667_1001888832 156
316 3300005367 Ga0070667_100484550 Ga0070667_1004845502 156
317 3300005367 Ga0070667_100999049 Ga0070667_1009990491 156
318 3300005367 Ga0070667_101222092 Ga0070667_1012220921 156
319 3300005438 Ga0070701_10383946 Ga0070701_103839461 156
320 3300005445 Ga0070708_100135616 Ga0070708_1001356163 156
321 3300005455 Ga0070663_100003925 Ga0070663_1000039252 156
322 3300005455 Ga0070663_100313932 Ga0070663_1003139321 156
323 3300005455 Ga0070663_100371878 Ga0070663_1003718782 156
324 3300005456 Ga0070678_100004609 Ga0070678_1000046097 156
325 3300005456 Ga0070678_100035270 Ga0070678_1000352703 156
326 3300005456 Ga0070678_100420817 Ga0070678_1004208173 156
327 3300005456 Ga0070678_101010441 Ga0070678_1010104412 156
328 3300005457 Ga0070662_100000552 Ga0070662_10000055216 156
329 3300005457 Ga0070662_100003920 Ga0070662_1000039207 156
330 3300005457 Ga0070662_100032880 Ga0070662_1000328802 156
331 3300005457 Ga0070662_100160037 Ga0070662_1001600372 156
332 3300005457 Ga0070662_100452663 Ga0070662_1004526632 156
333 3300005457 Ga0070662_100587568 Ga0070662_1005875682 156
334 3300005459 Ga0068867_100000186 Ga0068867_10000018626 156
335 3300005459 Ga0068867_100005611 Ga0068867_1000056113 156
336 3300005459 Ga0068867_100033298 Ga0068867_1000332982 156
337 3300005459 Ga0068867_100064019 Ga0068867_1000640193 156
338 3300005459 Ga0068867_100259388 Ga0068867_1002593881 156
339 3300005459 Ga0068867_100279964 Ga0068867_1002799642 156
340 3300005459 Ga0068867_100316881 Ga0068867_1003168812 156
341 3300005459 Ga0068867_100459729 Ga0068867_1004597292 156
342 3300005459 Ga0068867_100633974 Ga0068867_1006339742 156
343 3300005459 Ga0068867_100832172 Ga0068867_1008321721 156
344 3300005459 Ga0068867_100867902 Ga0068867_1008679022 156
345 3300005459 Ga0068867_100928701 Ga0068867_1009287011 156
346 3300005466 Ga0070685_10147935 Ga0070685_101479352 156
347 3300005467 Ga0070706_100017115 Ga0070706_1000171152 156
348 3300005467 Ga0070706_100960143 Ga0070706_1009601431 156
349 3300005467 Ga0070706_101871002 Ga0070706_1018710021 156
350 3300005468 Ga0070707_100064439 Ga0070707_1000644392 156
351 3300005468 Ga0070707_100154296 Ga0070707_1001542962 156
352 3300005518 Ga0070699_100116427 Ga0070699_1001164272 156
353 3300005530 Ga0070679_100003825 Ga0070679_1000038259 156
354 3300005535 Ga0070684_100023555 Ga0070684_1000235554 156
355 3300005535 Ga0070684_100248441 Ga0070684_1002484412 156
356 3300005539 Ga0068853_100011884 Ga0068853_1000118844 156
357 3300005539 Ga0068853_100059570 Ga0068853_1000595703 156
358 3300005539 Ga0068853_100189341 Ga0068853_1001893413 156
359 3300005539 Ga0068853_100437457 Ga0068853_1004374572 156
360 3300005539 Ga0068853_100898155 Ga0068853_1008981551 156
361 3300005539 Ga0068853_101606701 Ga0068853_1016067011 156
362 3300005543 Ga0070672_100010739 Ga0070672_1000107397 156
363 3300005543 Ga0070672_100016252 Ga0070672_1000162524 156
364 3300005543 Ga0070672_100027229 Ga0070672_1000272293 156
365 3300005543 Ga0070672_100055551 Ga0070672_1000555516 156
366 3300005543 Ga0070672_100164157 Ga0070672_1001641573 156
367 3300005543 Ga0070672_100228801 Ga0070672_1002288012 156
368 3300005543 Ga0070672_100245988 Ga0070672_1002459883 156
369 3300005543 Ga0070672_100369800 Ga0070672_1003698002 156
370 3300005543 Ga0070672_100389330 Ga0070672_1003893302 156
371 3300005543 Ga0070672_100739793 Ga0070672_1007397932 156
372 3300005543 Ga0070672_101241462 Ga0070672_1012414622 156
373 3300005547 Ga0070693_100763512 Ga0070693_1007635121 156
374 3300005548 Ga0070665_100043405 Ga0070665_1000434055 156
375 3300005548 Ga0070665_100144705 Ga0070665_1001447052 156
376 3300005548 Ga0070665_100278353 Ga0070665_1002783532 156
377 3300005548 Ga0070665_100509410 Ga0070665_1005094102 156
378 3300005548 Ga0070665_100668795 Ga0070665_1006687953 156
379 3300005563 Ga0068855_100015116 Ga0068855_1000151165 156
380 3300005563 Ga0068855_100047998 Ga0068855_1000479983 156
381 3300005563 Ga0068855_100173929 Ga0068855_1001739292 156
382 3300005564 Ga0070664_100006998 Ga0070664_1000069985 156
383 3300005564 Ga0070664_100116860 Ga0070664_1001168603 156
384 3300005564 Ga0070664_100211556 Ga0070664_1002115562 156
385 3300005564 Ga0070664_100219576 Ga0070664_1002195763 156
386 3300005564 Ga0070664_100325032 Ga0070664_1003250323 156
387 3300005564 Ga0070664_100769040 Ga0070664_1007690401 156
388 3300005564 Ga0070664_101313837 Ga0070664_1013138371 156
389 3300005577 Ga0068857_100053902 Ga0068857_1000539023 156
390 3300005577 Ga0068857_100134323 Ga0068857_1001343232 156
391 3300005577 Ga0068857_100162697 Ga0068857_1001626973 156
392 3300005577 Ga0068857_100298227 Ga0068857_1002982273 156
393 3300005578 Ga0068854_100048398 Ga0068854_1000483984 156
394 3300005578 Ga0068854_100084591 Ga0068854_1000845914 156
395 3300005578 Ga0068854_100120987 Ga0068854_1001209873 156
396 3300005578 Ga0068854_100694332 Ga0068854_1006943321 156
397 3300005578 Ga0068854_100841142 Ga0068854_1008411422 156
398 3300005578 Ga0068854_100935849 Ga0068854_1009358492 156
399 3300005614 Ga0068856_100069854 Ga0068856_1000698545 156
400 3300005614 Ga0068856_100139123 Ga0068856_1001391232 156
401 3300005614 Ga0068856_100226628 Ga0068856_1002266282 156
402 3300005614 Ga0068856_101093590 Ga0068856_1010935902 156
403 3300005615 Ga0070702_100026507 Ga0070702_1000265072 156
404 3300005616 Ga0068852_100012691 Ga0068852_1000126911 156
405 3300005616 Ga0068852_100014348 Ga0068852_1000143485 156
406 3300005616 Ga0068852_100018466 Ga0068852_1000184662 156
407 3300005616 Ga0068852_100097562 Ga0068852_1000975622 156
408 3300005616 Ga0068852_100227802 Ga0068852_1002278022 156
409 3300005616 Ga0068852_100250838 Ga0068852_1002508382 156
410 3300005616 Ga0068852_100274059 Ga0068852_1002740592 156
411 3300005616 Ga0068852_100517269 Ga0068852_1005172692 156
412 3300005616 Ga0068852_100913899 Ga0068852_1009138991 156
413 3300005616 Ga0068852_100919057 Ga0068852_1009190572 156
414 3300005617 Ga0068859_100141793 Ga0068859_1001417933 156
415 3300005617 Ga0068859_100260379 Ga0068859_1002603793 156
416 3300005617 Ga0068859_100306399 Ga0068859_1003063992 156
417 3300005617 Ga0068859_100870067 Ga0068859_1008700673 156
418 3300005618 Ga0068864_100000270 Ga0068864_1000002704 156
419 3300005618 Ga0068864_100010659 Ga0068864_1000106592 156
420 3300005618 Ga0068864_100053816 Ga0068864_1000538163 156
421 3300005618 Ga0068864_100065725 Ga0068864_1000657253 156
422 3300005618 Ga0068864_100207736 Ga0068864_1002077362 156
423 3300005618 Ga0068864_100837819 Ga0068864_1008378192 156
424 3300005718 Ga0068866_10001571 Ga0068866_100015715 156
425 3300005718 Ga0068866_10148194 Ga0068866_101481943 156
426 3300005718 Ga0068866_10554989 Ga0068866_105549892 156
427 3300005719 Ga0068861_100000126 Ga0068861_10000012623 156
428 3300005719 Ga0068861_100006858 Ga0068861_1000068585 156
429 3300005719 Ga0068861_100802485 Ga0068861_1008024851 156
430 3300005834 Ga0068851_10012812 Ga0068851_100128125 156
431 3300005834 Ga0068851_10019913 Ga0068851_100199132 156
432 3300005834 Ga0068851_10072851 Ga0068851_100728512 156
433 3300005834 Ga0068851_10090524 Ga0068851_100905242 156
434 3300005834 Ga0068851_10325795 Ga0068851_103257952 156
435 3300005840 Ga0068870_10115031 Ga0068870_101150312 156
436 3300005840 Ga0068870_10212735 Ga0068870_102127352 156
437 3300005841 Ga0068863_100000679 Ga0068863_1000006792 156
438 3300005841 Ga0068863_100022577 Ga0068863_1000225774 156
439 3300005841 Ga0068863_100136576 Ga0068863_1001365763 156
440 3300005841 Ga0068863_100227727 Ga0068863_1002277272 156
441 3300005841 Ga0068863_100259471 Ga0068863_1002594712 156
442 3300005841 Ga0068863_100366894 Ga0068863_1003668943 156
443 3300005841 Ga0068863_101408982 Ga0068863_1014089822 156
444 3300005842 Ga0068858_100000225 Ga0068858_1000002254 156
445 3300005842 Ga0068858_100006184 Ga0068858_1000061845 156
446 3300005842 Ga0068858_100011807 Ga0068858_1000118075 156
447 3300005843 Ga0068860_100010530 Ga0068860_1000105306 156
448 3300005843 Ga0068860_100025113 Ga0068860_1000251134 156
449 3300005843 Ga0068860_100071695 Ga0068860_1000716953 156
450 3300005843 Ga0068860_100224709 Ga0068860_1002247092 156
451 3300005843 Ga0068860_100372691 Ga0068860_1003726911 156
452 3300005843 Ga0068860_100678258 Ga0068860_1006782582 156
453 3300005844 Ga0068862_100091077 Ga0068862_1000910774 156
454 3300005844 Ga0068862_100215452 Ga0068862_1002154522 156
455 3300005844 Ga0068862_100274253 Ga0068862_1002742532 156
456 3300005844 Ga0068862_100921771 Ga0068862_1009217711 156
457 3300006028 Ga0070717_11108428 Ga0070717_111084282 156
458 3300006038 Ga0075365_10040246 Ga0075365_100402463 156
459 3300006042 Ga0075368_10019359 Ga0075368_100193592 156
460 3300006048 Ga0075363_100002613 Ga0075363_1000026132 156
461 3300006048 Ga0075363_100098285 Ga0075363_1000982852 156
462 3300006048 Ga0075363_100173312 Ga0075363_1001733121 156
463 3300006048 Ga0075363_100282609 Ga0075363_1002826092 156
464 3300006048 Ga0075363_100397393 Ga0075363_1003973932 156
465 3300006051 Ga0075364_10154827 Ga0075364_101548273 156
466 3300006058 Ga0075432_10028831 Ga0075432_100288311 156
467 3300006058 Ga0075432_10186761 Ga0075432_101867612 156
468 3300006173 Ga0070716_100528969 Ga0070716_1005289691 156
469 3300006177 Ga0075362_10006845 Ga0075362_100068453 156
470 3300006177 Ga0075362_10012721 Ga0075362_100127213 156
471 3300006177 Ga0075362_10027255 Ga0075362_100272553 156
472 3300006177 Ga0075362_10027795 Ga0075362_100277954 156
473 3300006177 Ga0075362_10036217 Ga0075362_100362172 156
474 3300006177 Ga0075362_10078719 Ga0075362_100787192 156
475 3300006177 Ga0075362_10101318 Ga0075362_101013182 156
476 3300006177 Ga0075362_10265553 Ga0075362_102655531 156
477 3300006177 Ga0075362_10268680 Ga0075362_102686802 156
478 3300006177 Ga0075362_10462436 Ga0075362_104624361 156
479 3300006177 Ga0075362_10620995 Ga0075362_106209951 156
480 3300006178 Ga0075367_10003489 Ga0075367_100034893 156
481 3300006178 Ga0075367_10023278 Ga0075367_100232784 156
482 3300006178 Ga0075367_10065241 Ga0075367_100652412 156
483 3300006178 Ga0075367_10086899 Ga0075367_100868994 156
484 3300006178 Ga0075367_10485085 Ga0075367_104850852 156
485 3300006186 Ga0075369_10028290 Ga0075369_100282902 156
486 3300006186 Ga0075369_10053864 Ga0075369_100538643 156
487 3300006186 Ga0075369_10127102 Ga0075369_101271021 156
488 3300006195 Ga0075366_10000903 Ga0075366_1000090317 156
489 3300006195 Ga0075366_10004367 Ga0075366_100043676 156
490 3300006195 Ga0075366_10005063 Ga0075366_1000506310 156
491 3300006195 Ga0075366_10005254 Ga0075366_100052549 156
492 3300006195 Ga0075366_10020888 Ga0075366_100208882 156
493 3300006195 Ga0075366_10024928 Ga0075366_100249282 156
494 3300006195 Ga0075366_10063986 Ga0075366_100639863 156
495 3300006195 Ga0075366_10076436 Ga0075366_100764363 156
496 3300006195 Ga0075366_10088553 Ga0075366_100885532 156
497 3300006195 Ga0075366_10089581 Ga0075366_100895813 156
498 3300006195 Ga0075366_10103288 Ga0075366_101032883 156
499 3300006195 Ga0075366_10108492 Ga0075366_101084922 156
500 3300006195 Ga0075366_10177989 Ga0075366_101779892 156
501 3300006195 Ga0075366_10205769 Ga0075366_102057692 156
502 3300006195 Ga0075366_10209479 Ga0075366_102094791 156
503 3300006195 Ga0075366_10233960 Ga0075366_102339602 156
504 3300006195 Ga0075366_10310856 Ga0075366_103108561 156
505 3300006195 Ga0075366_10341979 Ga0075366_103419792 156
506 3300006195 Ga0075366_10408676 Ga0075366_104086761 156
507 3300006195 Ga0075366_10553356 Ga0075366_105533562 156
508 3300006195 Ga0075366_10562262 Ga0075366_105622622 156
509 3300006195 Ga0075366_10938001 Ga0075366_109380011 156
510 3300006195 Ga0075366_10968446 Ga0075366_109684461 156
511 3300006237 Ga0097621_100060271 Ga0097621_1000602715 156
512 3300006237 Ga0097621_100178814 Ga0097621_1001788143 156
513 3300006237 Ga0097621_100226196 Ga0097621_1002261962 156
514 3300006237 Ga0097621_100321941 Ga0097621_1003219412 156
515 3300006237 Ga0097621_100417698 Ga0097621_1004176983 156
516 3300006237 Ga0097621_100423384 Ga0097621_1004233843 156
517 3300006353 Ga0075370_10001385 Ga0075370_100013858 156
518 3300006353 Ga0075370_10003497 Ga0075370_100034972 156
519 3300006353 Ga0075370_10006662 Ga0075370_100066624 156
520 3300006353 Ga0075370_10008356 Ga0075370_100083562 156
521 3300006353 Ga0075370_10009388 Ga0075370_100093887 156
522 3300006353 Ga0075370_10011977 Ga0075370_100119773 156
523 3300006353 Ga0075370_10021716 Ga0075370_100217162 156
524 3300006353 Ga0075370_10041399 Ga0075370_100413993 156
525 3300006353 Ga0075370_10072521 Ga0075370_100725213 156
526 3300006353 Ga0075370_10079534 Ga0075370_100795341 156
527 3300006353 Ga0075370_10159946 Ga0075370_101599462 156
528 3300006353 Ga0075370_10169808 Ga0075370_101698081 156
529 3300006353 Ga0075370_10221285 Ga0075370_102212852 156
530 3300006353 Ga0075370_10264415 Ga0075370_102644152 156
531 3300006353 Ga0075370_10393622 Ga0075370_103936222 156
