metagRoot

F496038

General Info

Members	Datasets	Scaffolds	Average Seq Length
1911	472	3822	120

Family's Representative Sequence

Representative Sequence	3300009174\|Ga0105241_12408179\|Ga0105241_124081791
Length	133
Sequence	VSHLDELDEFEAEAELRLKKEYSAVFGLFRYCVLTQDATYLCNKLDMQYVPQPNYPFFHLKMEDVWVWDKNRPTRIIPRAEVWTSSDVTVEELRGEGEDSHLTAEALAELAPELEIPGLGRVQTLLAGLQSTS

Samples

	Sample ID	Description	Type	Environment
1	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
2	3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Metagenome	Rhizosphere
3	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
4	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
5	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
6	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
7	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
8	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
9	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
10	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
11	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
12	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
13	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
14	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
15	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
16	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
17	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
18	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
19	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
20	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
21	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
22	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
23	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
24	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
25	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
26	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
27	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
28	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
29	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
30	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
31	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
32	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
33	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
34	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
35	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
36	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
37	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
38	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
39	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
40	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
41	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
42	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
43	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
44	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
45	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
46	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
47	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
48	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
49	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
50	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
51	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
52	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
53	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
54	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
55	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
56	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
57	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
58	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
59	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
60	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
61	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
62	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
63	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
64	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
65	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
66	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
67	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
68	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
69	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
70	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
71	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
72	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
73	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
74	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
75	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
76	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
77	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
78	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
79	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
80	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
81	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
82	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
83	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
84	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
85	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
86	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
87	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
88	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
89	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
90	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
91	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
92	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
93	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
94	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
95	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
96	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
97	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
98	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
99	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
100	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
101	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
102	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
103	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
104	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
105	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
106	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
107	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
108	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
109	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
110	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
111	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
112	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
113	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
114	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
115	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
116	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
117	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
118	3300012476	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610	Metagenome	Rhizosphere
119	3300012480	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610	Metagenome	Rhizosphere
120	3300012482	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510	Metagenome	Rhizosphere
121	3300012483	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610	Metagenome	Rhizosphere
122	3300012488	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610	Metagenome	Rhizosphere
123	3300012492	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610	Metagenome	Rhizosphere
124	3300012495	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610	Metagenome	Rhizosphere
125	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
126	3300012512	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510	Metagenome	Rhizosphere
127	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
128	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
129	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
130	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
131	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
132	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
133	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
134	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
135	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
136	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
137	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
138	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
139	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
140	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
141	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
142	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
143	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
144	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
145	3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3)	Metatranscriptome	Rhizosphere
146	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