532 3300006353 Ga0075370_10518841 Ga0075370_105188412 156
533 3300006358 Ga0068871_100026429 Ga0068871_1000264292 156
534 3300006358 Ga0068871_100044440 Ga0068871_1000444403 156
535 3300006358 Ga0068871_100060141 Ga0068871_1000601415 156
536 3300006358 Ga0068871_100186123 Ga0068871_1001861232 156
537 3300006358 Ga0068871_100412930 Ga0068871_1004129302 156
538 3300006358 Ga0068871_100705121 Ga0068871_1007051212 156
539 3300006358 Ga0068871_100816192 Ga0068871_1008161922 156
540 3300006846 Ga0075430_100464806 Ga0075430_1004648061 156
541 3300006846 Ga0075430_100742798 Ga0075430_1007427982 156
542 3300006871 Ga0075434_100258587 Ga0075434_1002585871 156
543 3300006881 Ga0068865_100031632 Ga0068865_1000316322 156
544 3300006881 Ga0068865_100242195 Ga0068865_1002421952 156
545 3300006881 Ga0068865_100360419 Ga0068865_1003604193 156
546 3300006881 Ga0068865_100717727 Ga0068865_1007177272 156
547 3300006931 Ga0097620_100141795 Ga0097620_1001417953 156
548 3300006931 Ga0097620_100260380 Ga0097620_1002603802 156
549 3300006931 Ga0097620_100306401 Ga0097620_1003064012 156
550 3300006931 Ga0097620_100870165 Ga0097620_1008701653 156
551 3300007076 Ga0075435_100684643 Ga0075435_1006846432 156
552 3300009036 Ga0105244_10002369 Ga0105244_1000236912 156
553 3300009036 Ga0105244_10080538 Ga0105244_100805381 156
554 3300009093 Ga0105240_10044244 Ga0105240_100442442 156
555 3300009093 Ga0105240_10376389 Ga0105240_103763892 156
556 3300009093 Ga0105240_11666270 Ga0105240_116662701 156
557 3300009094 Ga0111539_10496588 Ga0111539_104965882 156
558 3300009094 Ga0111539_11076507 Ga0111539_110765072 156
559 3300009098 Ga0105245_10011498 Ga0105245_100114988 156
560 3300009098 Ga0105245_10044575 Ga0105245_100445752 156
561 3300009098 Ga0105245_10429981 Ga0105245_104299813 156
562 3300009098 Ga0105245_10478639 Ga0105245_104786392 156
563 3300009098 Ga0105245_10578857 Ga0105245_105788572 156
564 3300009098 Ga0105245_10587549 Ga0105245_105875492 156
565 3300009098 Ga0105245_11031379 Ga0105245_110313792 156
566 3300009101 Ga0105247_10783640 Ga0105247_107836401 156
567 3300009148 Ga0105243_10002142 Ga0105243_1000214214 156
568 3300009148 Ga0105243_10002791 Ga0105243_100027918 156
569 3300009148 Ga0105243_10006295 Ga0105243_100062957 156
570 3300009148 Ga0105243_10066462 Ga0105243_100664622 156
571 3300009148 Ga0105243_10195426 Ga0105243_101954263 156
572 3300009148 Ga0105243_10211999 Ga0105243_102119991 156
573 3300009148 Ga0105243_10307811 Ga0105243_103078113 156
574 3300009148 Ga0105243_10529961 Ga0105243_105299611 156
575 3300009148 Ga0105243_10626920 Ga0105243_106269202 156
576 3300009148 Ga0105243_10824709 Ga0105243_108247092 156
577 3300009148 Ga0105243_11023162 Ga0105243_110231622 156
578 3300009174 Ga0105241_10207015 Ga0105241_102070151 156
579 3300009174 Ga0105241_10680647 Ga0105241_106806472 156
580 3300009174 Ga0105241_11448252 Ga0105241_114482521 156
581 3300009176 Ga0105242_10179763 Ga0105242_101797633 156
582 3300009176 Ga0105242_10785592 Ga0105242_107855922 156
583 3300009176 Ga0105242_10798183 Ga0105242_107981832 156
584 3300009176 Ga0105242_11464865 Ga0105242_114648652 156
585 3300009177 Ga0105248_10020776 Ga0105248_100207764 156
586 3300009177 Ga0105248_10069162 Ga0105248_100691623 156
587 3300009177 Ga0105248_10103800 Ga0105248_101038003 156
588 3300009177 Ga0105248_10140104 Ga0105248_101401043 156
589 3300009177 Ga0105248_10223348 Ga0105248_102233482 156
590 3300009177 Ga0105248_10381645 Ga0105248_103816452 156
591 3300009177 Ga0105248_11065491 Ga0105248_110654912 156
592 3300009177 Ga0105248_11365687 Ga0105248_113656872 156
593 3300009545 Ga0105237_10038448 Ga0105237_100384484 156
594 3300009545 Ga0105237_10210367 Ga0105237_102103672 156
595 3300009545 Ga0105237_10211438 Ga0105237_102114383 156
596 3300009545 Ga0105237_10584019 Ga0105237_105840192 156
597 3300009545 Ga0105237_11719452 Ga0105237_117194522 156
598 3300009551 Ga0105238_10007445 Ga0105238_100074456 156
599 3300009551 Ga0105238_10237419 Ga0105238_102374193 156
600 3300009551 Ga0105238_10554246 Ga0105238_105542463 156
601 3300009551 Ga0105238_10765782 Ga0105238_107657822 156
602 3300009551 Ga0105238_12092877 Ga0105238_120928772 156
603 3300009553 Ga0105249_10020223 Ga0105249_100202235 156
604 3300009553 Ga0105249_10255488 Ga0105249_102554883 156
605 3300009553 Ga0105249_10511243 Ga0105249_105112433 156
606 3300010375 Ga0105239_10008553 Ga0105239_100085533 156
607 3300010375 Ga0105239_10014688 Ga0105239_100146887 156
608 3300010375 Ga0105239_10178863 Ga0105239_101788632 156
609 3300010375 Ga0105239_11428694 Ga0105239_114286942 156
610 3300010375 Ga0105239_11885533 Ga0105239_118855332 156
611 3300011119 Ga0105246_10116212 Ga0105246_101162122 156
612 3300011119 Ga0105246_10261339 Ga0105246_102613392 156
613 3300011119 Ga0105246_11072474 Ga0105246_110724742 156
614 3300011119 Ga0105246_11128730 Ga0105246_111287301 156
615 3300012502 Ga0157347_1007959 Ga0157347_10079592 156
616 3300013100 Ga0157373_10000764 Ga0157373_1000076420 156
617 3300013100 Ga0157373_10073883 Ga0157373_100738832 156
618 3300013100 Ga0157373_10289715 Ga0157373_102897152 156
619 3300013102 Ga0157371_10102848 Ga0157371_101028483 156
620 3300013102 Ga0157371_10524539 Ga0157371_105245391 156
621 3300013102 Ga0157371_10891869 Ga0157371_108918692 156
622 3300013104 Ga0157370_10005548 Ga0157370_100055488 156
623 3300013104 Ga0157370_10925268 Ga0157370_109252682 156
624 3300013296 Ga0157374_10149927 Ga0157374_101499272 156
625 3300013296 Ga0157374_10576304 Ga0157374_105763042 156
626 3300013296 Ga0157374_11938732 Ga0157374_119387321 156
627 3300013297 Ga0157378_10204597 Ga0157378_102045972 156
628 3300013297 Ga0157378_10702504 Ga0157378_107025042 156
629 3300013306 Ga0163162_10010080 Ga0163162_100100807 156
630 3300013306 Ga0163162_10077396 Ga0163162_100773964 156
631 3300013306 Ga0163162_10093880 Ga0163162_100938802 156
632 3300013306 Ga0163162_10203206 Ga0163162_102032063 156
633 3300013306 Ga0163162_10242856 Ga0163162_102428562 156
634 3300013306 Ga0163162_10909509 Ga0163162_109095092 156
635 3300013307 Ga0157372_10024604 Ga0157372_100246045 156
636 3300013307 Ga0157372_10276250 Ga0157372_102762503 156
637 3300013308 Ga0157375_10010897 Ga0157375_100108973 156
638 3300013308 Ga0157375_10014628 Ga0157375_100146283 156
639 3300013308 Ga0157375_10051979 Ga0157375_100519794 156
640 3300013308 Ga0157375_10159166 Ga0157375_101591662 156
641 3300013308 Ga0157375_10277498 Ga0157375_102774983 156
642 3300013308 Ga0157375_10364097 Ga0157375_103640972 156
643 3300013308 Ga0157375_10404100 Ga0157375_104041002 156
644 3300013308 Ga0157375_10524196 Ga0157375_105241962 156
645 3300013308 Ga0157375_10626044 Ga0157375_106260442 156
646 3300013308 Ga0157375_10688444 Ga0157375_106884443 156
647 3300014325 Ga0163163_10004422 Ga0163163_100044223 156
648 3300014325 Ga0163163_10961423 Ga0163163_109614232 156
649 3300014326 Ga0157380_10001564 Ga0157380_100015643 156
650 3300014326 Ga0157380_10016118 Ga0157380_100161183 156
651 3300014326 Ga0157380_10343089 Ga0157380_103430891 156
652 3300014326 Ga0157380_11397059 Ga0157380_113970592 156
653 3300014497 Ga0182008_10000794 Ga0182008_1000079423 156
654 3300014497 Ga0182008_10043908 Ga0182008_100439083 156
655 3300014497 Ga0182008_10053057 Ga0182008_100530572 156
656 3300014745 Ga0157377_10000464 Ga0157377_1000046412 156
657 3300014745 Ga0157377_10074914 Ga0157377_100749142 156
658 3300014745 Ga0157377_10124000 Ga0157377_101240002 156
659 3300014968 Ga0157379_10005033 Ga0157379_100050334 156
660 3300014968 Ga0157379_10012124 Ga0157379_100121246 156
661 3300014968 Ga0157379_10040104 Ga0157379_100401043 156
662 3300014968 Ga0157379_10304460 Ga0157379_103044601 156
663 3300014969 Ga0157376_10001974 Ga0157376_100019748 156
664 3300014969 Ga0157376_10012956 Ga0157376_100129566 156
665 3300014969 Ga0157376_10787806 Ga0157376_107878062 156
666 3300014969 Ga0157376_11260089 Ga0157376_112600891 156
667 3300014969 Ga0157376_11488441 Ga0157376_114884412 156
668 3300014969 Ga0157376_11808905 Ga0157376_118089051 156
669 3300015261 Ga0182006_1000690 Ga0182006_100069024 156
670 3300015262 Ga0182007_10004716 Ga0182007_100047165 156
671 3300015262 Ga0182007_10006853 Ga0182007_100068535 156
672 3300015262 Ga0182007_10394058 Ga0182007_103940581 156
673 3300015265 Ga0182005_1027614 Ga0182005_10276142 156
674 3300015265 Ga0182005_1082344 Ga0182005_10823441 156
675 3300015683 Ga0183362_10002 Ga0183362_1000240 156
676 3300017792 Ga0163161_10000161 Ga0163161_1000016124 156
677 3300017792 Ga0163161_10016112 Ga0163161_100161121 156
678 3300017792 Ga0163161_10039405 Ga0163161_100394054 156
679 3300017792 Ga0163161_10067154 Ga0163161_100671543 156
680 3300017792 Ga0163161_10071647 Ga0163161_100716473 156
681 3300017792 Ga0163161_10341235 Ga0163161_103412352 156
682 3300017792 Ga0163161_10352220 Ga0163161_103522201 156
683 3300017792 Ga0163161_10851943 Ga0163161_108519432 156
684 3300021377 Ga0213874_10130485 Ga0213874_101304852 156
685 3300021384 Ga0213876_10101220 Ga0213876_101012202 156
686 3300025206 Ga0209435_100002 Ga0209435_100002560 156
687 3300025208 Ga0209436_103397 Ga0209436_1033972 156
688 3300025208 Ga0209436_106002 Ga0209436_1060021 156
689 3300025228 Ga0209672_100711 Ga0209672_1007114 156
690 3300025228 Ga0209672_101238 Ga0209672_1012383 156
691 3300025229 Ga0209147_100450 Ga0209147_1004508 156
692 3300025229 Ga0209147_103013 Ga0209147_1030132 156
693 3300025230 Ga0209563_100007 Ga0209563_100007216 156
694 3300025242 Ga0209258_100093 Ga0209258_10009374 156
695 3300025242 Ga0209258_100519 Ga0209258_10051912 156
696 3300025245 Ga0207425_1001011 Ga0207425_10010116 156
697 3300025245 Ga0207425_1001306 Ga0207425_10013069 156
698 3300025245 Ga0207425_1004714 Ga0207425_10047142 156
699 3300025245 Ga0207425_1022335 Ga0207425_10223351 156
700 3300025245 Ga0207425_1023670 Ga0207425_10236703 156
701 3300025245 Ga0207425_1038846 Ga0207425_10388462 156
702 3300025245 Ga0207425_1053424 Ga0207425_10534242 156
703 3300025246 Ga0209646_1000001 Ga0209646_10000012703 156
704 3300025250 Ga0209026_1000040 Ga0209026_100004072 156
705 3300025253 Ga0209677_109163 Ga0209677_1091632 156
706 3300025254 Ga0209148_1000007 Ga0209148_10000071041 156
707 3300025254 Ga0209148_1000067 Ga0209148_100006723 156
708 3300025254 Ga0209148_1000440 Ga0209148_100044014 156
709 3300025256 Ga0209759_1000001 Ga0209759_10000012334 156
710 3300025258 Ga0209129_1000024 Ga0209129_100002436 156
711 3300025258 Ga0209129_1001645 Ga0209129_10016453 156
712 3300025258 Ga0209129_1008680 Ga0209129_10086804 156
713 3300025258 Ga0209129_1016572 Ga0209129_10165722 156
714 3300025258 Ga0209129_1017663 Ga0209129_10176632 156
715 3300025258 Ga0209129_1035134 Ga0209129_10351342 156
716 3300025263 Ga0209565_1000039 Ga0209565_1000039112 156
717 3300025263 Ga0209565_1000080 Ga0209565_100008038 156
718 3300025263 Ga0209565_1000583 Ga0209565_10005839 156
719 3300025263 Ga0209565_1000645 Ga0209565_100064512 156
720 3300025263 Ga0209565_1000876 Ga0209565_100087612 156
721 3300025273 Ga0209673_1000088 Ga0209673_1000088108 156
722 3300025273 Ga0209673_1000284 Ga0209673_100028418 156
723 3300025273 Ga0209673_1001443 Ga0209673_100144312 156
724 3300025273 Ga0209673_1002254 Ga0209673_10022549 156
725 3300025284 Ga0209130_1000040 Ga0209130_100004063 156
726 3300025284 Ga0209130_1000346 Ga0209130_100034633 156
727 3300025284 Ga0209130_1000757 Ga0209130_100075716 156
728 3300025284 Ga0209130_1001429 Ga0209130_10014294 156
729 3300025291 Ga0209675_1000030 Ga0209675_1000030112 156
730 3300025291 Ga0209675_1000133 Ga0209675_100013378 156
731 3300025291 Ga0209675_1000471 Ga0209675_100047115 156
732 3300025291 Ga0209675_1000695 Ga0209675_100069512 156
733 3300025291 Ga0209675_1001131 Ga0209675_10011316 156
734 3300025291 Ga0209675_1004254 Ga0209675_10042541 156
735 3300025291 Ga0209675_1020620 Ga0209675_10206202 156
736 3300025292 Ga0209676_1000028 Ga0209676_1000028322 156
737 3300025292 Ga0209676_1000073 Ga0209676_1000073218 156
738 3300025292 Ga0209676_1000142 Ga0209676_1000142146 156
739 3300025292 Ga0209676_1000317 Ga0209676_100031736 156
740 3300025292 Ga0209676_1000383 Ga0209676_100038365 156
741 3300025292 Ga0209676_1013166 Ga0209676_10131663 156
742 3300025292 Ga0209676_1042675 Ga0209676_10426752 156
743 3300025294 Ga0209025_1000088 Ga0209025_100008852 156
744 3300025294 Ga0209025_1000104 Ga0209025_1000104172 156
745 3300025294 Ga0209025_1001526 Ga0209025_100152617 156
746 3300025294 Ga0209025_1002084 Ga0209025_10020842 156
747 3300025294 Ga0209025_1004730 Ga0209025_100473010 156
748 3300025294 Ga0209025_1006776 Ga0209025_10067765 156
749 3300025294 Ga0209025_1011727 Ga0209025_10117277 156
750 3300025294 Ga0209025_1013516 Ga0209025_10135162 156
751 3300025294 Ga0209025_1040081 Ga0209025_10400813 156
752 3300025294 Ga0209025_1095901 Ga0209025_10959012 156
753 3300025294 Ga0209025_1095980 Ga0209025_10959802 156
754 3300025295 Ga0209564_1000313 Ga0209564_100031346 156
755 3300025295 Ga0209564_1000823 Ga0209564_100082319 156
756 3300025295 Ga0209564_1001505 Ga0209564_100150512 156
757 3300025295 Ga0209564_1002447 Ga0209564_10024479 156
758 3300025295 Ga0209564_1005212 Ga0209564_10052123 156
759 3300025297 Ga0209758_1000510 Ga0209758_100051014 156
760 3300025297 Ga0209758_1000679 Ga0209758_100067930 156
761 3300025297 Ga0209758_1003918 Ga0209758_10039188 156
762 3300025297 Ga0209758_1005216 Ga0209758_10052167 156
763 3300025298 Ga0209050_1000008 Ga0209050_1000008845 156
764 3300025298 Ga0209050_1000072 Ga0209050_100007278 156
765 3300025298 Ga0209050_1000786 Ga0209050_100078615 156
766 3300025298 Ga0209050_1000952 Ga0209050_100095221 156
767 3300025298 Ga0209050_1001577 Ga0209050_10015779 156
768 3300025298 Ga0209050_1005629 Ga0209050_10056296 156
769 3300025298 Ga0209050_1015985 Ga0209050_10159853 156
770 3300025298 Ga0209050_1034091 Ga0209050_10340912 156
771 3300025299 Ga0209256_1000096 Ga0209256_100009699 156
772 3300025299 Ga0209256_1000151 Ga0209256_1000151114 156
773 3300025299 Ga0209256_1000256 Ga0209256_10002569 156
774 3300025299 Ga0209256_1040804 Ga0209256_10408042 156
775 3300025299 Ga0209256_1056004 Ga0209256_10560042 156
776 3300025302 Ga0207426_1000049 Ga0207426_1000049353 156
777 3300025302 Ga0207426_1000188 Ga0207426_100018863 156
778 3300025302 Ga0207426_1000315 Ga0207426_10003159 156
779 3300025302 Ga0207426_1001354 Ga0207426_100135425 156
780 3300025303 Ga0209051_1000005 Ga0209051_1000005845 156
781 3300025303 Ga0209051_1000015 Ga0209051_1000015251 156
782 3300025303 Ga0209051_1000056 Ga0209051_1000056149 156
783 3300025303 Ga0209051_1000161 Ga0209051_100016111 156
784 3300025303 Ga0209051_1000259 Ga0209051_100025966 156
785 3300025303 Ga0209051_1000416 Ga0209051_100041618 156
786 3300025303 Ga0209051_1084184 Ga0209051_10841842 156
787 3300025303 Ga0209051_1136246 Ga0209051_11362461 156
788 3300025304 Ga0209257_1000031 Ga0209257_1000031435 156
789 3300025304 Ga0209257_1000037 Ga0209257_1000037494 156
790 3300025304 Ga0209257_1000116 Ga0209257_1000116190 156
791 3300025304 Ga0209257_1002902 Ga0209257_10029023 156
792 3300025304 Ga0209257_1004513 Ga0209257_10045139 156
793 3300025304 Ga0209257_1022591 Ga0209257_10225913 156
794 3300025315 Ga0207697_10046109 Ga0207697_100461092 156
795 3300025315 Ga0207697_10070620 Ga0207697_100706202 156
796 3300025321 Ga0207656_10020678 Ga0207656_100206782 156
797 3300025321 Ga0207656_10027516 Ga0207656_100275162 156
798 3300025321 Ga0207656_10103921 Ga0207656_101039212 156
799 3300025321 Ga0207656_10234090 Ga0207656_102340901 156
800 3300025321 Ga0207656_10328922 Ga0207656_103289221 156
801 3300025728 Ga0207655_1015947 Ga0207655_10159474 156
802 3300025893 Ga0207682_10032758 Ga0207682_100327582 156
803 3300025893 Ga0207682_10044699 Ga0207682_100446993 156
804 3300025893 Ga0207682_10247434 Ga0207682_102474342 156
805 3300025899 Ga0207642_10006015 Ga0207642_100060153 156
806 3300025899 Ga0207642_10024373 Ga0207642_100243733 156
807 3300025901 Ga0207688_10078411 Ga0207688_100784113 156
808 3300025901 Ga0207688_10188104 Ga0207688_101881042 156
809 3300025901 Ga0207688_10652489 Ga0207688_106524891 156
810 3300025903 Ga0207680_10028766 Ga0207680_100287662 156
811 3300025903 Ga0207680_10191237 Ga0207680_101912372 156
812 3300025904 Ga0207647_10357268 Ga0207647_103572682 156
813 3300025907 Ga0207645_10004614 Ga0207645_100046146 156
814 3300025907 Ga0207645_10041857 Ga0207645_100418573 156
815 3300025907 Ga0207645_10309051 Ga0207645_103090512 156
816 3300025908 Ga0207643_10009830 Ga0207643_100098303 156
817 3300025908 Ga0207643_10166620 Ga0207643_101666202 156
818 3300025908 Ga0207643_10252977 Ga0207643_102529772 156
819 3300025909 Ga0207705_10164082 Ga0207705_101640822 156
820 3300025910 Ga0207684_10119778 Ga0207684_101197783 156
821 3300025911 Ga0207654_10402338 Ga0207654_104023382 156
822 3300025913 Ga0207695_10130175 Ga0207695_101301752 156
823 3300025913 Ga0207695_10145157 Ga0207695_101451573 156
824 3300025914 Ga0207671_10075823 Ga0207671_100758231 156
825 3300025914 Ga0207671_10219270 Ga0207671_102192703 156
826 3300025914 Ga0207671_10494572 Ga0207671_104945722 156
827 3300025917 Ga0207660_10026081 Ga0207660_100260813 156
828 3300025918 Ga0207662_10013391 Ga0207662_100133913 156
829 3300025918 Ga0207662_10089116 Ga0207662_100891163 156
830 3300025919 Ga0207657_10038426 Ga0207657_100384265 156
831 3300025919 Ga0207657_10082664 Ga0207657_100826643 156
832 3300025919 Ga0207657_10308033 Ga0207657_103080331 156
833 3300025919 Ga0207657_10320421 Ga0207657_103204212 156
834 3300025920 Ga0207649_10314732 Ga0207649_103147322 156
835 3300025920 Ga0207649_10762319 Ga0207649_107623191 156
836 3300025920 Ga0207649_10792593 Ga0207649_107925931 156
837 3300025921 Ga0207652_10073735 Ga0207652_100737352 156
838 3300025922 Ga0207646_10015873 Ga0207646_100158735 156
839 3300025923 Ga0207681_10000826 Ga0207681_1000082614 156
840 3300025923 Ga0207681_10008765 Ga0207681_100087653 156
841 3300025923 Ga0207681_10114005 Ga0207681_101140052 156
842 3300025923 Ga0207681_10243304 Ga0207681_102433042 156
843 3300025924 Ga0207694_10041437 Ga0207694_100414373 156
844 3300025924 Ga0207694_10111689 Ga0207694_101116892 156
845 3300025924 Ga0207694_10164283 Ga0207694_101642832 156
846 3300025924 Ga0207694_10603891 Ga0207694_106038912 156
847 3300025925 Ga0207650_10120072 Ga0207650_101200723 156
848 3300025925 Ga0207650_10204515 Ga0207650_102045152 156
849 3300025925 Ga0207650_10224507 Ga0207650_102245072 156
850 3300025925 Ga0207650_10315573 Ga0207650_103155732 156
851 3300025925 Ga0207650_10512274 Ga0207650_105122742 156
852 3300025925 Ga0207650_10576954 Ga0207650_105769542 156
853 3300025926 Ga0207659_10001869 Ga0207659_100018693 156
854 3300025926 Ga0207659_10029827 Ga0207659_100298275 156
855 3300025926 Ga0207659_10839328 Ga0207659_108393282 156
856 3300025926 Ga0207659_11273276 Ga0207659_112732761 156
857 3300025927 Ga0207687_10013703 Ga0207687_100137036 156
858 3300025927 Ga0207687_10056676 Ga0207687_100566762 156
859 3300025927 Ga0207687_10211834 Ga0207687_102118342 156
860 3300025927 Ga0207687_10421403 Ga0207687_104214032 156
861 3300025931 Ga0207644_10000223 Ga0207644_1000022316 156
862 3300025931 Ga0207644_10008993 Ga0207644_100089934 156
863 3300025931 Ga0207644_10065196 Ga0207644_100651962 156
864 3300025931 Ga0207644_10070563 Ga0207644_100705632 156
865 3300025931 Ga0207644_10347830 Ga0207644_103478302 156
866 3300025931 Ga0207644_10382331 Ga0207644_103823313 156
867 3300025931 Ga0207644_10672504 Ga0207644_106725042 156
868 3300025932 Ga0207690_10032585 Ga0207690_100325854 156
869 3300025932 Ga0207690_10456255 Ga0207690_104562552 156
870 3300025932 Ga0207690_10664135 Ga0207690_106641352 156
871 3300025933 Ga0207706_10000736 Ga0207706_1000073612 156
872 3300025933 Ga0207706_10012885 Ga0207706_100128853 156
873 3300025933 Ga0207706_10172590 Ga0207706_101725903 156
874 3300025933 Ga0207706_10379576 Ga0207706_103795762 156
875 3300025933 Ga0207706_10573407 Ga0207706_105734072 156
876 3300025933 Ga0207706_10720062 Ga0207706_107200621 156
877 3300025933 Ga0207706_10830020 Ga0207706_108300201 156
878 3300025933 Ga0207706_10850399 Ga0207706_108503991 156
879 3300025934 Ga0207686_10030421 Ga0207686_100304214 156
880 3300025934 Ga0207686_10088915 Ga0207686_100889152 156
881 3300025934 Ga0207686_10476777 Ga0207686_104767772 156
882 3300025935 Ga0207709_10000771 Ga0207709_1000077123 156
883 3300025935 Ga0207709_10001444 Ga0207709_100014444 156
884 3300025935 Ga0207709_10011940 Ga0207709_100119406 156
885 3300025935 Ga0207709_10012398 Ga0207709_100123982 156
886 3300025935 Ga0207709_10039692 Ga0207709_100396924 156
887 3300025935 Ga0207709_10076505 Ga0207709_100765053 156
888 3300025935 Ga0207709_10157185 Ga0207709_101571852 156
889 3300025935 Ga0207709_10616933 Ga0207709_106169332 156
890 3300025935 Ga0207709_10650558 Ga0207709_106505582 156
891 3300025937 Ga0207669_10002159 Ga0207669_100021594 156
892 3300025937 Ga0207669_10636871 Ga0207669_106368712 156
893 3300025937 Ga0207669_11385823 Ga0207669_113858231 156
894 3300025938 Ga0207704_10002371 Ga0207704_100023713 156
895 3300025938 Ga0207704_10205529 Ga0207704_102055293 156
896 3300025938 Ga0207704_10221663 Ga0207704_102216633 156
897 3300025938 Ga0207704_10262680 Ga0207704_102626803 156
898 3300025938 Ga0207704_10376209 Ga0207704_103762092 156
899 3300025938 Ga0207704_10404880 Ga0207704_104048802 156
900 3300025939 Ga0207665_10140128 Ga0207665_101401283 156
901 3300025940 Ga0207691_10002576 Ga0207691_100025766 156
902 3300025940 Ga0207691_10023739 Ga0207691_100237395 156
903 3300025940 Ga0207691_10075275 Ga0207691_100752756 156
904 3300025940 Ga0207691_10081432 Ga0207691_100814323 156
905 3300025940 Ga0207691_10087282 Ga0207691_100872822 156
906 3300025940 Ga0207691_10153924 Ga0207691_101539242 156
907 3300025940 Ga0207691_10337776 Ga0207691_103377762 156
908 3300025940 Ga0207691_10363434 Ga0207691_103634343 156
909 3300025941 Ga0207711_10002181 Ga0207711_1000218116 156
910 3300025941 Ga0207711_10008423 Ga0207711_100084232 156
911 3300025941 Ga0207711_10093737 Ga0207711_100937372 156
912 3300025941 Ga0207711_10205036 Ga0207711_102050362 156
913 3300025941 Ga0207711_10501111 Ga0207711_105011112 156
914 3300025941 Ga0207711_10666528 Ga0207711_106665282 156
915 3300025942 Ga0207689_10000259 Ga0207689_1000025924 156
916 3300025942 Ga0207689_10006174 Ga0207689_100061742 156
917 3300025942 Ga0207689_10018504 Ga0207689_100185041 156
918 3300025942 Ga0207689_10120756 Ga0207689_101207562 156
919 3300025942 Ga0207689_10180386 Ga0207689_101803862 156
920 3300025942 Ga0207689_10202186 Ga0207689_102021861 156
921 3300025942 Ga0207689_10202319 Ga0207689_102023192 156
922 3300025942 Ga0207689_10269083 Ga0207689_102690832 156
923 3300025942 Ga0207689_10644972 Ga0207689_106449722 156
924 3300025942 Ga0207689_10983709 Ga0207689_109837092 156
925 3300025944 Ga0207661_10025802 Ga0207661_100258022 156
926 3300025944 Ga0207661_10151431 Ga0207661_101514312 156
927 3300025945 Ga0207679_10044865 Ga0207679_100448652 156
928 3300025945 Ga0207679_10134308 Ga0207679_101343082 156
929 3300025945 Ga0207679_10212816 Ga0207679_102128162 156
930 3300025945 Ga0207679_10548238 Ga0207679_105482382 156
931 3300025945 Ga0207679_11094158 Ga0207679_110941582 156
932 3300025949 Ga0207667_10110625 Ga0207667_101106252 156
933 3300025960 Ga0207651_10005547 Ga0207651_100055474 156
934 3300025960 Ga0207651_10100796 Ga0207651_101007962 156
935 3300025960 Ga0207651_10128082 Ga0207651_101280822 156
936 3300025960 Ga0207651_10140033 Ga0207651_101400332 156
937 3300025960 Ga0207651_10184316 Ga0207651_101843162 156
938 3300025960 Ga0207651_10317868 Ga0207651_103178682 156
939 3300025960 Ga0207651_10330439 Ga0207651_103304393 156
940 3300025960 Ga0207651_10656942 Ga0207651_106569421 156
941 3300025960 Ga0207651_11063547 Ga0207651_110635472 156
942 3300025961 Ga0207712_10013171 Ga0207712_100131714 156
943 3300025961 Ga0207712_10375071 Ga0207712_103750712 156
944 3300025961 Ga0207712_10391396 Ga0207712_103913961 156
945 3300025972 Ga0207668_10030116 Ga0207668_100301163 156
946 3300025972 Ga0207668_10524630 Ga0207668_105246302 156
947 3300025981 Ga0207640_10072192 Ga0207640_100721923 156
948 3300025981 Ga0207640_11067399 Ga0207640_110673992 156
949 3300025986 Ga0207658_10002825 Ga0207658_100028257 156
950 3300025986 Ga0207658_10005834 Ga0207658_100058344 156
951 3300025986 Ga0207658_10013147 Ga0207658_100131476 156
952 3300025986 Ga0207658_10411655 Ga0207658_104116552 156
953 3300025986 Ga0207658_10742933 Ga0207658_107429332 156
954 3300025986 Ga0207658_10804600 Ga0207658_108046002 156
955 3300025986 Ga0207658_11137489 Ga0207658_111374892 156
956 3300025986 Ga0207658_11537809 Ga0207658_115378092 156
957 3300026023 Ga0207677_10001179 Ga0207677_1000117911 156
958 3300026023 Ga0207677_10001436 Ga0207677_100014364 156
959 3300026023 Ga0207677_10015394 Ga0207677_100153944 156
960 3300026023 Ga0207677_10040367 Ga0207677_100403673 156
961 3300026023 Ga0207677_10117791 Ga0207677_101177913 156
962 3300026023 Ga0207677_10260398 Ga0207677_102603981 156
963 3300026023 Ga0207677_10426178 Ga0207677_104261783 156
964 3300026035 Ga0207703_10000408 Ga0207703_1000040842 156
965 3300026035 Ga0207703_10018563 Ga0207703_100185634 156
966 3300026035 Ga0207703_10036310 Ga0207703_100363104 156
967 3300026035 Ga0207703_10037004 Ga0207703_100370045 156
968 3300026035 Ga0207703_11561808 Ga0207703_115618081 156
969 3300026041 Ga0207639_10043276 Ga0207639_100432763 156
970 3300026041 Ga0207639_10278290 Ga0207639_102782903 156
971 3300026041 Ga0207639_10811434 Ga0207639_108114342 156
972 3300026041 Ga0207639_11560680 Ga0207639_115606801 156
973 3300026067 Ga0207678_10005998 Ga0207678_100059984 156
974 3300026067 Ga0207678_10049813 Ga0207678_100498134 156
975 3300026067 Ga0207678_10171827 Ga0207678_101718272 156