147	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
148	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
149	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
150	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
151	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
152	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
153	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
154	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
155	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
217	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
221	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
222	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
223	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
224	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
225	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
226	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
227	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
228	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
229	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
230	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
231	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
232	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
233	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
234	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
235	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
236	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
237	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
238	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
239	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
240	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
241	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
242	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
243	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
244	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
245	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
246	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
247	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
248	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
249	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
250	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
251	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
252	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
253	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
254	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
255	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
256	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
257	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
258	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
259	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
260	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
261	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
262	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
263	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
264	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
265	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
266	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
267	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
268	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
269	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
270	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
271	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
272	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
273	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
274	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
275	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
276	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
277	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
278	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
279	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
280	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
281	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
282	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
283	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
284	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
285	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
286	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
287	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
288	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
289	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
290	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
291	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
292	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
293	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
294	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
295	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
296	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
297	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
298	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
299	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
300	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
301	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
302	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
303	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
304	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
305	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
306	3300042118	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156	Metagenome	Rhizosphere
307	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
308	3300042129	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95	Metagenome	Rhizosphere
309	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
310	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
311	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
312	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
313	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
314	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
315	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
316	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
317	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
318	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
319	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
320	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
321	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
322	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
323	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
324	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
325	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
326	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
327	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
328	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
329	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
330	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
331	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
332	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
333	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
334	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
335	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
336	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
337	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
338	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
339	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
340	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
341	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
342	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
343	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
344	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
345	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
346	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
347	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
348	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
349	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
350	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
351	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
352	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
353	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
354	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
355	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
356	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
357	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
358	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
359	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
360	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
361	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
362	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
363	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
364	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
365	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
366	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