976 3300026067 Ga0207678_10641644 Ga0207678_106416442 156
977 3300026078 Ga0207702_10037491 Ga0207702_100374915 156
978 3300026078 Ga0207702_10248514 Ga0207702_102485142 156
979 3300026078 Ga0207702_10979134 Ga0207702_109791342 156
980 3300026078 Ga0207702_11659806 Ga0207702_116598061 156
981 3300026088 Ga0207641_10002065 Ga0207641_100020654 156
982 3300026088 Ga0207641_10004421 Ga0207641_100044216 156
983 3300026088 Ga0207641_10037985 Ga0207641_100379856 156
984 3300026088 Ga0207641_10135068 Ga0207641_101350681 156
985 3300026088 Ga0207641_10136517 Ga0207641_101365173 156
986 3300026088 Ga0207641_10188888 Ga0207641_101888883 156
987 3300026089 Ga0207648_10000686 Ga0207648_1000068612 156
988 3300026089 Ga0207648_10012681 Ga0207648_100126813 156
989 3300026089 Ga0207648_10017873 Ga0207648_100178734 156
990 3300026089 Ga0207648_10019036 Ga0207648_100190362 156
991 3300026089 Ga0207648_10044650 Ga0207648_100446504 156
992 3300026089 Ga0207648_10292659 Ga0207648_102926593 156
993 3300026089 Ga0207648_10322549 Ga0207648_103225492 156
994 3300026089 Ga0207648_10400077 Ga0207648_104000771 156
995 3300026089 Ga0207648_10516637 Ga0207648_105166371 156
996 3300026089 Ga0207648_10522031 Ga0207648_105220312 156
997 3300026095 Ga0207676_10000269 Ga0207676_1000026942 156
998 3300026095 Ga0207676_10054658 Ga0207676_100546582 156
999 3300026095 Ga0207676_10065398 Ga0207676_100653982 156
1000 3300026095 Ga0207676_10161348 Ga0207676_101613483 156
1001 3300026095 Ga0207676_11046571 Ga0207676_110465712 156
1002 3300026095 Ga0207676_11577421 Ga0207676_115774211 156
1003 3300026116 Ga0207674_10016515 Ga0207674_100165152 156
1004 3300026116 Ga0207674_10029563 Ga0207674_100295635 156
1005 3300026116 Ga0207674_10038674 Ga0207674_100386746 156
1006 3300026116 Ga0207674_10139045 Ga0207674_101390452 156
1007 3300026116 Ga0207674_10411475 Ga0207674_104114753 156
1008 3300026116 Ga0207674_10604400 Ga0207674_106044002 156
1009 3300026116 Ga0207674_11470051 Ga0207674_114700512 156
1010 3300026118 Ga0207675_100000307 Ga0207675_10000030723 156
1011 3300026118 Ga0207675_100001416 Ga0207675_1000014165 156
1012 3300026118 Ga0207675_100076361 Ga0207675_1000763612 156
1013 3300026118 Ga0207675_100466401 Ga0207675_1004664013 156
1014 3300026121 Ga0207683_10001051 Ga0207683_1000105121 156
1015 3300026121 Ga0207683_10066755 Ga0207683_100667552 156
1016 3300026121 Ga0207683_10237209 Ga0207683_102372093 156
1017 3300026121 Ga0207683_10385382 Ga0207683_103853823 156
1018 3300026121 Ga0207683_10416789 Ga0207683_104167893 156
1019 3300026121 Ga0207683_10564333 Ga0207683_105643332 156
1020 3300026121 Ga0207683_10569559 Ga0207683_105695593 156
1021 3300026121 Ga0207683_11007022 Ga0207683_110070222 156
1022 3300026121 Ga0207683_11075958 Ga0207683_110759582 156
1023 3300026142 Ga0207698_10037962 Ga0207698_100379624 156
1024 3300026142 Ga0207698_10090847 Ga0207698_100908472 156
1025 3300026142 Ga0207698_10104934 Ga0207698_101049342 156
1026 3300026142 Ga0207698_10109147 Ga0207698_101091473 156
1027 3300026142 Ga0207698_10196658 Ga0207698_101966582 156
1028 3300026142 Ga0207698_10210647 Ga0207698_102106472 156
1029 3300026142 Ga0207698_10337349 Ga0207698_103373492 156
1030 3300026142 Ga0207698_10402939 Ga0207698_104029393 156
1031 3300026142 Ga0207698_10411559 Ga0207698_104115593 156
1032 3300026142 Ga0207698_10421196 Ga0207698_104211962 156
1033 3300026142 Ga0207698_10425227 Ga0207698_104252272 156
1034 3300026142 Ga0207698_10549355 Ga0207698_105493552 156
1035 3300026142 Ga0207698_10899207 Ga0207698_108992072 156
1036 3300026142 Ga0207698_11212884 Ga0207698_112128842 156
1037 3300026142 Ga0207698_11341165 Ga0207698_113411652 156
1038 3300027395 Ga0209996_1001867 Ga0209996_10018672 156
1039 3300027526 Ga0209968_1000702 Ga0209968_10007024 156
1040 3300027666 Ga0209282_1011860 Ga0209282_10118602 156
1041 3300027695 Ga0209966_1000040 Ga0209966_100004039 156
1042 3300027717 Ga0209998_10021105 Ga0209998_100211052 156
1043 3300027866 Ga0209813_10023158 Ga0209813_100231582 156
1044 3300027866 Ga0209813_10222054 Ga0209813_102220542 156
1045 3300027876 Ga0209974_10006173 Ga0209974_100061733 156
1046 3300027907 Ga0207428_10578269 Ga0207428_105782692 156
1047 3300028379 Ga0268266_10010170 Ga0268266_100101703 156
1048 3300028379 Ga0268266_10061450 Ga0268266_100614502 156
1049 3300028379 Ga0268266_10317098 Ga0268266_103170982 156
1050 3300028379 Ga0268266_10455050 Ga0268266_104550502 156
1051 3300028379 Ga0268266_10817657 Ga0268266_108176571 156
1052 3300028380 Ga0268265_10087552 Ga0268265_100875522 156
1053 3300028380 Ga0268265_10179219 Ga0268265_101792192 156
1054 3300028380 Ga0268265_10260150 Ga0268265_102601502 156
1055 3300028380 Ga0268265_10260891 Ga0268265_102608912 156
1056 3300028380 Ga0268265_10268500 Ga0268265_102685003 156
1057 3300028380 Ga0268265_11578579 Ga0268265_115785792 156
1058 3300028381 Ga0268264_10004973 Ga0268264_100049739 156
1059 3300028381 Ga0268264_10019709 Ga0268264_100197093 156
1060 3300028381 Ga0268264_10077625 Ga0268264_100776252 156
1061 3300028381 Ga0268264_10180300 Ga0268264_101803001 156
1062 3300028381 Ga0268264_10269302 Ga0268264_102693022 156
1063 3300028381 Ga0268264_10275052 Ga0268264_102750523 156
1064 3300028381 Ga0268264_10825647 Ga0268264_108256472 156
1065 3300028786 Ga0307517_10000160 Ga0307517_1000016046 156
1066 3300028786 Ga0307517_10000395 Ga0307517_1000039561 156
1067 3300028786 Ga0307517_10074719 Ga0307517_100747192 156
1068 3300028786 Ga0307517_10179818 Ga0307517_101798182 156
1069 3300028794 Ga0307515_10000006 Ga0307515_10000006469 156
1070 3300028794 Ga0307515_10000160 Ga0307515_10000160151 156
1071 3300028794 Ga0307515_10000332 Ga0307515_1000033225 156
1072 3300028794 Ga0307515_10000893 Ga0307515_1000089316 156
1073 3300028794 Ga0307515_10001283 Ga0307515_1000128337 156
1074 3300028794 Ga0307515_10007639 Ga0307515_1000763917 156
1075 3300028794 Ga0307515_10012223 Ga0307515_1001222317 156
1076 3300028794 Ga0307515_10022830 Ga0307515_100228309 156
1077 3300028794 Ga0307515_10033807 Ga0307515_100338076 156
1078 3300028794 Ga0307515_10060601 Ga0307515_100606016 156
1079 3300028794 Ga0307515_10080735 Ga0307515_100807355 156
1080 3300028794 Ga0307515_10147322 Ga0307515_101473222 156
1081 3300028794 Ga0307515_10179656 Ga0307515_101796563 156
1082 3300028794 Ga0307515_10206740 Ga0307515_102067403 156
1083 3300028794 Ga0307515_10223497 Ga0307515_102234972 156
1084 3300028794 Ga0307515_10281623 Ga0307515_102816233 156
1085 3300028794 Ga0307515_10364123 Ga0307515_103641233 156
1086 3300028794 Ga0307515_10635715 Ga0307515_106357152 156
1087 3300030521 Ga0307511_10013142 Ga0307511_100131423 156
1088 3300030522 Ga0307512_10041345 Ga0307512_100413452 156
1089 3300030522 Ga0307512_10102024 Ga0307512_101020243 156
1090 3300030522 Ga0307512_10139063 Ga0307512_101390632 156
1091 3300030522 Ga0307512_10289617 Ga0307512_102896172 156
1092 3300030731 Ga0316177_1091352 Ga0316177_10913524 156
1093 3300030732 Ga0316176_1071075 Ga0316176_10710751 156
1094 3300030733 Ga0314311_1059274 Ga0314311_105927410 156
1095 3300030734 Ga0316179_1119471 Ga0316179_11194712 156
1096 3300030735 Ga0316178_1094522 Ga0316178_10945222 156
1097 3300030736 Ga0316180_1037515 Ga0316180_10375152 156
1098 3300030742 Ga0316183_1042467 Ga0316183_10424672 156
1099 3300030744 Ga0316181_1174890 Ga0316181_11748903 156
1100 3300030745 Ga0316182_1176401 Ga0316182_11764012 156
1101 3300030745 Ga0316182_1440727 Ga0316182_14407273 156
1102 3300031251 Ga0265327_10002595 Ga0265327_1000259516 156
1103 3300031456 Ga0307513_10003528 Ga0307513_100035284 156
1104 3300031456 Ga0307513_10020560 Ga0307513_100205605 156
1105 3300031456 Ga0307513_10037147 Ga0307513_100371475 156
1106 3300031456 Ga0307513_10097939 Ga0307513_100979393 156
1107 3300031456 Ga0307513_10215434 Ga0307513_102154343 156
1108 3300031456 Ga0307513_11091140 Ga0307513_110911401 156
1109 3300031507 Ga0307509_10000212 Ga0307509_1000021237 156
1110 3300031507 Ga0307509_10000317 Ga0307509_1000031720 156
1111 3300031507 Ga0307509_10001515 Ga0307509_1000151520 156
1112 3300031507 Ga0307509_10002052 Ga0307509_1000205233 156
1113 3300031507 Ga0307509_10057914 Ga0307509_100579144 156
1114 3300031507 Ga0307509_10117990 Ga0307509_101179903 156
1115 3300031507 Ga0307509_10161551 Ga0307509_101615512 156
1116 3300031507 Ga0307509_10250752 Ga0307509_102507523 156
1117 3300031507 Ga0307509_10478928 Ga0307509_104789282 156
1118 3300031507 Ga0307509_10529824 Ga0307509_105298241 156
1119 3300031548 Ga0307408_100026572 Ga0307408_1000265722 156
1120 3300031548 Ga0307408_100073052 Ga0307408_1000730524 156
1121 3300031548 Ga0307408_100113754 Ga0307408_1001137542 156
1122 3300031548 Ga0307408_100199041 Ga0307408_1001990412 156
1123 3300031548 Ga0307408_100225286 Ga0307408_1002252862 156
1124 3300031548 Ga0307408_100323704 Ga0307408_1003237042 156
1125 3300031548 Ga0307408_100912915 Ga0307408_1009129151 156
1126 3300031616 Ga0307508_10000097 Ga0307508_1000009745 156
1127 3300031616 Ga0307508_10000332 Ga0307508_100003323 156
1128 3300031616 Ga0307508_10001697 Ga0307508_1000169712 156
1129 3300031616 Ga0307508_10005499 Ga0307508_100054992 156
1130 3300031616 Ga0307508_10006375 Ga0307508_100063756 156
1131 3300031616 Ga0307508_10118737 Ga0307508_101187373 156
1132 3300031616 Ga0307508_10191308 Ga0307508_101913082 156
1133 3300031616 Ga0307508_10394920 Ga0307508_103949202 156
1134 3300031649 Ga0307514_10000795 Ga0307514_1000079512 156
1135 3300031649 Ga0307514_10003838 Ga0307514_100038382 156
1136 3300031649 Ga0307514_10005414 Ga0307514_100054147 156
1137 3300031649 Ga0307514_10026427 Ga0307514_100264274 156
1138 3300031649 Ga0307514_10066783 Ga0307514_100667831 156
1139 3300031649 Ga0307514_10176693 Ga0307514_101766932 156
1140 3300031730 Ga0307516_10006132 Ga0307516_1000613211 156
1141 3300031730 Ga0307516_10126756 Ga0307516_101267563 156
1142 3300031730 Ga0307516_10166406 Ga0307516_101664062 156
1143 3300031730 Ga0307516_10269308 Ga0307516_102693082 156
1144 3300031730 Ga0307516_10307928 Ga0307516_103079282 156
1145 3300031730 Ga0307516_10513847 Ga0307516_105138471 156
1146 3300031731 Ga0307405_10008706 Ga0307405_100087065 156
1147 3300031731 Ga0307405_10044351 Ga0307405_100443513 156
1148 3300031731 Ga0307405_10199037 Ga0307405_101990373 156
1149 3300031731 Ga0307405_10510250 Ga0307405_105102502 156
1150 3300031731 Ga0307405_10542540 Ga0307405_105425401 156
1151 3300031731 Ga0307405_10948442 Ga0307405_109484422 156
1152 3300031731 Ga0307405_11726206 Ga0307405_117262061 156
1153 3300031824 Ga0307413_10709507 Ga0307413_107095071 156
1154 3300031824 Ga0307413_10984130 Ga0307413_109841302 156
1155 3300031852 Ga0307410_10450209 Ga0307410_104502092 156
1156 3300031852 Ga0307410_10678872 Ga0307410_106788722 156
1157 3300031901 Ga0307406_10067497 Ga0307406_100674972 156
1158 3300031901 Ga0307406_10083841 Ga0307406_100838413 156
1159 3300031901 Ga0307406_10717461 Ga0307406_107174612 156
1160 3300031901 Ga0307406_11592248 Ga0307406_115922482 156
1161 3300031911 Ga0307412_10017936 Ga0307412_100179364 156
1162 3300031911 Ga0307412_10032642 Ga0307412_100326424 156
1163 3300031911 Ga0307412_10096348 Ga0307412_100963482 156
1164 3300031911 Ga0307412_10203425 Ga0307412_102034252 156
1165 3300031911 Ga0307412_10309707 Ga0307412_103097072 156
1166 3300031911 Ga0307412_10625997 Ga0307412_106259971 156
1167 3300031911 Ga0307412_11142263 Ga0307412_111422632 156
1168 3300031995 Ga0307409_100005809 Ga0307409_1000058094 156
1169 3300031995 Ga0307409_101227328 Ga0307409_1012273282 156
1170 3300032002 Ga0307416_100001574 Ga0307416_10000157410 156
1171 3300032002 Ga0307416_100216574 Ga0307416_1002165742 156
1172 3300032002 Ga0307416_100360975 Ga0307416_1003609753 156
1173 3300032002 Ga0307416_100420709 Ga0307416_1004207093 156
1174 3300032002 Ga0307416_100891181 Ga0307416_1008911812 156
1175 3300032004 Ga0307414_10142492 Ga0307414_101424923 156
1176 3300032004 Ga0307414_10173251 Ga0307414_101732512 156
1177 3300032004 Ga0307414_11522563 Ga0307414_115225632 156
1178 3300032005 Ga0307411_10013253 Ga0307411_100132535 156
1179 3300032005 Ga0307411_10132222 Ga0307411_101322223 156
1180 3300032005 Ga0307411_10780284 Ga0307411_107802842 156
1181 3300032126 Ga0307415_100007021 Ga0307415_1000070216 156
1182 3300033179 Ga0307507_10269557 Ga0307507_102695573 156
1183 3300033179 Ga0307507_10369216 Ga0307507_103692161 156
1184 3300033180 Ga0307510_10129347 Ga0307510_101293472 156
1185 3300033180 Ga0307510_10262467 Ga0307510_102624673 156
1186 3300033180 Ga0307510_10395991 Ga0307510_103959912 156
1187 3300033180 Ga0307510_10538721 Ga0307510_105387211 156
1188 3300034816 Ga0373930_0047804 Ga0373930_0047804_65_535 156
1189 3300034817 Ga0373948_0053027 Ga0373948_0053027_121_591 156
1190 3300034957 Ga0373938_0083037 Ga0373938_0083037_195_671 156
1191 3300035083 Ga0373926_0317095 Ga0373926_0317095_104_577 156