367	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
368	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
369	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
370	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
371	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
372	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
373	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
374	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
375	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
376	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
377	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
378	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
379	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
380	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
381	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
382	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
383	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
384	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
385	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
386	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
387	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
388	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
389	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
390	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
391	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
392	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
393	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
394	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
395	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
396	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
397	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
398	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
399	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
400	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
401	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
402	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
403	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
404	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
405	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
406	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
407	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
408	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
409	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
410	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
411	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
412	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
413	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
414	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
415	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
416	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
417	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
418	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
419	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
420	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
421	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
422	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
423	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
424	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
425	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
426	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
427	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
428	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
429	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
430	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
431	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
432	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
433	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
434	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
435	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
436	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
437	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
438	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
439	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
440	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
441	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
442	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
443	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
444	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
445	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
446	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
447	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
448	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
449	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
450	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
451	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
452	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
453	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
454	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
455	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
456	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
457	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
458	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
459	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
460	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
461	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
462	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
463	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
464	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
465	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
466	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
467	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
468	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
469	3300059511	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
470	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
471	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
472	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.74
Metatranscriptomes	1.26
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.26
Nodule	0
Rhizoplane	12.04
Rhizosphere	87.18
Stem	0
Stem Tuber	0
Unclassified	11.51

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0105241_12408179	3300009174	Bacteria	526
2	JGI24747J21853_1023008	3300001978	Unclassified	687
3	rootH1_10095669	3300003323	Bacteria	3739
4	JGI25404J52841_10021458	3300003659	Bacteria	1398
5	Ga0070658_10009506	3300005327	Bacteria	7809
6	Ga0070658_10336322	3300005327	Bacteria	1291
7	Ga0070658_10404599	3300005327	Bacteria	1173
8	Ga0070658_11296507	3300005327	Bacteria	633
9	Ga0070676_11205942	3300005328	Bacteria	575
10	Ga0070676_11293623	3300005328	Bacteria	557
11	Ga0070676_11343178	3300005328	Bacteria	547
12	Ga0070683_100000523	3300005329	Bacteria	26938
13	Ga0070683_100009157	3300005329	Bacteria	8450
14	Ga0070683_100041671	3300005329	Bacteria	4226
15	Ga0070683_100075581	3300005329	Bacteria	3148
16	Ga0070683_100082914	3300005329	Bacteria	3003
17	Ga0070683_100088974	3300005329	Bacteria	2897
18	Ga0070683_100248471	3300005329	Bacteria	1692
19	Ga0070683_100301442	3300005329	Bacteria	1524
20	Ga0070683_100345724	3300005329	Bacteria	1416
21	Ga0070683_101359673	3300005329	Bacteria	683
22	Ga0070683_101988754	3300005329	Bacteria	558
23	Ga0070690_100057143	3300005330	Unclassified	2503
24	Ga0070690_101192268	3300005330	Bacteria	607
25	Ga0070677_10658311	3300005333	Bacteria	586
26	Ga0068869_100123677	3300005334	Bacteria	1981
27	Ga0068869_100912576	3300005334	Unclassified	761
28	Ga0070666_10075174	3300005335	Unclassified	2304
29	Ga0070666_10449620	3300005335	Bacteria	930
30	Ga0070666_10475180	3300005335	Bacteria	905
31	Ga0070680_100010010	3300005336	Bacteria	7304
32	Ga0070680_100063065	3300005336	Bacteria	3035
33	Ga0070680_100097834	3300005336	Unclassified	2433
34	Ga0070680_100117711	3300005336	Bacteria	2215
35	Ga0070680_100173956	3300005336	Bacteria	1812
36	Ga0070680_100444198	3300005336	Unclassified	1107
37	Ga0070680_100570134	3300005336	Unclassified	971
38	Ga0070682_100054940	3300005337	Bacteria	2500
39	Ga0070682_100071151	3300005337	Unclassified	2225
40	Ga0070682_100081989	3300005337	Bacteria	2090
41	Ga0070682_100129479	3300005337	Bacteria	1706
42	Ga0070682_100926706	3300005337	Bacteria	718
43	Ga0068868_100110077	3300005338	Bacteria	2237
44	Ga0068868_100480488	3300005338	Bacteria	1085
45	Ga0068868_100600394	3300005338	Bacteria	975
46	Ga0068868_101425311	3300005338	Bacteria	647
47	Ga0068868_101617723	3300005338	Unclassified	609
48	Ga0070660_100006456	3300005339	Bacteria	8131
49	Ga0070660_100041776	3300005339	Bacteria	3496
50	Ga0070660_100113166	3300005339	Bacteria	2161
51	Ga0070660_100147438	3300005339	Bacteria	1891
52	Ga0070660_100211859	3300005339	Bacteria	1573
53	Ga0070660_100281989	3300005339	Bacteria	1360
54	Ga0070660_100386563	3300005339	Bacteria	1155
55	Ga0070689_100203518	3300005340	Bacteria	1617
56	Ga0070689_100302479	3300005340	Bacteria	1332
57	Ga0070691_10236927	3300005341	Bacteria	973
58	Ga0070691_10306786	3300005341	Bacteria	869