1192 3300035085 Ga0373929_0004656 Ga0373929_0004656_1047_1523 156
1193 3300035088 Ga0373940_0078320 Ga0373940_0078320_410_886 156
1194 3300035089 Ga0373944_0026045 Ga0373944_0026045_146_619 156
1195 3300035111 Ga0373923_0056861 Ga0373923_0056861_1027_1497 156
1196 3300035111 Ga0373923_0151710 Ga0373923_0151710_370_843 156
1197 3300035112 Ga0373932_0020198 Ga0373932_0020198_532_1002 156
1198 3300035112 Ga0373932_0059406 Ga0373932_0059406_339_815 156
1199 3300035113 Ga0373936_0001484 Ga0373936_0001484_7648_8133 156
1200 3300035113 Ga0373936_0270213 Ga0373936_0270213_245_718 156
1201 3300035115 Ga0373941_0021775 Ga0373941_0021775_1283_1759 156
1202 3300035119 Ga0373956_0089353 Ga0373956_0089353_520_1035 156
1203 3300035170 Ga0373943_0008038 Ga0373943_0008038_2344_2859 156
1204 3300035170 Ga0373943_0082489 Ga0373943_0082489_1072_1542 156
1205 3300035171 Ga0373946_0124206 Ga0373946_0124206_102_572 156
1206 3300035242 Ga0373962_0098964 Ga0373962_0098964_231_707 156
1207 3300035410 Ga0373924_0001472 Ga0373924_0001472_4305_4778 156
1208 3300035691 Ga0373931_0010336 Ga0373931_0010336_2765_3235 156
1209 3300035692 Ga0373935_0166599 Ga0373935_0166599_22_495 156
1210 3300035692 Ga0373935_0418713 Ga0373935_0418713_285_800 156
1211 3300035692 Ga0373935_0585758 Ga0373935_0585758_14_484 156
1212 3300035695 Ga0373927_0032371 Ga0373927_0032371_1845_2318 156
1213 3300035725 Ga0373947_0162803 Ga0373947_0162803_870_1340 156
1214 3300035725 Ga0373947_0732890 Ga0373947_0732890_90_605 156
1215 3300036401 Ga0373937_0171129 Ga0373937_0171129_1506_1976 156
1216 3300036401 Ga0373937_0539793 Ga0373937_0539793_196_669 156
1217 3300037068 Ga0373925_0125496 Ga0373925_0125496_610_1125 156
1218 3300037312 Ga0395899_0000970 Ga0395899_0000970_25324_25806 156
1219 3300037312 Ga0395899_0001451 Ga0395899_0001451_19537_20019 156
1220 3300037312 Ga0395899_0115511 Ga0395899_0115511_609_1091 156
1221 3300037418 Ga0395900_0000091 Ga0395900_0000091_153387_153869 156
1222 3300037418 Ga0395900_0000602 Ga0395900_0000602_21812_22294 156
1223 3300037418 Ga0395900_0012073 Ga0395900_0012073_764_1246 156
1224 3300037418 Ga0395900_0109955 Ga0395900_0109955_1404_1886 156
1225 3300037418 Ga0395900_0313416 Ga0395900_0313416_663_1145 156
1226 3300037466 Ga0395898_0304421 Ga0395898_0304421_376_858 156
1227 3300037466 Ga0395898_0310389 Ga0395898_0310389_587_1069 156
1228 3300037466 Ga0395898_0708158 Ga0395898_0708158_413_895 156
1229 3300037471 Ga0395905_0000269 Ga0395905_0000269_56679_57158 156
1230 3300037471 Ga0395905_0003396 Ga0395905_0003396_5225_5707 156
1231 3300037471 Ga0395905_0008793 Ga0395905_0008793_7102_7578 156
1232 3300037471 Ga0395905_0018561 Ga0395905_0018561_50_520 156
1233 3300037471 Ga0395905_0115052 Ga0395905_0115052_164_646 156
1234 3300037471 Ga0395905_0136166 Ga0395905_0136166_263_748 156
1235 3300037471 Ga0395905_0137658 Ga0395905_0137658_1695_2177 156
1236 3300037471 Ga0395905_0237491 Ga0395905_0237491_389_868 156
1237 3300037471 Ga0395905_0243446 Ga0395905_0243446_810_1292 156
1238 3300037471 Ga0395905_0603517 Ga0395905_0603517_60_539 156
1239 3300038443 Ga0395901_0010721 Ga0395901_0010721_4386_4868 156
1240 3300038443 Ga0395901_0137392 Ga0395901_0137392_943_1425 156
1241 3300038443 Ga0395901_1085880 Ga0395901_1085880_237_719 156
1242 3300039437 Ga0436365_1128978 Ga0436365_1128978_1195_1674 156
1243 3300039450 Ga0436363_1660049 Ga0436363_1660049_150_629 156
1244 3300041404 Ga0439436_0052251 Ga0439436_0052251_148_618 156
1245 3300041406 Ga0439439_0039272 Ga0439439_0039272_580_1062 156
1246 3300041406 Ga0439439_0047623 Ga0439439_0047623_305_775 156
1247 3300041406 Ga0439439_0109082 Ga0439439_0109082_200_682 156
1248 3300041407 Ga0439447_025014 Ga0439447_025014_308_778 156
1249 3300041413 Ga0439465_0248345 Ga0439465_0248345_13_483 156
1250 3300041451 Ga0451791_0516807 Ga0451791_0516807_80_550 156
1251 3300041451 Ga0451791_1822013 Ga0451791_1822013_60_545 156
1252 3300041452 Ga0451793_0849783 Ga0451793_0849783_69_539 156
1253 3300041453 Ga0451797_0036350 Ga0451797_0036350_322_792 156
1254 3300041456 Ga0451795_1156050 Ga0451795_1156050_118_588 156
1255 3300041458 Ga0451798_0365603 Ga0451798_0365603_258_743 156
1256 3300041458 Ga0451798_0783119 Ga0451798_0783119_175_654 156
1257 3300041458 Ga0451798_1050572 Ga0451798_1050572_68_556 156
1258 3300041458 Ga0451798_1073454 Ga0451798_1073454_38_508 156
1259 3300041459 Ga0451800_0507924 Ga0451800_0507924_628_1110 156
1260 3300041459 Ga0451800_1125983 Ga0451800_1125983_22_492 156
1261 3300041486 Ga0451807_0955082 Ga0451807_0955082_21_491 156
1262 3300041491 Ga0451833_1039235 Ga0451833_1039235_187_657 156
1263 3300041496 Ga0451839_0995859 Ga0451839_0995859_137_607 156
1264 3300041501 Ga0451845_0395844 Ga0451845_0395844_34_525 156
1265 3300041505 Ga0451849_0455082 Ga0451849_0455082_444_914 156
1266 3300041505 Ga0451849_0763045 Ga0451849_0763045_27_509 156
1267 3300041512 Ga0451853_0929926 Ga0451853_0929926_879_1349 156
1268 3300041512 Ga0451853_2031670 Ga0451853_2031670_342_857 156
1269 3300041512 Ga0451853_2256767 Ga0451853_2256767_71_559 156
1270 3300041512 Ga0451853_2771872 Ga0451853_2771872_72_542 156
1271 3300041999 Ga0439433_0013375 Ga0439433_0013375_750_1220 156
1272 3300041999 Ga0439433_0019350 Ga0439433_0019350_27_509 156
1273 3300042002 Ga0439442_009722 Ga0439442_009722_930_1400 156
1274 3300042004 Ga0439445_0055849 Ga0439445_0055849_329_799 156
1275 3300042006 Ga0439432_075318 Ga0439432_075318_245_715 156
1276 3300042006 Ga0439432_200791 Ga0439432_200791_44_517 156
1277 3300042007 Ga0439449_0001455 Ga0439449_0001455_281_763 156
1278 3300042007 Ga0439449_0012086 Ga0439449_0012086_1323_1793 156
1279 3300042010 Ga0439452_031211 Ga0439452_031211_305_775 156
1280 3300042012 Ga0439455_0003947 Ga0439455_0003947_46_522 156
1281 3300042014 Ga0439457_067024 Ga0439457_067024_36_506 156
1282 3300042015 Ga0439462_0007888 Ga0439462_0007888_512_982 156
1283 3300042015 Ga0439462_0010211 Ga0439462_0010211_861_1343 156
1284 3300042123 Ga0450921_001983 Ga0450921_001983_449_919 156
1285 3300042125 Ga0450923_003206 Ga0450923_003206_1431_1901 156
1286 3300042125 Ga0450923_020511 Ga0450923_020511_424_894 156
1287 3300042125 Ga0450923_035316 Ga0450923_035316_64_537 156
1288 3300042128 Ga0450897_008249 Ga0450897_008249_333_803 156
1289 3300042133 Ga0450896_007410 Ga0450896_007410_635_1105 156
1290 3300042134 Ga0450898_005481 Ga0450898_005481_1174_1650 156
1291 3300042134 Ga0450898_020412 Ga0450898_020412_284_766 156
1292 3300042142 Ga0450905_056568 Ga0450905_056568_97_573 156
1293 3300042147 Ga0450910_025753 Ga0450910_025753_82_552 156
1294 3300042156 Ga0439446_0011968 Ga0439446_0011968_1737_2222 156
1295 3300042156 Ga0439446_0194101 Ga0439446_0194101_25_510 156
1296 3300042157 Ga0439458_0006040 Ga0439458_0006040_1117_1605 156
1297 3300042184 Ga0450908_011589 Ga0450908_011589_482_952 156
1298 3300042184 Ga0450908_030358 Ga0450908_030358_399_869 156
1299 3300042185 Ga0450909_037887 Ga0450909_037887_49_519 156
1300 3300042435 Ga0439434_0104381 Ga0439434_0104381_230_706 156
1301 3300042532 Ga0450893_0005187 Ga0450893_0005187_1328_1798 156
1302 3300042532 Ga0450893_0019015 Ga0450893_0019015_437_919 156
1303 3300042876 Ga0451577_0012109 Ga0451577_0012109_677_1159 156
1304 3300042876 Ga0451577_0694118 Ga0451577_0694118_402_881 156
1305 3300044658 Ga0466972_0026237 Ga0466972_0026237_607_1083 156
1306 3300044706 Ga0466964_0070136 Ga0466964_0070136_989_1462 156
1307 3300044712 Ga0453684_0009557 Ga0453684_0009557_4519_4989 156
1308 3300044712 Ga0453684_0067062 Ga0453684_0067062_4073_4555 156
1309 3300044735 Ga0466968_0578281 Ga0466968_0578281_30_512 156
1310 3300044901 Ga0466960_0187524 Ga0466960_0187524_385_855 156
1311 3300045051 Ga0451576_0035144 Ga0451576_0035144_2580_3062 156
1312 3300045051 Ga0451576_0804264 Ga0451576_0804264_148_645 156
1313 3300045051 Ga0451576_0993627 Ga0451576_0993627_360_836 156
1314 3300046453 Ga0495627_049188 Ga0495627_049188_506_985 156
1315 3300046453 Ga0495627_143442 Ga0495627_143442_26_508 156
1316 3300046454 Ga0495592_0000175 Ga0495592_0000175_20746_21228 156
1317 3300046454 Ga0495592_0003711 Ga0495592_0003711_2049_2519 156
1318 3300046455 Ga0495603_0337394 Ga0495603_0337394_304_819 156
1319 3300046457 Ga0495590_0014398 Ga0495590_0014398_129_599 156
1320 3300046457 Ga0495590_0015858 Ga0495590_0015858_1190_1660 156
1321 3300046457 Ga0495590_0151583 Ga0495590_0151583_268_738 156
1322 3300046460 Ga0495638_0005353 Ga0495638_0005353_424_894 156
1323 3300046460 Ga0495638_0086048 Ga0495638_0086048_1383_1865 156
1324 3300046460 Ga0495638_0105756 Ga0495638_0105756_748_1230 156
1325 3300046460 Ga0495638_0421708 Ga0495638_0421708_47_529 156
1326 3300046461 Ga0495641_0300235 Ga0495641_0300235_207_680 156
1327 3300046463 Ga0495653_0000009 Ga0495653_0000009_211673_212152 156
1328 3300046463 Ga0495653_0316734 Ga0495653_0316734_323_805 156
1329 3300046463 Ga0495653_0406350 Ga0495653_0406350_99_581 156
1330 3300046471 Ga0495650_0000051 Ga0495650_0000051_246299_246769 156
1331 3300046471 Ga0495650_0000213 Ga0495650_0000213_17997_18479 156
1332 3300046471 Ga0495650_0009697 Ga0495650_0009697_4153_4632 156
1333 3300046471 Ga0495650_0030124 Ga0495650_0030124_1337_1807 156
1334 3300046472 Ga0495580_0355786 Ga0495580_0355786_11_487 156
1335 3300046472 Ga0495580_0685529 Ga0495580_0685529_146_634 156
1336 3300046474 Ga0495605_0000040 Ga0495605_0000040_147723_148205 156
1337 3300046474 Ga0495605_0024096 Ga0495605_0024096_2269_2751 156
1338 3300046474 Ga0495605_0049002 Ga0495605_0049002_943_1425 156
1339 3300046474 Ga0495605_0284035 Ga0495605_0284035_108_578 156
1340 3300046474 Ga0495605_0386324 Ga0495605_0386324_76_558 156
1341 3300046475 Ga0495639_0021593 Ga0495639_0021593_428_898 156
1342 3300046475 Ga0495639_0127151 Ga0495639_0127151_416_886 156
1343 3300046475 Ga0495639_0457425 Ga0495639_0457425_134_604 156
1344 3300046475 Ga0495639_0629862 Ga0495639_0629862_22_504 156
1345 3300046476 Ga0495662_0401925 Ga0495662_0401925_92_562 156
1346 3300046491 Ga0495584_0015103 Ga0495584_0015103_682_1164 156
1347 3300046491 Ga0495584_0084559 Ga0495584_0084559_927_1409 156
1348 3300046491 Ga0495584_0269858 Ga0495584_0269858_371_853 156
1349 3300046492 Ga0495585_0000587 Ga0495585_0000587_21041_21520 156
1350 3300046492 Ga0495585_0005376 Ga0495585_0005376_7442_7915 156
1351 3300046492 Ga0495585_0292387 Ga0495585_0292387_169_651 156
1352 3300046500 Ga0495596_0000029 Ga0495596_0000029_24115_24597 156
1353 3300046500 Ga0495596_0000177 Ga0495596_0000177_670_1152 156
1354 3300046500 Ga0495596_0000309 Ga0495596_0000309_5905_6387 156
1355 3300046500 Ga0495596_0002217 Ga0495596_0002217_7293_7775 156
1356 3300046500 Ga0495596_0002850 Ga0495596_0002850_8506_8988 156
1357 3300046500 Ga0495596_0003951 Ga0495596_0003951_6540_7022 156
1358 3300046500 Ga0495596_0006338 Ga0495596_0006338_841_1323 156
1359 3300046500 Ga0495596_0032721 Ga0495596_0032721_1479_1961 156
1360 3300046500 Ga0495596_0046851 Ga0495596_0046851_1060_1542 156
1361 3300046501 Ga0495607_0003055 Ga0495607_0003055_10263_10736 156
1362 3300046501 Ga0495607_0035858 Ga0495607_0035858_541_1023 156
1363 3300046501 Ga0495607_0035916 Ga0495607_0035916_1970_2452 156
1364 3300046501 Ga0495607_0058891 Ga0495607_0058891_386_868 156
1365 3300046501 Ga0495607_0060055 Ga0495607_0060055_700_1182 156
1366 3300046501 Ga0495607_0095182 Ga0495607_0095182_709_1191 156
1367 3300046506 Ga0495583_0003009 Ga0495583_0003009_7056_7529 156
1368 3300046506 Ga0495583_0016689 Ga0495583_0016689_1316_1798 156
1369 3300046506 Ga0495583_0018534 Ga0495583_0018534_2564_3046 156
1370 3300046506 Ga0495583_0108944 Ga0495583_0108944_387_869 156
1371 3300046506 Ga0495583_0259338 Ga0495583_0259338_193_675 156
1372 3300046507 Ga0495606_0163844 Ga0495606_0163844_426_908 156
1373 3300046507 Ga0495606_0316167 Ga0495606_0316167_145_627 156
1374 3300046512 Ga0495610_0000008 Ga0495610_0000008_584802_585281 156
1375 3300046512 Ga0495610_0001018 Ga0495610_0001018_16550_17029 156
1376 3300046512 Ga0495610_0081480 Ga0495610_0081480_300_770 156
1377 3300046512 Ga0495610_0119289 Ga0495610_0119289_344_826 156
1378 3300046513 Ga0495616_0000034 Ga0495616_0000034_99840_100322 156
1379 3300046513 Ga0495616_0000071 Ga0495616_0000071_72370_72852 156
1380 3300046513 Ga0495616_0000294 Ga0495616_0000294_27182_27652 156
1381 3300046513 Ga0495616_0002129 Ga0495616_0002129_4029_4511 156
1382 3300046513 Ga0495616_0004940 Ga0495616_0004940_197_679 156
1383 3300046513 Ga0495616_0008342 Ga0495616_0008342_1044_1526 156
1384 3300046513 Ga0495616_0014033 Ga0495616_0014033_3907_4389 156
1385 3300046513 Ga0495616_0132029 Ga0495616_0132029_47_529 156
1386 3300046513 Ga0495616_0221478 Ga0495616_0221478_278_781 156
1387 3300046515 Ga0495620_0031646 Ga0495620_0031646_1635_2117 156
1388 3300046515 Ga0495620_0061356 Ga0495620_0061356_300_770 156
1389 3300046515 Ga0495620_0072090 Ga0495620_0072090_66_548 156
1390 3300046515 Ga0495620_0224872 Ga0495620_0224872_200_682 156
1391 3300046516 Ga0495628_0377451 Ga0495628_0377451_206_676 156
1392 3300046517 Ga0495630_0225575 Ga0495630_0225575_294_764 156
1393 3300046517 Ga0495630_0288158 Ga0495630_0288158_28_501 156
1394 3300046518 Ga0495631_0000042 Ga0495631_0000042_67017_67487 156
1395 3300046518 Ga0495631_0000408 Ga0495631_0000408_28937_29419 156
1396 3300046518 Ga0495631_0001648 Ga0495631_0001648_8936_9418 156
1397 3300046518 Ga0495631_0037703 Ga0495631_0037703_57_539 156
1398 3300046518 Ga0495631_0042931 Ga0495631_0042931_1235_1717 156
1399 3300046519 Ga0495632_0000033 Ga0495632_0000033_90084_90566 156
1400 3300046519 Ga0495632_0000086 Ga0495632_0000086_56297_56779 156
1401 3300046519 Ga0495632_0000321 Ga0495632_0000321_33876_34379 156
1402 3300046519 Ga0495632_0001237 Ga0495632_0001237_13831_14313 156
1403 3300046519 Ga0495632_0005196 Ga0495632_0005196_1722_2192 156
1404 3300046519 Ga0495632_0008164 Ga0495632_0008164_5740_6222 156
1405 3300046519 Ga0495632_0028978 Ga0495632_0028978_1496_1981 156
1406 3300046519 Ga0495632_0112266 Ga0495632_0112266_508_990 156
1407 3300046519 Ga0495632_0204880 Ga0495632_0204880_401_871 156
1408 3300046520 Ga0495637_0003831 Ga0495637_0003831_300_770 156
1409 3300046520 Ga0495637_0005223 Ga0495637_0005223_5457_5936 156
1410 3300046520 Ga0495637_0020863 Ga0495637_0020863_38_517 156
1411 3300046520 Ga0495637_0052143 Ga0495637_0052143_323_805 156
1412 3300046520 Ga0495637_0052357 Ga0495637_0052357_607_1089 156
1413 3300046520 Ga0495637_0068682 Ga0495637_0068682_341_823 156
1414 3300046520 Ga0495637_0097785 Ga0495637_0097785_287_769 156
1415 3300046520 Ga0495637_0193181 Ga0495637_0193181_222_704 156
1416 3300046522 Ga0495643_0000096 Ga0495643_0000096_102612_103106 156
1417 3300046522 Ga0495643_0000398 Ga0495643_0000398_56216_56698 156
1418 3300046522 Ga0495643_0000760 Ga0495643_0000760_21383_21886 156
1419 3300046522 Ga0495643_0001857 Ga0495643_0001857_528_1010 156
1420 3300046522 Ga0495643_0024026 Ga0495643_0024026_351_833 156
1421 3300046522 Ga0495643_0035116 Ga0495643_0035116_984_1466 156
1422 3300046522 Ga0495643_0048354 Ga0495643_0048354_1317_1799 156
1423 3300046522 Ga0495643_0068006 Ga0495643_0068006_329_811 156
1424 3300046522 Ga0495643_0084857 Ga0495643_0084857_797_1276 156
1425 3300046522 Ga0495643_0197664 Ga0495643_0197664_176_658 156
1426 3300046522 Ga0495643_0274842 Ga0495643_0274842_226_711 156
1427 3300046523 Ga0495644_0000030 Ga0495644_0000030_13730_14203 156
1428 3300046523 Ga0495644_0033198 Ga0495644_0033198_768_1250 156
1429 3300046524 Ga0495648_0000505 Ga0495648_0000505_9355_9837 156
1430 3300046524 Ga0495648_0001508 Ga0495648_0001508_6487_6966 156
1431 3300046524 Ga0495648_0011019 Ga0495648_0011019_6283_6765 156
1432 3300046524 Ga0495648_0016203 Ga0495648_0016203_76_558 156
1433 3300046524 Ga0495648_0020401 Ga0495648_0020401_1124_1606 156
1434 3300046524 Ga0495648_0024378 Ga0495648_0024378_136_618 156
1435 3300046524 Ga0495648_0036767 Ga0495648_0036767_946_1428 156
1436 3300046524 Ga0495648_0041837 Ga0495648_0041837_2138_2617 156
1437 3300046524 Ga0495648_0054396 Ga0495648_0054396_1578_2060 156
1438 3300046524 Ga0495648_0115262 Ga0495648_0115262_48_518 156
1439 3300046524 Ga0495648_0292683 Ga0495648_0292683_117_599 156
1440 3300046528 Ga0495642_0000246 Ga0495642_0000246_26112_26594 156
1441 3300046528 Ga0495642_0000273 Ga0495642_0000273_5525_6007 156
1442 3300046528 Ga0495642_0003450 Ga0495642_0003450_1594_2076 156
1443 3300046528 Ga0495642_0054844 Ga0495642_0054844_1124_1609 156
1444 3300046528 Ga0495642_0063629 Ga0495642_0063629_886_1368 156
1445 3300046528 Ga0495642_0099496 Ga0495642_0099496_665_1147 156
1446 3300046528 Ga0495642_0218528 Ga0495642_0218528_187_669 156
1447 3300046530 Ga0495654_0000058 Ga0495654_0000058_105490_105969 156
1448 3300046530 Ga0495654_0001164 Ga0495654_0001164_13051_13533 156
1449 3300046530 Ga0495654_0002363 Ga0495654_0002363_8857_9336 156
1450 3300046530 Ga0495654_0008964 Ga0495654_0008964_4710_5192 156
1451 3300046530 Ga0495654_0020402 Ga0495654_0020402_402_875 156
1452 3300046530 Ga0495654_0045998 Ga0495654_0045998_42_521 156
1453 3300046530 Ga0495654_0054787 Ga0495654_0054787_416_898 156
1454 3300046530 Ga0495654_0058094 Ga0495654_0058094_1101_1571 156
1455 3300046530 Ga0495654_0174153 Ga0495654_0174153_143_625 156
1456 3300046530 Ga0495654_0205785 Ga0495654_0205785_124_648 156
1457 3300046535 Ga0495586_0509190 Ga0495586_0509190_11_493 156
1458 3300046536 Ga0495587_0200705 Ga0495587_0200705_30_500 156
1459 3300046536 Ga0495587_0292480 Ga0495587_0292480_306_788 156
1460 3300046537 Ga0495598_0069329 Ga0495598_0069329_53_568 156
1461 3300046538 Ga0495609_0000044 Ga0495609_0000044_88763_89245 156
1462 3300046538 Ga0495609_0000913 Ga0495609_0000913_3059_3541 156
1463 3300046538 Ga0495609_0000919 Ga0495609_0000919_5283_5765 156
1464 3300046538 Ga0495609_0002371 Ga0495609_0002371_184_663 156
1465 3300046538 Ga0495609_0005079 Ga0495609_0005079_5854_6336 156
1466 3300046538 Ga0495609_0034221 Ga0495609_0034221_1490_1972 156
1467 3300046538 Ga0495609_0094690 Ga0495609_0094690_68_550 156
1468 3300046538 Ga0495609_0199349 Ga0495609_0199349_109_591 156
1469 3300046539 Ga0495621_0041382 Ga0495621_0041382_956_1471 156
1470 3300046539 Ga0495621_0098758 Ga0495621_0098758_447_917 156
1471 3300046539 Ga0495621_0099677 Ga0495621_0099677_379_849 156
1472 3300046539 Ga0495621_0100499 Ga0495621_0100499_472_957 156
1473 3300046542 Ga0495597_0000996 Ga0495597_0000996_11691_12170 156
1474 3300046542 Ga0495597_0001025 Ga0495597_0001025_14512_14994 156
1475 3300046542 Ga0495597_0003730 Ga0495597_0003730_1662_2144 156
1476 3300046542 Ga0495597_0030025 Ga0495597_0030025_476_958 156
1477 3300046542 Ga0495597_0041564 Ga0495597_0041564_522_1001 156
1478 3300046542 Ga0495597_0084653 Ga0495597_0084653_651_1133 156
1479 3300046543 Ga0495645_0181194 Ga0495645_0181194_351_866 156
1480 3300046557 Ga0495622_0051350 Ga0495622_0051350_98_580 156
1481 3300046557 Ga0495622_0063469 Ga0495622_0063469_807_1286 156
1482 3300046558 Ga0495633_0000521 Ga0495633_0000521_22448_22927 156
1483 3300046558 Ga0495633_0003990 Ga0495633_0003990_4185_4664 156
1484 3300046558 Ga0495633_0019390 Ga0495633_0019390_1103_1582 156
1485 3300046558 Ga0495633_0073496 Ga0495633_0073496_974_1489 156
1486 3300046558 Ga0495633_0249677 Ga0495633_0249677_169_639 156
1487 3300046558 Ga0495633_0310676 Ga0495633_0310676_63_542 156
1488 3300046559 Ga0495667_0081116 Ga0495667_0081116_1039_1509 156
1489 3300046615 Ga0495656_0006352 Ga0495656_0006352_2381_2854 156
1490 3300046616 Ga0495668_0000193 Ga0495668_0000193_36392_36865 156
1491 3300046616 Ga0495668_0000669 Ga0495668_0000669_11808_12290 156
1492 3300046616 Ga0495668_0051691 Ga0495668_0051691_349_819 156
1493 3300046616 Ga0495668_0123854 Ga0495668_0123854_597_1079 156
1494 3300046616 Ga0495668_0133597 Ga0495668_0133597_321_803 156
1495 3300046616 Ga0495668_0255204 Ga0495668_0255204_310_792 156
1496 3300046616 Ga0495668_0312677 Ga0495668_0312677_100_582 156
1497 3300046616 Ga0495668_0373975 Ga0495668_0373975_269_751 156
1498 3300046616 Ga0495668_0375524 Ga0495668_0375524_121_603 156
1499 3300046642 Ga0495634_0293425 Ga0495634_0293425_371_841 156
1500 3300046642 Ga0495634_0438806 Ga0495634_0438806_55_525 156
1501 3300046648 Ga0495611_0000439 Ga0495611_0000439_8889_9362 156
1502 3300046648 Ga0495611_0179729 Ga0495611_0179729_121_603 156
1503 3300046648 Ga0495611_0192884 Ga0495611_0192884_100_570 156
1504 3300046660 Ga0495625_0000224 Ga0495625_0000224_61329_61799 156
1505 3300046660 Ga0495625_0004383 Ga0495625_0004383_1963_2433 156
1506 3300046660 Ga0495625_0010559 Ga0495625_0010559_323_805 156
1507 3300046660 Ga0495625_0010801 Ga0495625_0010801_2243_2725 156
1508 3300046660 Ga0495625_0021731 Ga0495625_0021731_1740_2210 156
1509 3300046660 Ga0495625_0054514 Ga0495625_0054514_371_850 156
1510 3300046660 Ga0495625_0080161 Ga0495625_0080161_1390_1872 156
1511 3300046660 Ga0495625_0083807 Ga0495625_0083807_349_831 156
1512 3300046660 Ga0495625_0114980 Ga0495625_0114980_414_893 156
1513 3300046660 Ga0495625_0147503 Ga0495625_0147503_511_981 156
1514 3300046660 Ga0495625_0227577 Ga0495625_0227577_46_516 156
1515 3300046660 Ga0495625_0385197 Ga0495625_0385197_50_532 156
1516 3300046660 Ga0495625_0451389 Ga0495625_0451389_16_495 156
1517 3300046660 Ga0495625_0592313 Ga0495625_0592313_27_509 156
1518 3300046663 Ga0495635_0418108 Ga0495635_0418108_176_691 156
1519 3300046664 Ga0495659_0000041 Ga0495659_0000041_41846_42325 156
1520 3300046665 Ga0495661_0000049 Ga0495661_0000049_88092_88574 156
1521 3300046665 Ga0495661_0000170 Ga0495661_0000170_43670_44173 156
1522 3300046665 Ga0495661_0000325 Ga0495661_0000325_17550_18032 156
1523 3300046665 Ga0495661_0000843 Ga0495661_0000843_18230_18712 156
1524 3300046665 Ga0495661_0001206 Ga0495661_0001206_6305_6787 156
1525 3300046665 Ga0495661_0002108 Ga0495661_0002108_10118_10600 156
1526 3300046665 Ga0495661_0005969 Ga0495661_0005969_7265_7747 156
1527 3300046665 Ga0495661_0024188 Ga0495661_0024188_1970_2452 156
1528 3300046665 Ga0495661_0040999 Ga0495661_0040999_1973_2455 156
1529 3300046665 Ga0495661_0062830 Ga0495661_0062830_1011_1484 156
1530 3300046665 Ga0495661_0126875 Ga0495661_0126875_688_1167 156
1531 3300046665 Ga0495661_0166230 Ga0495661_0166230_383_865 156
1532 3300046665 Ga0495661_0217644 Ga0495661_0217644_407_889 156
1533 3300046665 Ga0495661_0478153 Ga0495661_0478153_91_573 156
1534 3300046674 Ga0495588_0020475 Ga0495588_0020475_500_982 156
1535 3300046674 Ga0495588_0026306 Ga0495588_0026306_891_1370 156
1536 3300046674 Ga0495588_0191695 Ga0495588_0191695_391_861 156
1537 3300046674 Ga0495588_0218584 Ga0495588_0218584_52_522 156
1538 3300046675 Ga0495657_0274252 Ga0495657_0274252_405_875 156
1539 3300046680 Ga0495646_0005993 Ga0495646_0005993_5007_5489 156
1540 3300046680 Ga0495646_0284957 Ga0495646_0284957_206_688 156
1541 3300046681 Ga0495647_0116960 Ga0495647_0116960_434_904 156
1542 3300046681 Ga0495647_0122974 Ga0495647_0122974_467_982 156
1543 3300046681 Ga0495647_0150415 Ga0495647_0150415_250_720 156
1544 3300046681 Ga0495647_0157311 Ga0495647_0157311_113_628 156
1545 3300046683 Ga0495658_0010460 Ga0495658_0010460_1654_2124 156
1546 3300046683 Ga0495658_0037225 Ga0495658_0037225_1700_2182 156
1547 3300046683 Ga0495658_0068835 Ga0495658_0068835_336_806 156
1548 3300046683 Ga0495658_0180529 Ga0495658_0180529_145_660 156
1549 3300046683 Ga0495658_0327932 Ga0495658_0327932_171_686 156
1550 3300046683 Ga0495658_0525918 Ga0495658_0525918_34_507 156
1551 3300046684 Ga0495669_0000091 Ga0495669_0000091_2399_2881 156
1552 3300046684 Ga0495669_0015836 Ga0495669_0015836_313_795 156
1553 3300046684 Ga0495669_0029860 Ga0495669_0029860_281_763 156
1554 3300046684 Ga0495669_0256211 Ga0495669_0256211_324_806 156
1555 3300046689 Ga0495613_0387219 Ga0495613_0387219_370_885 156
1556 3300046691 Ga0495670_0024393 Ga0495670_0024393_1663_2133 156
1557 3300046691 Ga0495670_0030552 Ga0495670_0030552_745_1227 156
1558 3300046691 Ga0495670_0257154 Ga0495670_0257154_255_725 156
1559 3300046692 Ga0495671_0000002 Ga0495671_0000002_1108197_1108676 156
1560 3300046692 Ga0495671_0000131 Ga0495671_0000131_4462_4944 156
1561 3300046692 Ga0495671_0000198 Ga0495671_0000198_51552_52031 156
1562 3300046692 Ga0495671_0001101 Ga0495671_0001101_8581_9060 156
1563 3300046692 Ga0495671_0062030 Ga0495671_0062030_710_1180 156
1564 3300046692 Ga0495671_0241127 Ga0495671_0241127_301_783 156
1565 3300046692 Ga0495671_0334160 Ga0495671_0334160_56_538 156
1566 3300046694 Ga0495649_0000303 Ga0495649_0000303_24193_24675 156
1567 3300046694 Ga0495649_0001551 Ga0495649_0001551_6234_6704 156
1568 3300046694 Ga0495649_0007850 Ga0495649_0007850_509_991 156
1569 3300046694 Ga0495649_0077226 Ga0495649_0077226_1195_1677 156
1570 3300046694 Ga0495649_0152523 Ga0495649_0152523_486_968 156
1571 3300046694 Ga0495649_0287073 Ga0495649_0287073_259_741 156
1572 3300046694 Ga0495649_0497529 Ga0495649_0497529_32_514 156
1573 3300046794 Ga0495589_0000035 Ga0495589_0000035_88763_89245 156
1574 3300046794 Ga0495589_0000219 Ga0495589_0000219_42427_42909 156
1575 3300046794 Ga0495589_0004514 Ga0495589_0004514_251_733 156
1576 3300046794 Ga0495589_0014524 Ga0495589_0014524_3372_3854 156
1577 3300046794 Ga0495589_0086051 Ga0495589_0086051_427_909 156
1578 3300046794 Ga0495589_0145767 Ga0495589_0145767_440_919 156
1579 3300046794 Ga0495589_0157520 Ga0495589_0157520_89_571 156
1580 3300046794 Ga0495589_0294625 Ga0495589_0294625_118_600 156
1581 3300046809 Ga0495600_0177981 Ga0495600_0177981_352_822 156
1582 3300046809 Ga0495600_0459836 Ga0495600_0459836_196_678 156
1583 3300046810 Ga0495660_0002312 Ga0495660_0002312_11171_11653 156
1584 3300046810 Ga0495660_0004863 Ga0495660_0004863_3958_4440 156
1585 3300046810 Ga0495660_0012822 Ga0495660_0012822_2445_2927 156
1586 3300046810 Ga0495660_0018326 Ga0495660_0018326_2486_2968 156