59	Ga0070691_10700854	3300005341	Bacteria	608
60	Ga0070687_100083971	3300005343	Unclassified	1745
61	Ga0070687_100540861	3300005343	Bacteria	791
62	Ga0070661_100227156	3300005344	Bacteria	1433
63	Ga0070661_100567675	3300005344	Bacteria	915
64	Ga0070661_100599260	3300005344	Bacteria	890
65	Ga0070661_100959211	3300005344	Unclassified	708
66	Ga0070692_10080600	3300005345	Bacteria	1752
67	Ga0070692_10332728	3300005345	Unclassified	938
68	Ga0070692_10553813	3300005345	Bacteria	754
69	Ga0070668_100008802	3300005347	Bacteria	7497
70	Ga0070668_100068976	3300005347	Bacteria	2750
71	Ga0070668_100382669	3300005347	Bacteria	1198
72	Ga0070668_100417251	3300005347	Unclassified	1149
73	Ga0070668_101113854	3300005347	Bacteria	713
74	Ga0070669_100084021	3300005353	Bacteria	2375
75	Ga0070669_100399136	3300005353	Bacteria	1125
76	Ga0070671_100158555	3300005355	Bacteria	1913
77	Ga0070671_100269660	3300005355	Bacteria	1447
78	Ga0070671_100311154	3300005355	Bacteria	1342
79	Ga0070671_100586720	3300005355	Bacteria	963
80	Ga0070671_100818257	3300005355	Unclassified	812
81	Ga0070671_102046437	3300005355	Unclassified	510
82	Ga0070674_100040202	3300005356	Bacteria	3162
83	Ga0070674_100271402	3300005356	Bacteria	1341
84	Ga0070674_101017598	3300005356	Bacteria	728
85	Ga0070674_101293751	3300005356	Bacteria	650
86	Ga0070674_101374208	3300005356	Bacteria	632
87	Ga0070673_100170671	3300005364	Bacteria	1856
88	Ga0070673_100354111	3300005364	Bacteria	1303
89	Ga0070673_101323817	3300005364	Bacteria	677
90	Ga0070673_101547185	3300005364	Unclassified	626
91	Ga0070688_100078117	3300005365	Bacteria	2135
92	Ga0070688_100508417	3300005365	Bacteria	910
93	Ga0070688_100676921	3300005365	Bacteria	797
94	Ga0070688_101389314	3300005365	Bacteria	569
95	Ga0070659_100008088	3300005366	Bacteria	7669
96	Ga0070659_100148082	3300005366	Bacteria	1913
97	Ga0070659_100175747	3300005366	Bacteria	1756
98	Ga0070659_100199290	3300005366	Bacteria	1647
99	Ga0070659_100531654	3300005366	Bacteria	1005
100	Ga0070667_100007872	3300005367	Bacteria	8840
101	Ga0070703_10022773	3300005406	Bacteria	1841
102	Ga0070703_10076387	3300005406	Bacteria	1130
103	Ga0070709_10013768	3300005434	Bacteria	4556
104	Ga0070709_10053705	3300005434	Bacteria	2538
105	Ga0070709_10084542	3300005434	Bacteria	2079
106	Ga0070709_10157128	3300005434	Bacteria	1577
107	Ga0070709_10189194	3300005434	Unclassified	1451
108	Ga0070709_10554671	3300005434	Bacteria	880
109	Ga0070714_100018892	3300005435	Bacteria	5608
110	Ga0070714_100059592	3300005435	Bacteria	3273
111	Ga0070714_100101727	3300005435	Bacteria	2533
112	Ga0070714_100103832	3300005435	Bacteria	2508
113	Ga0070714_100179929	3300005435	Bacteria	1923
114	Ga0070714_100329406	3300005435	Bacteria	1430
115	Ga0070714_100344571	3300005435	Bacteria	1398
116	Ga0070714_100402142	3300005435	Bacteria	1294
117	Ga0070714_100456995	3300005435	Bacteria	1214
118	Ga0070714_100900630	3300005435	Bacteria	859
119	Ga0070714_100911139	3300005435	Bacteria	854
120	Ga0070714_101517046	3300005435	Unclassified	655
121	Ga0070713_100017522	3300005436	Bacteria	5419
122	Ga0070713_100024336	3300005436	Bacteria	4715
123	Ga0070713_100172262	3300005436	Bacteria	1940
124	Ga0070713_100227718	3300005436	Bacteria	1693
125	Ga0070713_100377168	3300005436	Bacteria	1321
126	Ga0070713_100543369	3300005436	Bacteria	1100
127	Ga0070713_100570413	3300005436	Bacteria	1073
128	Ga0070713_101628196	3300005436	Bacteria	627
129	Ga0070713_101871684	3300005436	Bacteria	582
130	Ga0070710_10075557	3300005437	Bacteria	1953
131	Ga0070710_10096594	3300005437	Bacteria	1752
132	Ga0070710_10379451	3300005437	Bacteria	942
133	Ga0070710_10961066	3300005437	Bacteria	620
134	Ga0070701_10186184	3300005438	Bacteria	1219
135	Ga0070701_10697237	3300005438	Bacteria	683
136	Ga0070701_10952605	3300005438	Bacteria	596
137	Ga0070711_100046539	3300005439	Bacteria	2956
138	Ga0070711_100287137	3300005439	Bacteria	1304
139	Ga0070711_100384501	3300005439	Bacteria	1136
140	Ga0070711_100386646	3300005439	Bacteria	1133
141	Ga0070711_100451817	3300005439	Bacteria	1052
142	Ga0070711_100459604	3300005439	Bacteria	1043
143	Ga0070711_100620694	3300005439	Bacteria	904
144	Ga0070711_100632388	3300005439	Unclassified	896
145	Ga0070711_101810476	3300005439	Unclassified	536
146	Ga0070705_100003732	3300005440	Bacteria	7456
147	Ga0070705_100024018	3300005440	Bacteria	3283
148	Ga0070705_100027582	3300005440	Bacteria	3102
149	Ga0070705_100107539	3300005440	Bacteria	1775
150	Ga0070705_100143857	3300005440	Bacteria	1573
151	Ga0070705_100241853	3300005440	Bacteria	1262
152	Ga0070705_100341689	3300005440	Bacteria	1088
153	Ga0070700_100003754	3300005441	Bacteria	7860
154	Ga0070700_100217213	3300005441	Bacteria	1352
155	Ga0070700_100883226	3300005441	Bacteria	726
156	Ga0070694_100006955	3300005444	Bacteria	6874
157	Ga0070694_100016424	3300005444	Bacteria	4659
158	Ga0070694_100365309	3300005444	Bacteria	1122
159	Ga0070694_100422806	3300005444	Bacteria	1047
160	Ga0070694_100460963	3300005444	Bacteria	1005
161	Ga0070694_100556864	3300005444	Bacteria	919
162	Ga0070708_100019342	3300005445	Bacteria	5721
163	Ga0070708_100036259	3300005445	Bacteria	4301
164	Ga0070708_100144787	3300005445	Bacteria	2206
165	Ga0070708_100306568	3300005445	Bacteria	1495
166	Ga0070708_100415060	3300005445	Bacteria	1269
167	Ga0070708_100571914	3300005445	Bacteria	1066
168	Ga0070708_101194154	3300005445	Bacteria	712
169	Ga0070663_100071890	3300005455	Bacteria	2518
170	Ga0070678_100009863	3300005456	Bacteria	5805
171	Ga0070678_100050199	3300005456	Bacteria	3016
172	Ga0070678_100154318	3300005456	Bacteria	1853
173	Ga0070678_100264504	3300005456	Bacteria	1448
174	Ga0070678_100360384	3300005456	Bacteria	1253
175	Ga0070678_101765938	3300005456	Bacteria	583
176	Ga0070678_102120611	3300005456	Unclassified	533
177	Ga0070662_100022582	3300005457	Bacteria	4309
178	Ga0070662_100024496	3300005457	Bacteria	4158
179	Ga0070662_100396268	3300005457	Bacteria	1139
180	Ga0070662_101533375	3300005457	Bacteria	575
181	Ga0070681_10019930	3300005458	Bacteria	6719
182	Ga0070681_10047248	3300005458	Bacteria	4302
183	Ga0070681_10055700	3300005458	Bacteria	3936
184	Ga0070681_10095156	3300005458	Bacteria	2927
185	Ga0070681_10461469	3300005458	Bacteria	1182
186	Ga0070681_10666480	3300005458	Bacteria	955
187	Ga0070681_10705760	3300005458	Bacteria	924
188	Ga0068867_100063199	3300005459	Bacteria	2751
189	Ga0068867_100219285	3300005459	Bacteria	1532
190	Ga0068867_100622263	3300005459	Bacteria	944
191	Ga0068867_102187901	3300005459	Bacteria	525
192	Ga0070685_10038782	3300005466	Bacteria	2703
193	Ga0070685_10980774	3300005466	Bacteria	633
194	Ga0070706_100027782	3300005467	Bacteria	5203
195	Ga0070706_100033677	3300005467	Bacteria	4730
196	Ga0070706_100233538	3300005467	Bacteria	1717
197	Ga0070706_100298356	3300005467	Bacteria	1504
198	Ga0070706_100498596	3300005467	Bacteria	1133
199	Ga0070706_100710947	3300005467	Bacteria	932
200	Ga0070706_100822449	3300005467	Unclassified	859
201	Ga0070707_100020563	3300005468	Bacteria	6229
202	Ga0070707_100029981	3300005468	Bacteria	5177
203	Ga0070707_100125358	3300005468	Bacteria	2495
204	Ga0070707_100260660	3300005468	Bacteria	1686
205	Ga0070707_100644830	3300005468	Bacteria	1022
206	Ga0070707_100664723	3300005468	Bacteria	1005
207	Ga0070707_101256437	3300005468	Bacteria	707
208	Ga0070698_100014108	3300005471	Bacteria	8449
209	Ga0070698_100112573	3300005471	Bacteria	2686
210	Ga0070698_100218957	3300005471	Bacteria	1838
211	Ga0070698_100246467	3300005471	Bacteria	1719
212	Ga0070698_100819948	3300005471	Bacteria	875
213	Ga0070699_100070169	3300005518	Bacteria	3046
214	Ga0070699_100085645	3300005518	Bacteria	2750
215	Ga0070699_100154863	3300005518	Bacteria	2028
216	Ga0070699_100260874	3300005518	Bacteria	1550
217	Ga0070699_101017350	3300005518	Bacteria	760
218	Ga0070679_100002176	3300005530	Bacteria	17688
219	Ga0070679_100038811	3300005530	Bacteria	4735
220	Ga0070679_100051462	3300005530	Bacteria	4102
221	Ga0070679_100066844	3300005530	Bacteria	3584
222	Ga0070679_100085488	3300005530	Bacteria	3141
223	Ga0070679_100155914	3300005530	Bacteria	2258
224	Ga0070679_100166100	3300005530	Bacteria	2180
225	Ga0070679_100475771	3300005530	Bacteria	1193
226	Ga0070679_100925335	3300005530	Bacteria	815
227	Ga0070679_101244656	3300005530	Bacteria	690
228	Ga0070684_100004398	3300005535	Bacteria	10719
229	Ga0070684_100007842	3300005535	Bacteria	8326
230	Ga0070684_100012575	3300005535	Bacteria	6789
231	Ga0070684_100030405	3300005535	Bacteria	4588
232	Ga0070684_100048453	3300005535	Unclassified	3686
233	Ga0070684_100065555	3300005535	Bacteria	3187
234	Ga0070684_100101106	3300005535	Bacteria	2575
235	Ga0070684_100204352	3300005535	Bacteria	1800
236	Ga0070684_100933287	3300005535	Unclassified	813
237	Ga0070684_101083232	3300005535	Bacteria	753
238	Ga0070684_101402510	3300005535	Unclassified	658
239	Ga0070697_100026565	3300005536	Bacteria	4627
240	Ga0070697_100092559	3300005536	Bacteria	2502
241	Ga0070697_100142130	3300005536	Bacteria	2019
242	Ga0070697_100948871	3300005536	Unclassified	764
243	Ga0070697_100951477	3300005536	Bacteria	763
244	Ga0068853_100132508	3300005539	Bacteria	2232
245	Ga0068853_100242748	3300005539	Unclassified	1651