1587 3300046810 Ga0495660_0027191 Ga0495660_0027191_204_683 156
1588 3300046810 Ga0495660_0027838 Ga0495660_0027838_478_957 156
1589 3300046810 Ga0495660_0030060 Ga0495660_0030060_87_566 156
1590 3300046810 Ga0495660_0092147 Ga0495660_0092147_775_1257 156
1591 3300046810 Ga0495660_0134626 Ga0495660_0134626_613_1092 156
1592 3300046810 Ga0495660_0141449 Ga0495660_0141449_306_776 156
1593 3300047317 Ga0495604_0413231 Ga0495604_0413231_121_591 156
1594 3300047320 Ga0495672_0000031 Ga0495672_0000031_84247_84729 156
1595 3300047320 Ga0495672_0000685 Ga0495672_0000685_9934_10416 156
1596 3300047320 Ga0495672_0001603 Ga0495672_0001603_14489_14968 156
1597 3300047320 Ga0495672_0005983 Ga0495672_0005983_3718_4200 156
1598 3300047320 Ga0495672_0021488 Ga0495672_0021488_724_1206 156
1599 3300047321 Ga0495676_0000398 Ga0495676_0000398_10990_11460 156
1600 3300047321 Ga0495676_0030096 Ga0495676_0030096_344_826 156
1601 3300047321 Ga0495676_0069402 Ga0495676_0069402_1435_1917 156
1602 3300047322 Ga0495680_0509407 Ga0495680_0509407_54_536 156
1603 3300047323 Ga0495683_0003254 Ga0495683_0003254_8046_8528 156
1604 3300047323 Ga0495683_0072619 Ga0495683_0072619_308_778 156
1605 3300047323 Ga0495683_0116569 Ga0495683_0116569_737_1219 156
1606 3300047323 Ga0495683_0432777 Ga0495683_0432777_41_523 156
1607 3300047443 Ga0495687_000002 Ga0495687_000002_454228_454710 156
1608 3300047443 Ga0495687_000066 Ga0495687_000066_88763_89245 156
1609 3300047443 Ga0495687_001453 Ga0495687_001453_7946_8428 156
1610 3300047443 Ga0495687_002257 Ga0495687_002257_11250_11732 156
1611 3300047443 Ga0495687_004333 Ga0495687_004333_4728_5198 156
1612 3300047443 Ga0495687_012673 Ga0495687_012673_1194_1676 156
1613 3300047443 Ga0495687_013163 Ga0495687_013163_3168_3650 156
1614 3300047443 Ga0495687_018635 Ga0495687_018635_87_569 156
1615 3300047443 Ga0495687_031321 Ga0495687_031321_1307_1789 156
1616 3300047445 Ga0495677_0000013 Ga0495677_0000013_72398_72880 156
1617 3300047445 Ga0495677_0000512 Ga0495677_0000512_6288_6761 156
1618 3300047445 Ga0495677_0000550 Ga0495677_0000550_1246_1728 156
1619 3300047445 Ga0495677_0050369 Ga0495677_0050369_413_916 156
1620 3300047445 Ga0495677_0088148 Ga0495677_0088148_264_734 156
1621 3300047445 Ga0495677_0148178 Ga0495677_0148178_315_797 156
1622 3300047445 Ga0495677_0202949 Ga0495677_0202949_42_524 156
1623 3300047446 Ga0495679_000296 Ga0495679_000296_27552_28031 156
1624 3300047446 Ga0495679_002037 Ga0495679_002037_7217_7696 156
1625 3300047446 Ga0495679_010136 Ga0495679_010136_2547_3029 156
1626 3300047446 Ga0495679_045256 Ga0495679_045256_82_561 156
1627 3300047447 Ga0495685_040375 Ga0495685_040375_903_1385 156
1628 3300047469 Ga0495673_0000061 Ga0495673_0000061_159781_160254 156
1629 3300047469 Ga0495673_0000926 Ga0495673_0000926_8470_8949 156
1630 3300047470 Ga0495681_0000016 Ga0495681_0000016_69244_69726 156
1631 3300047470 Ga0495681_0022987 Ga0495681_0022987_639_1118 156
1632 3300047470 Ga0495681_0104177 Ga0495681_0104177_21_506 156
1633 3300047472 Ga0495686_0000054 Ga0495686_0000054_43976_44458 156
1634 3300047472 Ga0495686_0000464 Ga0495686_0000464_44183_44665 156
1635 3300047472 Ga0495686_0001324 Ga0495686_0001324_19227_19697 156
1636 3300047472 Ga0495686_0269510 Ga0495686_0269510_298_777 156
1637 3300047472 Ga0495686_0459673 Ga0495686_0459673_37_507 156
1638 3300047673 Ga0495593_0000083 Ga0495593_0000083_21336_21806 156
1639 3300047673 Ga0495593_0017089 Ga0495593_0017089_133_615 156
1640 3300048088 Ga0495602_0232178 Ga0495602_0232178_773_1255 156
1641 3300048089 Ga0495614_0004378 Ga0495614_0004378_5251_5721 156
1642 3300048089 Ga0495614_0010642 Ga0495614_0010642_428_910 156
1643 3300048091 Ga0495626_0000011 Ga0495626_0000011_131977_132459 156
1644 3300048091 Ga0495626_0000071 Ga0495626_0000071_60271_60753 156
1645 3300048091 Ga0495626_0005258 Ga0495626_0005258_5934_6416 156
1646 3300048091 Ga0495626_0008223 Ga0495626_0008223_4694_5176 156
1647 3300048091 Ga0495626_0020612 Ga0495626_0020612_995_1477 156
1648 3300048091 Ga0495626_0029974 Ga0495626_0029974_1990_2472 156
1649 3300048091 Ga0495626_0031597 Ga0495626_0031597_1737_2231 156
1650 3300048091 Ga0495626_0058708 Ga0495626_0058708_223_705 156
1651 3300048091 Ga0495626_0059441 Ga0495626_0059441_418_900 156
1652 3300048091 Ga0495626_0065283 Ga0495626_0065283_914_1396 156
1653 3300048091 Ga0495626_0066936 Ga0495626_0066936_511_993 156
1654 3300048091 Ga0495626_0086231 Ga0495626_0086231_761_1243 156
1655 3300048091 Ga0495626_0090886 Ga0495626_0090886_754_1236 156
1656 3300048091 Ga0495626_0127985 Ga0495626_0127985_66_569 156
1657 3300048091 Ga0495626_0127989 Ga0495626_0127989_518_1021 156
1658 3300048091 Ga0495626_0399090 Ga0495626_0399090_31_513 156
1659 3300048903 Ga0496100_0002053 Ga0496100_0002053_9574_10044 156
1660 3300048903 Ga0496100_0007896 Ga0496100_0007896_1812_2294 156
1661 3300048903 Ga0496100_0456306 Ga0496100_0456306_242_712 156
1662 3300048904 Ga0496101_0056761 Ga0496101_0056761_2130_2612 156
1663 3300048904 Ga0496101_0067612 Ga0496101_0067612_597_1067 156
1664 3300048904 Ga0496101_0485113 Ga0496101_0485113_270_785 156
1665 3300048905 Ga0496102_0003799 Ga0496102_0003799_8510_8980 156
1666 3300048905 Ga0496102_0047264 Ga0496102_0047264_676_1146 156
1667 3300048905 Ga0496102_0191157 Ga0496102_0191157_794_1270 156
1668 3300048905 Ga0496102_0509070 Ga0496102_0509070_271_741 156
1669 3300048906 Ga0496103_0246927 Ga0496103_0246927_538_1008 156
1670 3300048907 Ga0496104_0004101 Ga0496104_0004101_10927_11397 156
1671 3300048907 Ga0496104_0058001 Ga0496104_0058001_2688_3164 156
1672 3300048907 Ga0496104_0330733 Ga0496104_0330733_269_751 156
1673 3300048907 Ga0496104_0657970 Ga0496104_0657970_67_552 156
1674 3300048908 Ga0496105_0043048 Ga0496105_0043048_138_608 156
1675 3300048908 Ga0496105_0592230 Ga0496105_0592230_157_627 156
1676 3300048908 Ga0496105_0626676 Ga0496105_0626676_256_738 156
1677 3300048909 Ga0496106_0012220 Ga0496106_0012220_436_912 156
1678 3300048909 Ga0496106_0055120 Ga0496106_0055120_2366_2836 156
1679 3300048910 Ga0496107_0130976 Ga0496107_0130976_328_798 156
1680 3300048910 Ga0496107_0372999 Ga0496107_0372999_503_973 156
1681 3300048911 Ga0496108_0067782 Ga0496108_0067782_741_1211 156
1682 3300048911 Ga0496108_0254884 Ga0496108_0254884_25_510 156
1683 3300048911 Ga0496108_0525511 Ga0496108_0525511_449_961 156
1684 3300048912 Ga0496109_0034590 Ga0496109_0034590_3993_4475 156
1685 3300048912 Ga0496109_0069873 Ga0496109_0069873_2431_2901 156
1686 3300048912 Ga0496109_1231936 Ga0496109_1231936_15_497 156
1687 3300048913 Ga0496110_0094088 Ga0496110_0094088_1158_1628 156
1688 3300048913 Ga0496110_0128599 Ga0496110_0128599_1387_1857 156
1689 3300048913 Ga0496110_0158310 Ga0496110_0158310_1075_1551 156
1690 3300048913 Ga0496110_0353796 Ga0496110_0353796_703_1185 156
1691 3300048914 Ga0496111_0062777 Ga0496111_0062777_522_992 156
1692 3300048914 Ga0496111_0252643 Ga0496111_0252643_563_1033 156
1693 3300048914 Ga0496111_0669728 Ga0496111_0669728_263_745 156
1694 3300048915 Ga0496112_0277695 Ga0496112_0277695_43_525 156
1695 3300048916 Ga0496113_0010989 Ga0496113_0010989_4859_5341 156
1696 3300048916 Ga0496113_0122050 Ga0496113_0122050_1081_1557 156
1697 3300048916 Ga0496113_0990754 Ga0496113_0990754_53_568 156
1698 3300048917 Ga0496114_0218590 Ga0496114_0218590_640_1116 156
1699 3300048917 Ga0496114_0341868 Ga0496114_0341868_750_1220 156
1700 3300048917 Ga0496114_0601822 Ga0496114_0601822_322_792 156
1701 3300048918 Ga0496115_0259830 Ga0496115_0259830_490_966 156
1702 3300048919 Ga0496116_0163029 Ga0496116_0163029_329_808 156
1703 3300048919 Ga0496116_0166712 Ga0496116_0166712_665_1147 156
1704 3300048919 Ga0496116_0266748 Ga0496116_0266748_64_534 156
1705 3300048920 Ga0496117_0013508 Ga0496117_0013508_5402_5872 156
1706 3300048920 Ga0496117_0019516 Ga0496117_0019516_2576_3058 156
1707 3300048920 Ga0496117_0052144 Ga0496117_0052144_414_902 156
1708 3300048921 Ga0496118_0009116 Ga0496118_0009116_6815_7297 156
1709 3300048921 Ga0496118_0053625 Ga0496118_0053625_621_1091 156
1710 3300048924 Ga0496121_0045456 Ga0496121_0045456_1443_1925 156
1711 3300048924 Ga0496121_0089403 Ga0496121_0089403_599_1072 156
1712 3300048924 Ga0496121_0188861 Ga0496121_0188861_310_798 156
1713 3300048925 Ga0496122_0000552 Ga0496122_0000552_55200_55682 156
1714 3300048925 Ga0496122_0127986 Ga0496122_0127986_439_921 156
1715 3300048926 Ga0496123_0001585 Ga0496123_0001585_17483_17965 156
1716 3300048926 Ga0496123_0025017 Ga0496123_0025017_197_685 156
1717 3300048926 Ga0496123_0052955 Ga0496123_0052955_694_1176 156
1718 3300048926 Ga0496123_0143032 Ga0496123_0143032_608_1090 156
1719 3300048927 Ga0496124_0089671 Ga0496124_0089671_1452_1934 156
1720 3300048927 Ga0496124_0142076 Ga0496124_0142076_1066_1590 156
1721 3300048927 Ga0496124_0166873 Ga0496124_0166873_1131_1613 156
1722 3300048927 Ga0496124_0189507 Ga0496124_0189507_513_983 156
1723 3300048928 Ga0496125_0001368 Ga0496125_0001368_12960_13442 156
1724 3300048928 Ga0496125_0009166 Ga0496125_0009166_775_1248 156
1725 3300048928 Ga0496125_0034798 Ga0496125_0034798_2665_3147 156
1726 3300048928 Ga0496125_0056434 Ga0496125_0056434_1715_2197 156
1727 3300048928 Ga0496125_0190126 Ga0496125_0190126_183_653 156
1728 3300048928 Ga0496125_0256365 Ga0496125_0256365_507_989 156
1729 3300048928 Ga0496125_0471999 Ga0496125_0471999_17_496 156
1730 3300048929 Ga0496126_0126980 Ga0496126_0126980_537_1061 156
1731 3300048929 Ga0496126_0496667 Ga0496126_0496667_58_528 156
1732 3300048929 Ga0496126_0547004 Ga0496126_0547004_156_629 156
1733 3300049459 Ga0495678_000009 Ga0495678_000009_103334_103813 156
1734 3300049459 Ga0495678_000035 Ga0495678_000035_27724_28206 156
1735 3300049459 Ga0495678_003416 Ga0495678_003416_1236_1718 156
1736 3300049459 Ga0495678_014610 Ga0495678_014610_2448_2918 156
1737 3300049459 Ga0495678_094668 Ga0495678_094668_64_534 156
1738 3300049460 Ga0495682_0001939 Ga0495682_0001939_548_1030 156
1739 3300049460 Ga0495682_0002609 Ga0495682_0002609_7671_8153 156
1740 3300049460 Ga0495682_0007946 Ga0495682_0007946_175_654 156
1741 3300049460 Ga0495682_0068522 Ga0495682_0068522_442_924 156
1742 3300049521 Ga0501298_011896 Ga0501298_011896_932_1408 156
1743 3300049523 Ga0501300_018393 Ga0501300_018393_423_899 156
1744 3300049526 Ga0501303_004894 Ga0501303_004894_538_1014 156
1745 3300049569 Ga0501032_0057759 Ga0501032_0057759_1140_1622 156
1746 3300049579 Ga0501043_0010569 Ga0501043_0010569_6308_6790 156
1747 3300049579 Ga0501043_0365601 Ga0501043_0365601_351_824 156
1748 3300049579 Ga0501043_0623108 Ga0501043_0623108_257_739 156
1749 3300049580 Ga0501046_0012537 Ga0501046_0012537_6307_6789 156
1750 3300049581 Ga0501047_0015658 Ga0501047_0015658_437_919 156
1751 3300049582 Ga0501048_0068146 Ga0501048_0068146_1627_2109 156
1752 3300049583 Ga0501067_0457017 Ga0501067_0457017_64_627 156
1753 3300049653 Ga0501206_015062 Ga0501206_015062_237_719 156
1754 3300049662 Ga0501222_011032 Ga0501222_011032_542_1024 156
1755 3300049673 Ga0501240_015693 Ga0501240_015693_240_719 156
1756 3300049679 Ga0501249_001955 Ga0501249_001955_1322_1801 156
1757 3300049705 Ga0501225_0009720 Ga0501225_0009720_239_718 156
1758 3300049741 Ga0501079_0898240 Ga0501079_0898240_146_628 156
1759 3300049759 Ga0501262_000333 Ga0501262_000333_2532_3011 156
1760 3300049761 Ga0501264_008911 Ga0501264_008911_303_785 156
1761 3300049762 Ga0501265_002430 Ga0501265_002430_530_1006 156
1762 3300050489 nmdc:mga03683_11059_c1 nmdc:mga03683_11059_c1_113_595 156
1763 3300050489 nmdc:mga03683_121243_c1 nmdc:mga03683_121243_c1_33_503 156
1764 3300050489 nmdc:mga03683_176849_c1 nmdc:mga03683_176849_c1_482_952 156
1765 3300050489 nmdc:mga03683_191079_c1 nmdc:mga03683_191079_c1_94_576 156
1766 3300050489 nmdc:mga03683_2207_c1 nmdc:mga03683_2207_c1_304_774 156
1767 3300050489 nmdc:mga03683_231868_c1 nmdc:mga03683_231868_c1_22_492 156
1768 3300050489 nmdc:mga03683_312174_c1 nmdc:mga03683_312174_c1_106_591 156
1769 3300050489 nmdc:mga03683_351698_c1 nmdc:mga03683_351698_c1_197_679 156
1770 3300050489 nmdc:mga03683_4604_c1 nmdc:mga03683_4604_c1_3380_3862 156
1771 3300050489 nmdc:mga03683_505229_c1 nmdc:mga03683_505229_c1_31_513 156
1772 3300050489 nmdc:mga03683_52226_c1 nmdc:mga03683_52226_c1_463_936 156
1773 3300050489 nmdc:mga03683_558913_c1 nmdc:mga03683_558913_c1_59_529 156
1774 3300050489 nmdc:mga03683_7947_c2 nmdc:mga03683_7947_c2_122_592 156
1775 3300050490 nmdc:mga03n38_132691_c1 nmdc:mga03n38_132691_c1_712_1194 156
1776 3300050490 nmdc:mga03n38_395696_c1 nmdc:mga03n38_395696_c1_271_750 156
1777 3300050490 nmdc:mga03n38_73274_c1 nmdc:mga03n38_73274_c1_721_1191 156
1778 3300050491 nmdc:mga00v17_28836_c1 nmdc:mga00v17_28836_c1_2491_2961 156
1779 3300050491 nmdc:mga00v17_309415_c1 nmdc:mga00v17_309415_c1_514_1002 156
1780 3300050491 nmdc:mga00v17_779504_c1 nmdc:mga00v17_779504_c1_110_580 156
1781 3300050493 nmdc:mga0k408_12545_c1 nmdc:mga0k408_12545_c1_791_1273 156