246	Ga0068853_100498514	3300005539	Bacteria	1149
247	Ga0070672_100342653	3300005543	Bacteria	1273
248	Ga0070672_100401560	3300005543	Bacteria	1175
249	Ga0070686_100076411	3300005544	Bacteria	2205
250	Ga0070686_100093834	3300005544	Bacteria	2013
251	Ga0070686_100098681	3300005544	Bacteria	1969
252	Ga0070686_100142640	3300005544	Bacteria	1669
253	Ga0070686_100143324	3300005544	Unclassified	1665
254	Ga0070686_101243504	3300005544	Bacteria	620
255	Ga0070695_100391681	3300005545	Bacteria	1051
256	Ga0070696_100013955	3300005546	Bacteria	5394
257	Ga0070696_100014346	3300005546	Bacteria	5315
258	Ga0070696_100300111	3300005546	Bacteria	1230
259	Ga0070696_100302290	3300005546	Bacteria	1226
260	Ga0070696_100466581	3300005546	Unclassified	999
261	Ga0070693_100038053	3300005547	Bacteria	2686
262	Ga0070693_100073761	3300005547	Bacteria	2017
263	Ga0070693_100291545	3300005547	Bacteria	1096
264	Ga0070693_100300054	3300005547	Unclassified	1082
265	Ga0070693_100584735	3300005547	Unclassified	804
266	Ga0070665_100049475	3300005548	Bacteria	4217
267	Ga0070665_101697643	3300005548	Bacteria	639
268	Ga0070704_100007670	3300005549	Bacteria	6431
269	Ga0070704_100063059	3300005549	Bacteria	2659
270	Ga0070704_100106552	3300005549	Bacteria	2124
271	Ga0070704_100410275	3300005549	Bacteria	1158
272	Ga0070704_100517826	3300005549	Bacteria	1038
273	Ga0070704_100811672	3300005549	Bacteria	836
274	Ga0070704_101063568	3300005549	Unclassified	734
275	Ga0068855_100001318	3300005563	Bacteria	30730
276	Ga0068855_100016339	3300005563	Bacteria	8924
277	Ga0068855_100020461	3300005563	Bacteria	7935
278	Ga0068855_100046067	3300005563	Bacteria	5156
279	Ga0068855_100150744	3300005563	Bacteria	2644
280	Ga0068855_100244346	3300005563	Bacteria	2004
281	Ga0068855_100256970	3300005563	Bacteria	1947
282	Ga0068855_100323312	3300005563	Bacteria	1704
283	Ga0068855_100588221	3300005563	Bacteria	1201
284	Ga0068855_100924253	3300005563	Bacteria	920
285	Ga0068855_100994324	3300005563	Bacteria	882
286	Ga0070664_100009360	3300005564	Bacteria	7942
287	Ga0070664_100054229	3300005564	Bacteria	3401
288	Ga0070664_100167473	3300005564	Bacteria	1948
289	Ga0068857_100003052	3300005577	Bacteria	13854
290	Ga0068857_100017539	3300005577	Bacteria	6276
291	Ga0068857_100066279	3300005577	Bacteria	3212
292	Ga0068857_100071689	3300005577	Bacteria	3087
293	Ga0068857_100468237	3300005577	Bacteria	1180
294	Ga0068857_101459816	3300005577	Bacteria	666
295	Ga0068854_100234216	3300005578	Bacteria	1459
296	Ga0068854_100706644	3300005578	Unclassified	871
297	Ga0068856_100027335	3300005614	Bacteria	5566
298	Ga0068856_100091211	3300005614	Bacteria	3031
299	Ga0068856_100130676	3300005614	Bacteria	2516
300	Ga0068856_100161025	3300005614	Bacteria	2254
301	Ga0068856_100189480	3300005614	Bacteria	2070
302	Ga0068856_100333576	3300005614	Bacteria	1534
303	Ga0068856_100352694	3300005614	Bacteria	1490
304	Ga0068856_100801404	3300005614	Bacteria	962
305	Ga0068856_101242640	3300005614	Bacteria	761
306	Ga0068856_101408454	3300005614	Bacteria	711
307	Ga0068856_101801966	3300005614	Unclassified	624
308	Ga0070702_100082668	3300005615	Bacteria	1927
309	Ga0070702_100090818	3300005615	Bacteria	1852
310	Ga0070702_100143351	3300005615	Unclassified	1524
311	Ga0070702_100711363	3300005615	Bacteria	767
312	Ga0070702_101221462	3300005615	Bacteria	607
313	Ga0068852_100014829	3300005616	Bacteria	6021
314	Ga0068852_100980339	3300005616	Bacteria	864
315	Ga0068859_100875185	3300005617	Bacteria	984
316	Ga0068859_100890577	3300005617	Bacteria	975
317	Ga0068864_100181855	3300005618	Bacteria	1923
318	Ga0068864_100333355	3300005618	Bacteria	1428
319	Ga0068864_100597891	3300005618	Bacteria	1070
320	Ga0068864_101393148	3300005618	Bacteria	703
321	Ga0068864_101540093	3300005618	Unclassified	668
322	Ga0068866_10110321	3300005718	Bacteria	1534
323	Ga0068866_10123626	3300005718	Bacteria	1462
324	Ga0068861_100011239	3300005719	Bacteria	6215
325	Ga0068861_100084461	3300005719	Bacteria	2492
326	Ga0068861_100234869	3300005719	Bacteria	1557
327	Ga0068851_10640910	3300005834	Bacteria	650
328	Ga0068870_10050805	3300005840	Bacteria	2192
329	Ga0068870_10115439	3300005840	Bacteria	1539
330	Ga0068870_10146176	3300005840	Unclassified	1388
331	Ga0068870_10298715	3300005840	Bacteria	1016
332	Ga0068863_100470902	3300005841	Bacteria	1234
333	Ga0068863_101719264	3300005841	Bacteria	637
334	Ga0068863_101884056	3300005841	Bacteria	608
335	Ga0068858_100243159	3300005842	Bacteria	1708
336	Ga0068858_100458434	3300005842	Bacteria	1229
337	Ga0068858_101087675	3300005842	Bacteria	785
338	Ga0068858_101115189	3300005842	Bacteria	775
339	Ga0068860_100173793	3300005843	Unclassified	2081
340	Ga0068860_100255293	3300005843	Bacteria	1708
341	Ga0068860_101508180	3300005843	Bacteria	694
342	Ga0068862_100034106	3300005844	Bacteria	4305
343	Ga0068862_100754744	3300005844	Bacteria	947
344	Ga0081455_10008468	3300005937	Bacteria	10693
345	Ga0081455_10288718	3300005937	Bacteria	1182
346	Ga0081538_10200632	3300005981	Bacteria	820
347	Ga0081540_1000590	3300005983	Bacteria	34934
348	Ga0081540_1001254	3300005983	Bacteria	22178
349	Ga0081540_1055287	3300005983	Bacteria	1934
350	Ga0081539_10171408	3300005985	Bacteria	1026
351	Ga0081539_10202245	3300005985	Bacteria	916
352	Ga0070717_10041958	3300006028	Bacteria	3731
353	Ga0070717_10052460	3300006028	Bacteria	3360
354	Ga0070717_10066197	3300006028	Bacteria	3004
355	Ga0070717_10069495	3300006028	Bacteria	2933
356	Ga0070717_10082334	3300006028	Bacteria	2704
357	Ga0070717_10096383	3300006028	Bacteria	2506
358	Ga0070717_10207375	3300006028	Bacteria	1719
359	Ga0070717_10228440	3300006028	Bacteria	1638
360	Ga0070717_10699674	3300006028	Bacteria	921
361	Ga0070717_10702120	3300006028	Bacteria	919
362	Ga0070717_10720214	3300006028	Bacteria	907
363	Ga0070717_10724787	3300006028	Bacteria	904
364	Ga0070717_11439473	3300006028	Bacteria	625
365	Ga0070717_11735287	3300006028	Bacteria	565
366	Ga0075365_10420319	3300006038	Unclassified	944
367	Ga0075364_10854446	3300006051	Bacteria	620
368	Ga0075432_10024612	3300006058	Unclassified	2064
369	Ga0075432_10048617	3300006058	Bacteria	1493
370	Ga0075432_10262293	3300006058	Unclassified	705
371	Ga0070715_10062297	3300006163	Bacteria	1640
372	Ga0070715_10116667	3300006163	Bacteria	1267
373	Ga0070716_100051012	3300006173	Bacteria	2350
374	Ga0070716_100217268	3300006173	Bacteria	1282
375	Ga0070716_100447328	3300006173	Bacteria	941
376	Ga0070716_100649199	3300006173	Unclassified	800
377	Ga0070716_101100289	3300006173	Bacteria	634
378	Ga0070712_100038563	3300006175	Bacteria	3266
379	Ga0070712_100059432	3300006175	Bacteria	2693
380	Ga0070712_100066500	3300006175	Bacteria	2562
381	Ga0070712_100076067	3300006175	Bacteria	2416
382	Ga0070712_100086588	3300006175	Bacteria	2284
383	Ga0070712_100087606	3300006175	Bacteria	2272
384	Ga0070712_100176265	3300006175	Bacteria	1663
385	Ga0070712_100188124	3300006175	Bacteria	1613
386	Ga0070712_100368816	3300006175	Bacteria	1179
387	Ga0070712_100395229	3300006175	Unclassified	1141
388	Ga0070712_101506874	3300006175	Bacteria	588
389	Ga0070712_101855356	3300006175	Bacteria	528
390	Ga0097621_100124759	3300006237	Bacteria	2186
391	Ga0097621_100716571	3300006237	Bacteria	922
392	Ga0097621_101418969	3300006237	Bacteria	658
393	Ga0068871_100212915	3300006358	Bacteria	1672
394	Ga0068871_100239029	3300006358	Bacteria	1578
395	Ga0068871_100546478	3300006358	Bacteria	1049
396	Ga0068871_100923291	3300006358	Unclassified	810
397	Ga0068871_101296160	3300006358	Unclassified	685
398	Ga0068871_102068538	3300006358	Unclassified	542
399	Ga0075428_100017889	3300006844	Bacteria	7833
400	Ga0075428_100370076	3300006844	Bacteria	1537
401	Ga0075428_100861582	3300006844	Unclassified	962
402	Ga0075430_100219807	3300006846	Bacteria	1576
403	Ga0075430_100307537	3300006846	Unclassified	1311
404	Ga0075431_100165950	3300006847	Unclassified	2270
405	Ga0075431_100222421	3300006847	Bacteria	1925
406	Ga0075431_100294447	3300006847	Bacteria	1641
407	Ga0075431_100323753	3300006847	Bacteria	1554
408	Ga0075433_10010135	3300006852	Bacteria	7555
409	Ga0075433_10165470	3300006852	Unclassified	1968
410	Ga0075433_10212906	3300006852	Bacteria	1717
411	Ga0075433_10273154	3300006852	Bacteria	1498
412	Ga0075433_11219157	3300006852	Bacteria	653
413	Ga0075434_100015798	3300006871	Bacteria	7248
414	Ga0075434_100015868	3300006871	Bacteria	7232
415	Ga0075434_100036036	3300006871	Bacteria	4892
416	Ga0075434_100104107	3300006871	Bacteria	2847
417	Ga0075434_100110662	3300006871	Bacteria	2757
418	Ga0075434_100207461	3300006871	Bacteria	1980
419	Ga0075434_100530355	3300006871	Unclassified	1198
420	Ga0075434_100647452	3300006871	Bacteria	1075
421	Ga0075434_100685289	3300006871	Bacteria	1043
422	Ga0075434_101366149	3300006871	Bacteria	719
423	Ga0075429_100186049	3300006880	Bacteria	1820
424	Ga0068865_100012932	3300006881	Bacteria	5263
425	Ga0068865_100142837	3300006881	Bacteria	1807
426	Ga0068865_100847274	3300006881	Bacteria	792
427	Ga0075436_100007098	3300006914	Bacteria	7668
428	Ga0075436_100016739	3300006914	Bacteria	5018
429	Ga0075436_100028265	3300006914	Bacteria	3858
430	Ga0075436_100061396	3300006914	Bacteria	2596
431	Ga0075436_100074274	3300006914	Bacteria	2354
432	Ga0075436_100266501	3300006914	Bacteria	1222
433	Ga0075436_100694288	3300006914	Bacteria	754
434	Ga0097620_100875229	3300006931	Bacteria	984
435	Ga0097620_100890429	3300006931	Bacteria	975
436	Ga0075435_100001046	3300007076	Bacteria	17525
437	Ga0075435_100006265	3300007076	Bacteria	8398
438	Ga0075435_100016752	3300007076	Bacteria	5529
439	Ga0075435_100085456	3300007076	Bacteria	2597
440	Ga0075435_101032913	3300007076	Bacteria	718
441	Ga0075435_101044799	3300007076	Bacteria	714
442	Ga0075435_101251537	3300007076	Unclassified	650
443	Ga0099794_10636115	3300007265	Bacteria	566
444	Ga0105251_10566023	3300009011	Bacteria	536
445	Ga0105250_10139469	3300009092	Bacteria	1004
446	Ga0105240_10037030	3300009093	Bacteria	6271
447	Ga0105240_10125511	3300009093	Bacteria	3084
448	Ga0105240_10234925	3300009093	Bacteria	2128
449	Ga0105240_10296183	3300009093	Bacteria	1852
450	Ga0105240_10462212	3300009093	Bacteria	1418
451	Ga0105240_10871396	3300009093	Bacteria	971
452	Ga0105240_10920476	3300009093	Bacteria	939
453	Ga0105240_11219350	3300009093	Bacteria	796
454	Ga0111539_10039025	3300009094	Bacteria	5726
455	Ga0111539_10505758	3300009094	Bacteria	1407
456	Ga0111539_10914744	3300009094	Bacteria	1020
457	Ga0111539_10923311	3300009094	Bacteria	1015
458	Ga0111539_12967722	3300009094	Bacteria	548
459	Ga0111539_13230618	3300009094	Bacteria	525
460	Ga0111539_13504609	3300009094	Archaea	504
461	Ga0105245_10005664	3300009098	Bacteria	10974
462	Ga0105245_10050690	3300009098	Bacteria	3721
463	Ga0105245_10060517	3300009098	Bacteria	3410
464	Ga0105245_10251265	3300009098	Bacteria	1718
465	Ga0105245_10255600	3300009098	Bacteria	1703
466	Ga0105245_10272032	3300009098	Bacteria	1653
467	Ga0105245_10429953	3300009098	Bacteria	1325
468	Ga0105245_10444987	3300009098	Bacteria	1303
469	Ga0105245_10874888	3300009098	Bacteria	939
470	Ga0105245_11102155	3300009098	Bacteria	840
471	Ga0105245_12169829	3300009098	Unclassified	609
472	Ga0105247_10466130	3300009101	Bacteria	914
473	Ga0105247_10695488	3300009101	Unclassified	765
474	Ga0105247_10927721	3300009101	Bacteria	674
475	Ga0114129_10005393	3300009147	Bacteria	18051
476	Ga0114129_10014330	3300009147	Bacteria	11301
477	Ga0114129_10021521	3300009147	Bacteria	9154
478	Ga0114129_10320552	3300009147	Bacteria	2060
479	Ga0114129_10375213	3300009147	Bacteria	1879
480	Ga0114129_11558758	3300009147	Bacteria	810
481	Ga0114129_11668245	3300009147	Bacteria	778
482	Ga0105243_10013481	3300009148	Bacteria	6182
483	Ga0105243_10045390	3300009148	Bacteria	3453
484	Ga0105243_10047725	3300009148	Bacteria	3373
485	Ga0105243_10070224	3300009148	Bacteria	2827
486	Ga0105243_10072695	3300009148	Bacteria	2784
487	Ga0105243_10159705	3300009148	Bacteria	1942
488	Ga0105243_10200484	3300009148	Bacteria	1750
489	Ga0105243_10298879	3300009148	Bacteria	1458
490	Ga0105243_10477304	3300009148	Bacteria	1176
491	Ga0105243_11137716	3300009148	Bacteria	791
492	Ga0105243_11261390	3300009148	Bacteria	755
493	Ga0105243_12072950	3300009148	Unclassified	604
494	Ga0105243_12196207	3300009148	Unclassified	589
495	Ga0105243_12312822	3300009148	Unclassified	575
496	Ga0105241_10105504	3300009174	Bacteria	2248
497	Ga0105241_10124047	3300009174	Bacteria	2083
498	Ga0105241_10208932	3300009174	Bacteria	1635
499	Ga0105241_10401135	3300009174	Bacteria	1203
500	Ga0105241_10441493	3300009174	Bacteria	1149
501	Ga0105241_10450983	3300009174	Bacteria	1138
502	Ga0105242_10127621	3300009176	Bacteria	2191
503	Ga0105242_10193660	3300009176	Bacteria	1802
504	Ga0105242_10226867	3300009176	Bacteria	1672
505	Ga0105242_10312144	3300009176	Bacteria	1439
506	Ga0105242_10347608	3300009176	Bacteria	1369
507	Ga0105242_10430680	3300009176	Bacteria	1238
508	Ga0105242_10523775	3300009176	Bacteria	1131
509	Ga0105242_10615221	3300009176	Bacteria	1051
510	Ga0105242_11548776	3300009176	Bacteria	695
511	Ga0105242_11954493	3300009176	Bacteria	628
512	Ga0105248_10668821	3300009177	Bacteria	1171
513	Ga0105248_11117863	3300009177	Bacteria	891
514	Ga0105248_11181875	3300009177	Bacteria	865
515	Ga0105248_11488600	3300009177	Bacteria	766
516	Ga0105237_10048627	3300009545	Bacteria	4263
517	Ga0105237_10083936	3300009545	Bacteria	3176
518	Ga0105237_10094168	3300009545	Bacteria	2984
519	Ga0105237_10738182	3300009545	Unclassified	991
520	Ga0105237_11442557	3300009545	Bacteria	695
521	Ga0105237_11596087	3300009545	Bacteria	659
522	Ga0105237_11902750	3300009545	Unclassified	603
523	Ga0105238_10470718	3300009551	Bacteria	1255
524	Ga0105238_10929937	3300009551	Bacteria	889
525	Ga0105238_11610160	3300009551	Unclassified	679
526	Ga0105249_10006017	3300009553	Bacteria	10512
527	Ga0105249_10708130	3300009553	Unclassified	1067
528	Ga0105249_11147554	3300009553	Bacteria	848
529	Ga0099796_10423059	3300010159	Bacteria	588
530	Ga0105239_10064809	3300010375	Bacteria	4011
531	Ga0105239_10108699	3300010375	Bacteria	3072
532	Ga0105239_10176479	3300010375	Bacteria	2390
533	Ga0105239_10222292	3300010375	Bacteria	2118
534	Ga0105239_10319356	3300010375	Bacteria	1751
535	Ga0105239_10378905	3300010375	Bacteria	1599
536	Ga0105239_10771102	3300010375	Bacteria	1101
537	Ga0105239_11030747	3300010375	Bacteria	946
538	Ga0105239_11465270	3300010375	Bacteria	788
539	Ga0105239_12023356	3300010375	Unclassified	669
540	Ga0105239_12192547	3300010375	Bacteria	642
541	Ga0105246_10039671	3300011119	Bacteria	3174
542	Ga0105246_10322572	3300011119	Unclassified	1256
543	Ga0105246_10355778	3300011119	Unclassified	1201
544	Ga0105246_10386168	3300011119	Unclassified	1158
545	Ga0105246_10471107	3300011119	Bacteria	1060
546	Ga0157344_1026555	3300012476	Unclassified	532
547	Ga0157346_1012411	3300012480	Unclassified	645
548	Ga0157318_1006667	3300012482	Bacteria	768
549	Ga0157337_1033438	3300012483	Unclassified	538
550	Ga0157343_1023246	3300012488	Bacteria	577
551	Ga0157335_1014438	3300012492	Bacteria	684
552	Ga0157323_1029068	3300012495	Bacteria	576
553	Ga0157347_1068440	3300012502	Unclassified	520
554	Ga0157327_1003085	3300012512	Bacteria	1203
555	Ga0157371_10484932	3300013102	Bacteria	912
556	Ga0157371_10624744	3300013102	Bacteria	802
557	Ga0157371_11322045	3300013102	Bacteria	558
558	Ga0157371_11542781	3300013102	Bacteria	519
559	Ga0157370_10031927	3300013104	Bacteria	5146
560	Ga0157370_10045914	3300013104	Bacteria	4190
561	Ga0157370_10049951	3300013104	Bacteria	4000
562	Ga0157370_10055761	3300013104	Bacteria	3763
563	Ga0157370_10145472	3300013104	Bacteria	2207
564	Ga0157370_10739647	3300013104	Bacteria	896
565	Ga0157369_10051991	3300013105	Bacteria	4433
566	Ga0157369_10143037	3300013105	Bacteria	2530
567	Ga0157369_10205262	3300013105	Bacteria	2067
568	Ga0157369_10238659	3300013105	Bacteria	1899
569	Ga0157369_10495856	3300013105	Bacteria	1263
570	Ga0157374_10018647	3300013296	Bacteria	6128
571	Ga0157374_10575338	3300013296	Bacteria	1135
572	Ga0157374_10888418	3300013296	Unclassified	908
573	Ga0157374_11437191	3300013296	Bacteria	713
574	Ga0157378_10169406	3300013297	Bacteria	2047
575	Ga0157378_10943374	3300013297	Bacteria	895
576	Ga0157378_11395209	3300013297	Unclassified	743
577	Ga0157378_11695294	3300013297	Bacteria	679
578	Ga0157378_11696301	3300013297	Bacteria	679
579	Ga0163162_10076626	3300013306	Bacteria	3407
580	Ga0163162_10187999	3300013306	Bacteria	2193
581	Ga0163162_10601473	3300013306	Bacteria	1226
582	Ga0157372_10067977	3300013307	Bacteria	4006
583	Ga0157372_10224927	3300013307	Bacteria	2175
584	Ga0157372_10598949	3300013307	Bacteria	1285
585	Ga0157372_10798933	3300013307	Unclassified	1096
586	Ga0157375_10021076	3300013308	Bacteria	5969
587	Ga0157375_10075348	3300013308	Bacteria	3398
588	Ga0157375_10233076	3300013308	Bacteria	2000
589	Ga0157375_10522510	3300013308	Bacteria	1350
590	Ga0157375_10542834	3300013308	Unclassified	1325
591	Ga0157375_10640161	3300013308	Bacteria	1220
592	Ga0157375_10650498	3300013308	Bacteria	1210
593	Ga0157375_12309760	3300013308	Bacteria	641
594	Ga0163163_10121140	3300014325	Bacteria	2650
595	Ga0163163_10192131	3300014325	Unclassified	2090
596	Ga0163163_10450828	3300014325	Bacteria	1347
597	Ga0163163_11094753	3300014325	Bacteria	860
598	Ga0163163_11413268	3300014325	Bacteria	757
599	Ga0157380_10259866	3300014326	Bacteria	1577
600	Ga0157380_10360179	3300014326	Bacteria	1364
601	Ga0157380_10515010	3300014326	Bacteria	1165
602	Ga0157380_10991715	3300014326	Bacteria	873
603	Ga0157380_11910999	3300014326	Bacteria	654
604	Ga0182008_10051970	3300014497	Bacteria	2032
605	Ga0182008_10132578	3300014497	Bacteria	1243
606	Ga0182008_10168170	3300014497	Bacteria	1106
607	Ga0182008_10223509	3300014497	Bacteria	964
608	Ga0157377_10074746	3300014745	Bacteria	1966
609	Ga0157377_10503630	3300014745	Bacteria	847
610	Ga0157377_10649220	3300014745	Bacteria	759
611	Ga0157377_11487074	3300014745	Bacteria	538
612	Ga0157379_10382484	3300014968	Bacteria	1291
613	Ga0157379_10685049	3300014968	Bacteria	961
614	Ga0157379_12334976	3300014968	Bacteria	533
615	Ga0157376_10192603	3300014969	Bacteria	1870
616	Ga0157376_10400782	3300014969	Bacteria	1327
617	Ga0157376_10724162	3300014969	Archaea	1002
618	Ga0182006_1193313	3300015261	Bacteria	676
619	Ga0163161_10015754	3300017792	Bacteria	5272
620	Ga0163161_10200093	3300017792	Bacteria	1539
621	Ga0163161_10770822	3300017792	Bacteria	806