1782 3300050493 nmdc:mga0k408_136604_c1 nmdc:mga0k408_136604_c1_730_1212 156
1783 3300050493 nmdc:mga0k408_143867_c1 nmdc:mga0k408_143867_c1_731_1213 156
1784 3300050493 nmdc:mga0k408_172153_c1 nmdc:mga0k408_172153_c1_466_939 156
1785 3300050493 nmdc:mga0k408_18003_c1 nmdc:mga0k408_18003_c1_222_701 156
1786 3300050493 nmdc:mga0k408_1832_c1 nmdc:mga0k408_1832_c1_6629_7111 156
1787 3300050493 nmdc:mga0k408_2173_c2 nmdc:mga0k408_2173_c2_6273_6800 156
1788 3300050493 nmdc:mga0k408_23489_c1 nmdc:mga0k408_23489_c1_601_1071 156
1789 3300050493 nmdc:mga0k408_2403_c1 nmdc:mga0k408_2403_c1_9158_9628 156
1790 3300050493 nmdc:mga0k408_25142_c1 nmdc:mga0k408_25142_c1_136_618 156
1791 3300050493 nmdc:mga0k408_3264_c1 nmdc:mga0k408_3264_c1_6696_7169 156
1792 3300050493 nmdc:mga0k408_366874_c1 nmdc:mga0k408_366874_c1_34_516 156
1793 3300050493 nmdc:mga0k408_374987_c1 nmdc:mga0k408_374987_c1_160_636 156
1794 3300050493 nmdc:mga0k408_38001_c1 nmdc:mga0k408_38001_c1_2180_2668 156
1795 3300050493 nmdc:mga0k408_394745_c1 nmdc:mga0k408_394745_c1_12_482 156
1796 3300050493 nmdc:mga0k408_41756_c1 nmdc:mga0k408_41756_c1_1434_1916 156
1797 3300050493 nmdc:mga0k408_483053_c1 nmdc:mga0k408_483053_c1_11_493 156
1798 3300050493 nmdc:mga0k408_519125_c1 nmdc:mga0k408_519125_c1_28_510 156
1799 3300050493 nmdc:mga0k408_6625_c1 nmdc:mga0k408_6625_c1_2519_2992 156
1800 3300050493 nmdc:mga0k408_69454_c1 nmdc:mga0k408_69454_c1_150_620 156
1801 3300050493 nmdc:mga0k408_79993_c1 nmdc:mga0k408_79993_c1_967_1449 156
1802 3300050493 nmdc:mga0k408_83142_c1 nmdc:mga0k408_83142_c1_819_1304 156
1803 3300050493 nmdc:mga0k408_83423_c1 nmdc:mga0k408_83423_c1_687_1160 156
1804 3300050493 nmdc:mga0k408_95654_c1 nmdc:mga0k408_95654_c1_125_595 156
1805 3300050494 nmdc:mga06z11_15676_c1 nmdc:mga06z11_15676_c1_2575_3045 156
1806 3300050494 nmdc:mga06z11_251659_c1 nmdc:mga06z11_251659_c1_227_709 156
1807 3300050494 nmdc:mga06z11_291793_c1 nmdc:mga06z11_291793_c1_444_923 156
1808 3300050494 nmdc:mga06z11_297640_c1 nmdc:mga06z11_297640_c1_195_722 156
1809 3300050494 nmdc:mga06z11_431473_c1 nmdc:mga06z11_431473_c1_98_568 156
1810 3300050494 nmdc:mga06z11_5404_c1 nmdc:mga06z11_5404_c1_65_547 156
1811 3300050495 nmdc:mga04h51_104660_c1 nmdc:mga04h51_104660_c1_236_718 156
1812 3300050495 nmdc:mga04h51_257970_c1 nmdc:mga04h51_257970_c1_117_599 156
1813 3300050496 nmdc:mga07m45_10967_c1 nmdc:mga07m45_10967_c1_403_879 156
1814 3300050496 nmdc:mga07m45_117139_c1 nmdc:mga07m45_117139_c1_425_907 156
1815 3300050496 nmdc:mga07m45_13780_c1 nmdc:mga07m45_13780_c1_2297_2767 156
1816 3300050496 nmdc:mga07m45_142433_c1 nmdc:mga07m45_142433_c1_521_994 156
1817 3300050496 nmdc:mga07m45_173713_c1 nmdc:mga07m45_173713_c1_53_526 156
1818 3300050496 nmdc:mga07m45_23347_c2 nmdc:mga07m45_23347_c2_110_580 156
1819 3300050496 nmdc:mga07m45_257119_c1 nmdc:mga07m45_257119_c1_395_877 156
1820 3300050496 nmdc:mga07m45_43309_c1 nmdc:mga07m45_43309_c1_560_1042 156
1821 3300050496 nmdc:mga07m45_48119_c1 nmdc:mga07m45_48119_c1_1281_1760 156
1822 3300050496 nmdc:mga07m45_6011_c1 nmdc:mga07m45_6011_c1_3159_3641 156
1823 3300050496 nmdc:mga07m45_62617_c1 nmdc:mga07m45_62617_c1_969_1439 156
1824 3300050496 nmdc:mga07m45_70336_c1 nmdc:mga07m45_70336_c1_1480_1962 156
1825 3300050496 nmdc:mga07m45_88815_c1 nmdc:mga07m45_88815_c1_104_586 156
1826 3300050509 nmdc:mga0qj67_725633_c1 nmdc:mga0qj67_725633_c1_164_646 156
1827 3300050513 nmdc:mga0rr50_902513_c1 nmdc:mga0rr50_902513_c1_170_640 156
1828 3300050516 nmdc:mga0sz30_276124_c1 nmdc:mga0sz30_276124_c1_22_504 156
1829 3300050516 nmdc:mga0sz30_294999_c1 nmdc:mga0sz30_294999_c1_36_506 156
1830 3300053077 Ga0495601_0069985 Ga0495601_0069985_1279_1749 156
1831 3300053079 Ga0500610_0000055 Ga0500610_0000055_20476_20946 156
1832 3300053079 Ga0500610_0000454 Ga0500610_0000454_6288_6767 156
1833 3300053079 Ga0500610_0000509 Ga0500610_0000509_5638_6117 156
1834 3300053083 Ga0495655_0078673 Ga0495655_0078673_285_767 156
1835 3300053084 Ga0495595_0056914 Ga0495595_0056914_950_1420 156
1836 3300053084 Ga0495595_0140001 Ga0495595_0140001_476_946 156
1837 3300053085 Ga0495619_0694758 Ga0495619_0694758_49_531 156
1838 3300053086 Ga0500578_0078098 Ga0500578_0078098_779_1249 156
1839 3300053086 Ga0500578_0168990 Ga0500578_0168990_225_707 156
1840 3300053087 Ga0500643_011260 Ga0500643_011260_2209_2691 156
1841 3300053088 Ga0500644_0008080 Ga0500644_0008080_43_516 156
1842 3300053088 Ga0500644_0014654 Ga0500644_0014654_392_862 156
1843 3300053088 Ga0500644_0018208 Ga0500644_0018208_634_1122 156
1844 3300053090 Ga0500646_0132370 Ga0500646_0132370_60_539 156
1845 3300053091 Ga0500647_0050303 Ga0500647_0050303_620_1102 156
1846 3300053091 Ga0500647_0249347 Ga0500647_0249347_143_625 156
1847 3300053092 Ga0500583_0125474 Ga0500583_0125474_165_635 156
1848 3300053092 Ga0500583_0318735 Ga0500583_0318735_206_688 156
1849 3300053092 Ga0500583_0334033 Ga0500583_0334033_45_527 156
1850 3300053093 Ga0500651_0000015 Ga0500651_0000015_10421_10903 156
1851 3300053093 Ga0500651_0000242 Ga0500651_0000242_2652_3122 156
1852 3300053093 Ga0500651_0179287 Ga0500651_0179287_571_1041 156
1853 3300053094 Ga0500566_0129441 Ga0500566_0129441_271_753 156
1854 3300053094 Ga0500566_0362801 Ga0500566_0362801_59_529 156
1855 3300053096 Ga0500641_0211130 Ga0500641_0211130_94_573 156
1856 3300053098 Ga0500650_0128252 Ga0500650_0128252_43_513 156
1857 3300053098 Ga0500650_0260854 Ga0500650_0260854_159_641 156
1858 3300053107 Ga0500560_096383 Ga0500560_096383_389_859 156
1859 3300053108 Ga0500562_010558 Ga0500562_010558_158_631 156
1860 3300053109 Ga0500569_087057 Ga0500569_087057_337_807 156
1861 3300053110 Ga0500571_000017 Ga0500571_000017_53740_54222 156
1862 3300053110 Ga0500571_000074 Ga0500571_000074_11883_12353 156
1863 3300053111 Ga0500572_107590 Ga0500572_107590_248_730 156
1864 3300053111 Ga0500572_210357 Ga0500572_210357_88_558 156
1865 3300053111 Ga0500572_245004 Ga0500572_245004_64_546 156
1866 3300053115 Ga0500591_050154 Ga0500591_050154_742_1227 156
1867 3300053116 Ga0500592_006166 Ga0500592_006166_213_683 156
1868 3300053117 Ga0500593_000097 Ga0500593_000097_27207_27677 156
1869 3300053117 Ga0500593_000242 Ga0500593_000242_16542_17021 156
1870 3300053117 Ga0500593_003350 Ga0500593_003350_5335_5823 156
1871 3300053118 Ga0500594_0002529 Ga0500594_0002529_3211_3681 156
1872 3300053118 Ga0500594_0021001 Ga0500594_0021001_854_1336 156
1873 3300053121 Ga0500607_000025 Ga0500607_000025_70561_71040 156
1874 3300053121 Ga0500607_000049 Ga0500607_000049_44663_45133 156
1875 3300053121 Ga0500607_019928 Ga0500607_019928_3193_3675 156
1876 3300053121 Ga0500607_135680 Ga0500607_135680_138_620 156
1877 3300053122 Ga0500608_012479 Ga0500608_012479_2262_2744 156
1878 3300053123 Ga0500614_156419 Ga0500614_156419_78_560 156
1879 3300053125 Ga0500618_000173 Ga0500618_000173_42240_42719 156
1880 3300053125 Ga0500618_015894 Ga0500618_015894_166_636 156
1881 3300053125 Ga0500618_052678 Ga0500618_052678_244_723 156
1882 3300053125 Ga0500618_058291 Ga0500618_058291_27_551 156
1883 3300053128 Ga0500626_009438 Ga0500626_009438_3030_3500 156
1884 3300053133 Ga0500655_000065 Ga0500655_000065_14948_15418 156
1885 3300053133 Ga0500655_002857 Ga0500655_002857_2144_2626 156
1886 3300053134 Ga0500658_0000028 Ga0500658_0000028_74882_75352 156
1887 3300053134 Ga0500658_0000054 Ga0500658_0000054_57386_57868 156
1888 3300053134 Ga0500658_0003025 Ga0500658_0003025_2899_3381 156
1889 3300053134 Ga0500658_0042452 Ga0500658_0042452_773_1255 156
1890 3300053136 Ga0500559_0001694 Ga0500559_0001694_11257_11739 156
1891 3300053136 Ga0500559_0004268 Ga0500559_0004268_2359_2829 156
1892 3300053136 Ga0500559_0006743 Ga0500559_0006743_2389_2874 156
1893 3300053136 Ga0500559_0015080 Ga0500559_0015080_339_809 156
1894 3300053136 Ga0500559_0025318 Ga0500559_0025318_1865_2347 156
1895 3300053136 Ga0500559_0093712 Ga0500559_0093712_90_560 156
1896 3300053136 Ga0500559_0226043 Ga0500559_0226043_105_575 156
1897 3300053138 Ga0500564_001050 Ga0500564_001050_138_620 156
1898 3300053138 Ga0500564_066263 Ga0500564_066263_856_1326 156
1899 3300053138 Ga0500564_118137 Ga0500564_118137_466_936 156
1900 3300053139 Ga0500568_0001518 Ga0500568_0001518_7271_7753 156
1901 3300053139 Ga0500568_0068042 Ga0500568_0068042_518_988 156
1902 3300053140 Ga0500573_0005327 Ga0500573_0005327_429_899 156
1903 3300053141 Ga0500574_000051 Ga0500574_000051_10867_11337 156
1904 3300053141 Ga0500574_000431 Ga0500574_000431_2750_3232 156
1905 3300053145 Ga0500586_000727 Ga0500586_000727_711_1190 156
1906 3300053145 Ga0500586_025988 Ga0500586_025988_946_1425 156
1907 3300053153 Ga0500616_0025694 Ga0500616_0025694_1440_1922 156
1908 3300053153 Ga0500616_0041391 Ga0500616_0041391_258_731 156
1909 3300053153 Ga0500616_0050793 Ga0500616_0050793_1430_1900 156
1910 3300053153 Ga0500616_0332006 Ga0500616_0332006_124_606 156
1911 3300053154 Ga0500619_088620 Ga0500619_088620_204_686 156
1912 3300053156 Ga0500622_0001109 Ga0500622_0001109_21624_22106 156
1913 3300053156 Ga0500622_0008524 Ga0500622_0008524_917_1399 156
1914 3300053156 Ga0500622_0137997 Ga0500622_0137997_364_834 156
1915 3300053158 Ga0500627_0000171 Ga0500627_0000171_10258_10728 156
1916 3300053159 Ga0500630_073077 Ga0500630_073077_628_1113 156
1917 3300053160 Ga0500633_0087958 Ga0500633_0087958_68_547 156
1918 3300053161 Ga0500634_0004247 Ga0500634_0004247_5682_6161 156
1919 3300053161 Ga0500634_0004851 Ga0500634_0004851_1310_1780 156
1920 3300053161 Ga0500634_0063922 Ga0500634_0063922_1451_1930 156
1921 3300053161 Ga0500634_0113662 Ga0500634_0113662_165_647 156
1922 3300053162 Ga0500638_000284 Ga0500638_000284_1929_2399 156
1923 3300053162 Ga0500638_012459 Ga0500638_012459_2894_3376 156
1924 3300053163 Ga0500639_008998 Ga0500639_008998_335_820 156
1925 3300053177 Ga0500636_0005829 Ga0500636_0005829_5152_5622 156
1926 3300053177 Ga0500636_0221671 Ga0500636_0221671_372_854 156
1927 3300053723 Ga0500567_125390 Ga0500567_125390_354_824 156
1928 3300053734 Ga0500565_025083 Ga0500565_025083_202_672 156
1929 3300053739 Ga0500587_002697 Ga0500587_002697_1951_2436 156
1930 3300053739 Ga0500587_009667 Ga0500587_009667_614_1096 156
1931 3300055283 Ga0500661_003998 Ga0500661_003998_1844_2332 156
1932 iso_pu_bacteria 2511231002 2511242546 156
1933 iso_pu_bacteria 2547132374 2548498599 156
1934 iso_pu_bacteria 2585428062 2587758680 156
1935 iso_pu_bacteria 2643221644 2644244933 156
1936 iso_pu_bacteria 2643221646 2644257493 156
1937 iso_pu_bacteria 2643221654 2644302577 156
1938 iso_pu_bacteria 2643221717 2644649334 156
1939 iso_pu_bacteria 2842733646 2842735283 156
1940 iso_pu_bacteria 2842747753 2842749961 156
1941 iso_pu_bacteria 2919704043 2919708845 156
1942 iso_pu_bacteria 2939631187 2939634006 156
1943 iso_pu_bacteria 2945909444 2945912018 156
1944 iso_pu_bacteria 2945945610 2945947977 156
1945 iso_pu_bacteria 2945984333 2945985711 156
1946 iso_pu_bacteria 2954767861 2954772223 156
1947 iso_pu_bacteria 2990710928 2990712005 156
1948 iso_pu_bacteria 639633007 639787670 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00866

Ring_hydroxyl_B

Ring hydroxylating beta subunit

46

181

0.89

PF13577

SnoaL_4

SnoaL-like domain

33

171

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2chc-assembly1.cif.gz_C structure of rv3472(d26n), a function unknown protein from mycobacterium tuberculosis 0.9167 2 144
7c8z-assembly2.cif.gz_H crystal structure of salicylate 5-hydroxylase naggh (a rieske non-heme iron-dependent monooxgenase) 0.9136 1 156
7c8z-assembly2.cif.gz_H crystal structure of salicylate 5-hydroxylase naggh (a rieske non-heme iron-dependent monooxgenase) 0.9081 1 156
7vju-assembly1.cif.gz_F crystal structure of terephthalate dioxygenase from comamonas testosteroni kf1 0.9074 7 156
7q05-assembly1.cif.gz_C crystal structure of tpado in complex with tpa 0.9061 6 156
ID Description Score Start End Superfamily
3ebyA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8855 9 156 3.10.450.50
3ef8B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8544 15 143 3.10.450.50
af_P71754_77_184_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8494 60 141 3.10.450.50
2b1xB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8422 1 148 3.10.450.50
2rfrA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8414 4 147 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A356HL20-F1-model_v4 Salicylate hydroxylase 0.955 1 150
AF-B8ESU3-F1-model_v4 Aromatic-ring-hydroxylating dioxygenase beta subunit 0.9542 1 148 GO:0051213
AF-A0A1Y0BBZ9-F1-model_v4 B172 0.9513 1 148 GO:0016491
AF-A0A537TZC4-F1-model_v4 Ring-hydroxylating dioxygenase subunit beta 0.9421 6 135 GO:0051213
AF-A0A6N8XPX4-F1-model_v4 Aromatic-ring-hydroxylating dioxygenase subunit beta 0.9398 1 148 GO:0051213

Feature Viewer

pLDDT pTM Quality
92.83 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map