622	Ga0197907_10974813	3300020069	Bacteria	1197
623	Ga0206356_10019179	3300020070	Bacteria	1537
624	Ga0206356_10466495	3300020070	Bacteria	580
625	Ga0206356_10528364	3300020070	Bacteria	2651
626	Ga0206356_10753970	3300020070	Bacteria	1551
627	Ga0206356_11848280	3300020070	Bacteria	520
628	Ga0206356_11900485	3300020070	Bacteria	710
629	Ga0206355_1228152	3300020076	Unclassified	770
630	Ga0206352_10999200	3300020078	Bacteria	561
631	Ga0206350_10516667	3300020080	Bacteria	1185
632	Ga0206354_10421540	3300020081	Bacteria	2120
633	Ga0206354_10496823	3300020081	Bacteria	1954
634	Ga0206354_11109982	3300020081	Bacteria	534
635	Ga0206353_10700471	3300020082	Bacteria	1276
636	Ga0206353_10959294	3300020082	Bacteria	1555
637	Ga0206353_11494663	3300020082	Bacteria	1297
638	Ga0206353_11682805	3300020082	Bacteria	1203
639	Ga0154015_1196527	3300020610	Bacteria	653
640	Ga0154015_1578235	3300020610	Bacteria	660
641	Ga0213873_10069372	3300021358	Bacteria	969
642	Ga0213874_10049470	3300021377	Bacteria	1285
643	Ga0213876_10208238	3300021384	Bacteria	1040
644	Ga0224712_10097784	3300022467	Bacteria	1240
645	Ga0224712_10127434	3300022467	Bacteria	1108
646	Ga0224712_10283379	3300022467	Bacteria	772
647	Ga0224712_10561851	3300022467	Bacteria	555
648	Ga0207656_10053163	3300025321	Bacteria	1757
649	Ga0207653_10001866	3300025885	Bacteria	6741
650	Ga0207653_10002877	3300025885	Bacteria	5464
651	Ga0207692_10008105	3300025898	Bacteria	4337
652	Ga0207692_10028187	3300025898	Bacteria	2653
653	Ga0207692_10134680	3300025898	Bacteria	1399
654	Ga0207692_10226310	3300025898	Bacteria	1111
655	Ga0207692_10433588	3300025898	Bacteria	824
656	Ga0207692_10534295	3300025898	Bacteria	748
657	Ga0207642_10083706	3300025899	Bacteria	1556
658	Ga0207642_10097939	3300025899	Bacteria	1465
659	Ga0207642_10629477	3300025899	Bacteria	670
660	Ga0207710_10342328	3300025900	Bacteria	760
661	Ga0207710_10619745	3300025900	Unclassified	566
662	Ga0207688_10018465	3300025901	Bacteria	3795
663	Ga0207688_10043987	3300025901	Unclassified	2488
664	Ga0207688_10141863	3300025901	Bacteria	1414
665	Ga0207688_10282631	3300025901	Bacteria	1011
666	Ga0207688_11006280	3300025901	Bacteria	527
667	Ga0207680_10281737	3300025903	Unclassified	1155
668	Ga0207647_10440882	3300025904	Bacteria	730
669	Ga0207685_10009323	3300025905	Bacteria	2846
670	Ga0207685_10070512	3300025905	Unclassified	1415
671	Ga0207685_10135899	3300025905	Bacteria	1097
672	Ga0207685_10642425	3300025905	Bacteria	573
673	Ga0207699_10010874	3300025906	Bacteria	4582
674	Ga0207699_10119996	3300025906	Bacteria	1699
675	Ga0207699_10145495	3300025906	Bacteria	1562
676	Ga0207699_10161826	3300025906	Bacteria	1490
677	Ga0207699_10280331	3300025906	Bacteria	1158
678	Ga0207699_10348746	3300025906	Bacteria	1044
679	Ga0207699_11022676	3300025906	Unclassified	611
680	Ga0207643_10087232	3300025908	Bacteria	1814
681	Ga0207643_10112153	3300025908	Bacteria	1607
682	Ga0207643_10177046	3300025908	Unclassified	1289
683	Ga0207643_10289462	3300025908	Bacteria	1017
684	Ga0207705_10019252	3300025909	Bacteria	4882
685	Ga0207705_10034743	3300025909	Bacteria	3605
686	Ga0207705_10332392	3300025909	Bacteria	1169
687	Ga0207705_10446229	3300025909	Unclassified	1003
688	Ga0207684_10024861	3300025910	Bacteria	5103
689	Ga0207684_10167344	3300025910	Bacteria	1895
690	Ga0207684_10207376	3300025910	Bacteria	1691
691	Ga0207654_10068328	3300025911	Bacteria	2102
692	Ga0207654_10084664	3300025911	Bacteria	1917
693	Ga0207654_10131007	3300025911	Bacteria	1587
694	Ga0207654_10241210	3300025911	Bacteria	1208
695	Ga0207654_10590729	3300025911	Bacteria	792
696	Ga0207654_11059730	3300025911	Bacteria	590
697	Ga0207707_10019035	3300025912	Bacteria	5990
698	Ga0207707_10024482	3300025912	Bacteria	5282
699	Ga0207707_10037899	3300025912	Bacteria	4212
700	Ga0207707_10052903	3300025912	Bacteria	3534
701	Ga0207707_10065089	3300025912	Bacteria	3175
702	Ga0207707_10096476	3300025912	Bacteria	2584
703	Ga0207707_10208199	3300025912	Bacteria	1704
704	Ga0207707_10288308	3300025912	Bacteria	1420
705	Ga0207707_10402835	3300025912	Bacteria	1174
706	Ga0207695_10034316	3300025913	Bacteria	5520
707	Ga0207695_10198896	3300025913	Bacteria	1919
708	Ga0207695_10351630	3300025913	Bacteria	1361
709	Ga0207695_10409690	3300025913	Bacteria	1240
710	Ga0207695_10556145	3300025913	Bacteria	1029
711	Ga0207671_10280621	3300025914	Bacteria	1314
712	Ga0207671_10319881	3300025914	Bacteria	1228
713	Ga0207671_10633138	3300025914	Bacteria	852
714	Ga0207693_10001702	3300025915	Bacteria	19375
715	Ga0207693_10008511	3300025915	Bacteria	8399
716	Ga0207693_10022388	3300025915	Bacteria	5022
717	Ga0207693_10046006	3300025915	Bacteria	3429
718	Ga0207693_10070758	3300025915	Bacteria	2730
719	Ga0207693_10085365	3300025915	Bacteria	2473
720	Ga0207693_10096081	3300025915	Bacteria	2323
721	Ga0207693_10102694	3300025915	Bacteria	2242
722	Ga0207693_10106237	3300025915	Bacteria	2202
723	Ga0207693_10153386	3300025915	Bacteria	1812
724	Ga0207693_10161496	3300025915	Bacteria	1763
725	Ga0207693_10171044	3300025915	Bacteria	1711
726	Ga0207693_10399334	3300025915	Bacteria	1075
727	Ga0207693_10462267	3300025915	Bacteria	991
728	Ga0207693_11129766	3300025915	Bacteria	594
729	Ga0207663_10003839	3300025916	Bacteria	7417
730	Ga0207663_10023722	3300025916	Bacteria	3525
731	Ga0207663_10041881	3300025916	Bacteria	2794
732	Ga0207663_10088782	3300025916	Bacteria	2045
733	Ga0207663_10198174	3300025916	Bacteria	1446
734	Ga0207663_10227950	3300025916	Bacteria	1359
735	Ga0207663_10756089	3300025916	Bacteria	772
736	Ga0207663_10842514	3300025916	Bacteria	731
737	Ga0207660_10010825	3300025917	Bacteria	5928
738	Ga0207660_10097736	3300025917	Bacteria	2188
739	Ga0207660_10208707	3300025917	Bacteria	1528
740	Ga0207660_10890811	3300025917	Bacteria	726
741	Ga0207660_11070923	3300025917	Bacteria	657
742	Ga0207662_10552688	3300025918	Bacteria	797
743	Ga0207657_10000486	3300025919	Bacteria	41915
744	Ga0207657_10020525	3300025919	Bacteria	6241
745	Ga0207657_10029003	3300025919	Bacteria	5043
746	Ga0207657_10069360	3300025919	Bacteria	2992
747	Ga0207657_10211250	3300025919	Bacteria	1557
748	Ga0207657_10243118	3300025919	Bacteria	1436
749	Ga0207657_11187346	3300025919	Bacteria	580
750	Ga0207649_10020343	3300025920	Bacteria	3805
751	Ga0207649_10234246	3300025920	Bacteria	1315
752	Ga0207649_10428825	3300025920	Bacteria	994
753	Ga0207652_10024240	3300025921	Bacteria	5032
754	Ga0207652_10148650	3300025921	Bacteria	2097
755	Ga0207652_10187592	3300025921	Bacteria	1859
756	Ga0207652_10587723	3300025921	Bacteria	999
757	Ga0207652_10638974	3300025921	Bacteria	952
758	Ga0207652_10722120	3300025921	Bacteria	888
759	Ga0207652_10726145	3300025921	Bacteria	885
760	Ga0207646_10019475	3300025922	Bacteria	6306
761	Ga0207646_10077558	3300025922	Bacteria	2969
762	Ga0207646_10091083	3300025922	Unclassified	2729
763	Ga0207646_10242481	3300025922	Bacteria	1628
764	Ga0207681_10067909	3300025923	Bacteria	2474
765	Ga0207681_10470553	3300025923	Bacteria	1025
766	Ga0207694_10028485	3300025924	Bacteria	4259
767	Ga0207694_10294369	3300025924	Bacteria	1335
768	Ga0207694_10888537	3300025924	Bacteria	753
769	Ga0207694_11039551	3300025924	Bacteria	693
770	Ga0207659_10325565	3300025926	Bacteria	1269
771	Ga0207687_10004254	3300025927	Bacteria	9575
772	Ga0207687_10058493	3300025927	Bacteria	2712
773	Ga0207687_10113889	3300025927	Bacteria	2012
774	Ga0207687_10146127	3300025927	Bacteria	1799
775	Ga0207687_10176299	3300025927	Bacteria	1653
776	Ga0207687_10275873	3300025927	Bacteria	1346
777	Ga0207687_10833946	3300025927	Bacteria	787
778	Ga0207700_10000001	3300025928	Bacteria	1122509
779	Ga0207700_10047933	3300025928	Bacteria	3170
780	Ga0207700_10061103	3300025928	Bacteria	2856
781	Ga0207700_10192678	3300025928	Unclassified	1714
782	Ga0207700_10356432	3300025928	Bacteria	1275
783	Ga0207700_10398038	3300025928	Bacteria	1206
784	Ga0207700_10472997	3300025928	Bacteria	1107
785	Ga0207700_10488766	3300025928	Bacteria	1088
786	Ga0207700_10708073	3300025928	Bacteria	899
787	Ga0207700_10885183	3300025928	Bacteria	799
788	Ga0207700_10911504	3300025928	Bacteria	787
789	Ga0207664_10024395	3300025929	Bacteria	4544
790	Ga0207664_10029771	3300025929	Bacteria	4162
791	Ga0207664_10065326	3300025929	Unclassified	2913
792	Ga0207664_10065955	3300025929	Bacteria	2900
793	Ga0207664_10132232	3300025929	Bacteria	2101
794	Ga0207664_10133047	3300025929	Bacteria	2096
795	Ga0207664_10210224	3300025929	Bacteria	1683
796	Ga0207664_10337969	3300025929	Bacteria	1331
797	Ga0207664_10493709	3300025929	Bacteria	1096
798	Ga0207664_10508097	3300025929	Bacteria	1079
799	Ga0207664_10726475	3300025929	Bacteria	893
800	Ga0207664_10842028	3300025929	Bacteria	824
801	Ga0207644_10122251	3300025931	Bacteria	1983
802	Ga0207644_10507612	3300025931	Bacteria	995
803	Ga0207644_10588513	3300025931	Unclassified	923
804	Ga0207690_10047787	3300025932	Bacteria	2842
805	Ga0207690_10050298	3300025932	Bacteria	2781
806	Ga0207690_10671299	3300025932	Unclassified	850
807	Ga0207690_10779089	3300025932	Bacteria	790
808	Ga0207706_10015841	3300025933	Bacteria	6817
809	Ga0207706_10017665	3300025933	Bacteria	6427
810	Ga0207706_10054683	3300025933	Bacteria	3522
811	Ga0207706_10201317	3300025933	Bacteria	1746
812	Ga0207706_10699764	3300025933	Bacteria	866
813	Ga0207686_10187941	3300025934	Bacteria	1470
814	Ga0207686_10304470	3300025934	Bacteria	1185
815	Ga0207686_10372647	3300025934	Bacteria	1081
816	Ga0207686_10377961	3300025934	Bacteria	1073
817	Ga0207686_10949012	3300025934	Bacteria	696
818	Ga0207709_10015535	3300025935	Bacteria	4221
819	Ga0207709_10140030	3300025935	Bacteria	1662
820	Ga0207709_10168690	3300025935	Bacteria	1534
821	Ga0207709_10503042	3300025935	Bacteria	946
822	Ga0207709_10795398	3300025935	Bacteria	763
823	Ga0207709_11765147	3300025935	Bacteria	515
824	Ga0207709_11769923	3300025935	Bacteria	514
825	Ga0207669_10169339	3300025937	Bacteria	1553
826	Ga0207669_10236887	3300025937	Bacteria	1350
827	Ga0207669_10695316	3300025937	Bacteria	835
828	Ga0207669_10935620	3300025937	Bacteria	726
829	Ga0207704_10204716	3300025938	Bacteria	1447
830	Ga0207704_10297628	3300025938	Bacteria	1234
831	Ga0207704_10748286	3300025938	Bacteria	813
832	Ga0207704_11366652	3300025938	Bacteria	606
833	Ga0207704_11388089	3300025938	Bacteria	602
834	Ga0207665_10006909	3300025939	Bacteria	7511
835	Ga0207665_10007382	3300025939	Bacteria	7268
836	Ga0207665_10008549	3300025939	Bacteria	6738
837	Ga0207665_10020551	3300025939	Bacteria	4340
838	Ga0207665_10198345	3300025939	Unclassified	1461
839	Ga0207665_10560610	3300025939	Bacteria	888
840	Ga0207691_10323663	3300025940	Bacteria	1322
841	Ga0207691_10811322	3300025940	Bacteria	786
842	Ga0207691_10850185	3300025940	Bacteria	765
843	Ga0207691_11074852	3300025940	Bacteria	670
844	Ga0207689_10273603	3300025942	Bacteria	1398
845	Ga0207689_10610310	3300025942	Archaea	918
846	Ga0207689_11239316	3300025942	Bacteria	627
847	Ga0207661_10034132	3300025944	Bacteria	3954
848	Ga0207661_10054438	3300025944	Bacteria	3205
849	Ga0207661_10055071	3300025944	Bacteria	3189
850	Ga0207661_10087029	3300025944	Bacteria	2594
851	Ga0207661_10133641	3300025944	Bacteria	2128
852	Ga0207661_10193455	3300025944	Bacteria	1784
853	Ga0207661_10382193	3300025944	Bacteria	1274
854	Ga0207661_10940229	3300025944	Bacteria	796
855	Ga0207661_11731735	3300025944	Bacteria	570
856	Ga0207679_10019315	3300025945	Bacteria	4575
857	Ga0207679_10101510	3300025945	Bacteria	2251
858	Ga0207679_10214098	3300025945	Bacteria	1618
859	Ga0207679_10588546	3300025945	Bacteria	1001
860	Ga0207679_11120337	3300025945	Bacteria	722
861	Ga0207679_11852546	3300025945	Bacteria	551
862	Ga0207667_10033657	3300025949	Bacteria	5508
863	Ga0207667_10052550	3300025949	Bacteria	4291
864	Ga0207667_10093704	3300025949	Bacteria	3101
865	Ga0207667_10120032	3300025949	Bacteria	2709
866	Ga0207667_10162617	3300025949	Bacteria	2296
867	Ga0207667_10209389	3300025949	Bacteria	1999
868	Ga0207667_10323170	3300025949	Unclassified	1576
869	Ga0207667_10367618	3300025949	Bacteria	1466
870	Ga0207667_10488163	3300025949	Bacteria	1250
871	Ga0207667_11516923	3300025949	Bacteria	641
872	Ga0207651_10184902	3300025960	Bacteria	1657
873	Ga0207651_10366202	3300025960	Bacteria	1218
874	Ga0207712_10015044	3300025961	Bacteria	4985
875	Ga0207712_10103593	3300025961	Bacteria	2120
876	Ga0207712_10387120	3300025961	Bacteria	1172
877	Ga0207712_11706340	3300025961	Bacteria	565
878	Ga0207668_10011409	3300025972	Bacteria	5398
879	Ga0207668_10254655	3300025972	Bacteria	1428
880	Ga0207668_10444041	3300025972	Bacteria	1106
881	Ga0207668_11538079	3300025972	Unclassified	600
882	Ga0207668_11626459	3300025972	Bacteria	583
883	Ga0207668_11890381	3300025972	Unclassified	538
884	Ga0207640_10745180	3300025981	Bacteria	844
885	Ga0207640_10746621	3300025981	Bacteria	843
886	Ga0207640_11308970	3300025981	Bacteria	647
887	Ga0207658_10020350	3300025986	Bacteria	4595
888	Ga0207658_11072635	3300025986	Bacteria	736
889	Ga0207677_10015921	3300026023	Bacteria	4439
890	Ga0207677_10176005	3300026023	Bacteria	1678
891	Ga0207677_10694713	3300026023	Bacteria	902
892	Ga0207677_10853475	3300026023	Bacteria	818
893	Ga0207677_11579061	3300026023	Bacteria	607
894	Ga0207703_10213799	3300026035	Bacteria	1720
895	Ga0207703_10527194	3300026035	Bacteria	1112
896	Ga0207703_10691683	3300026035	Unclassified	969
897	Ga0207703_11962184	3300026035	Bacteria	562
898	Ga0207639_10194243	3300026041	Unclassified	1736
899	Ga0207678_10077817	3300026067	Bacteria	2841
900	Ga0207678_10286144	3300026067	Bacteria	1415
901	Ga0207678_11346924	3300026067	Bacteria	631
902	Ga0207708_10007846	3300026075	Bacteria	7907
903	Ga0207708_10062648	3300026075	Bacteria	2841
904	Ga0207708_10113738	3300026075	Bacteria	2103
905	Ga0207708_11023482	3300026075	Bacteria	718
906	Ga0207702_10019475	3300026078	Bacteria	5614
907	Ga0207702_10046950	3300026078	Bacteria	3637
908	Ga0207702_10168557	3300026078	Bacteria	2006
909	Ga0207702_10169868	3300026078	Bacteria	1998
910	Ga0207702_10175752	3300026078	Bacteria	1967
911	Ga0207702_10180710	3300026078	Bacteria	1943
912	Ga0207702_10729753	3300026078	Unclassified	977
913	Ga0207702_11582796	3300026078	Bacteria	649
914	Ga0207702_12016608	3300026078	Bacteria	567
915	Ga0207702_12323859	3300026078	Unclassified	524
916	Ga0207648_10025309	3300026089	Bacteria	5289
917	Ga0207648_10233020	3300026089	Bacteria	1638
918	Ga0207648_10318116	3300026089	Bacteria	1398
919	Ga0207648_10487025	3300026089	Bacteria	1127
920	Ga0207648_11290594	3300026089	Bacteria	686
921	Ga0207676_10194178	3300026095	Bacteria	1789
922	Ga0207676_10312176	3300026095	Bacteria	1440
923	Ga0207676_10455555	3300026095	Bacteria	1207
924	Ga0207674_10006401	3300026116	Bacteria	13860
925	Ga0207674_10018554	3300026116	Bacteria	7558
926	Ga0207674_10055428	3300026116	Bacteria	4030
927	Ga0207674_10118840	3300026116	Bacteria	2613
928	Ga0207674_10432115	3300026116	Bacteria	1272
929	Ga0207674_10691849	3300026116	Bacteria	984
930	Ga0207674_11498837	3300026116	Unclassified	644
931	Ga0207674_11694651	3300026116	Unclassified	600
932	Ga0207675_100000456	3300026118	Bacteria	39658
933	Ga0207675_100027462	3300026118	Bacteria	5301
934	Ga0207675_100041096	3300026118	Bacteria	4318
935	Ga0207675_100133303	3300026118	Bacteria	2356
936	Ga0207675_101991972	3300026118	Bacteria	598
937	Ga0207683_10008677	3300026121	Bacteria	8691
938	Ga0207683_10129968	3300026121	Bacteria	2265
939	Ga0207683_10182679	3300026121	Bacteria	1902
940	Ga0207683_10227881	3300026121	Bacteria	1699
941	Ga0207683_10266845	3300026121	Bacteria	1563
942	Ga0207683_10609437	3300026121	Bacteria	1011
943	Ga0207683_10821772	3300026121	Bacteria	863
944	Ga0207683_11009747	3300026121	Bacteria	772
945	Ga0207698_10009525	3300026142	Bacteria	6199
946	Ga0207698_10043186	3300026142	Bacteria	3376
947	Ga0207698_10522411	3300026142	Bacteria	1159
948	Ga0207698_10699441	3300026142	Bacteria	1008
949	Ga0207698_11753808	3300026142	Bacteria	636
950	Ga0207428_10098665	3300027907	Unclassified	2260
951	Ga0207428_10230385	3300027907	Bacteria	1387
952	Ga0207428_11054577	3300027907	Unclassified	569
953	Ga0207428_11237744	3300027907	Bacteria	518
954	Ga0268266_10049246	3300028379	Bacteria	3613
955	Ga0268266_10544619	3300028379	Bacteria	1111
956	Ga0268266_10995896	3300028379	Bacteria	811
957	Ga0268265_10220518	3300028380	Unclassified	1659
958	Ga0268265_10417212	3300028380	Bacteria	1245
959	Ga0268265_10796555	3300028380	Bacteria	921
960	Ga0268264_10680413	3300028381	Bacteria	1020
961	Ga0268264_10921257	3300028381	Bacteria	878
962	Ga0268264_11119527	3300028381	Bacteria	796
963	Ga0268264_11542297	3300028381	Unclassified	675
964	Ga0268264_12058820	3300028381	Bacteria	580
965	Ga0265337_1024713	3300028556	Bacteria	1834
966	Ga0265326_10012763	3300028558	Bacteria	2463
967	Ga0265326_10107237	3300028558	Bacteria	793
968	Ga0265319_1001553	3300028563	Bacteria	13557
969	Ga0265319_1043575	3300028563	Bacteria	1506
970	Ga0265334_10001519	3300028573	Bacteria	11204
971	Ga0265334_10249635	3300028573	Unclassified	611
972	Ga0265318_10000286	3300028577	Bacteria	41428
973	Ga0265318_10003745	3300028577	Bacteria	7562
974	Ga0265318_10081970	3300028577	Bacteria	1191
975	Ga0265318_10100317	3300028577	Bacteria	1065
976	Ga0265318_10203192	3300028577	Bacteria	724
977	Ga0265323_10039216	3300028653	Bacteria	1728
978	Ga0265322_10002000	3300028654	Bacteria	6423
979	Ga0265336_10030818	3300028666	Bacteria	1669
980	Ga0265336_10032603	3300028666	Bacteria	1615
981	Ga0265338_10004064	3300028800	Bacteria	20061
982	Ga0265338_10004582	3300028800	Bacteria	18589
983	Ga0265338_10029019	3300028800	Bacteria	5499
984	Ga0265338_10057309	3300028800	Bacteria	3447
985	Ga0265338_10074499	3300028800	Bacteria	2886
986	Ga0265338_10967195	3300028800	Bacteria	577
987	Ga0265330_10000170	3300031235	Bacteria	51357
988	Ga0265330_10055589	3300031235	Bacteria	1728
989	Ga0265332_10053278	3300031238	Bacteria	1736
990	Ga0265332_10165449	3300031238	Bacteria	923
991	Ga0265328_10000396	3300031239	Bacteria	20417
992	Ga0265320_10004950	3300031240	Bacteria	8637
993	Ga0265320_10011270	3300031240	Bacteria	5269
994	Ga0265320_10073140	3300031240	Bacteria	1611
995	Ga0265325_10000058	3300031241	Bacteria	76250
996	Ga0265325_10026134	3300031241	Bacteria	3165
997	Ga0265325_10340994	3300031241	Bacteria	663
998	Ga0265329_10002680	3300031242	Bacteria	8004
999	Ga0265340_10008073	3300031247	Bacteria	5698
1000	Ga0265339_10001168	3300031249	Bacteria	19822
1001	Ga0265339_10002081	3300031249	Bacteria	14653
1002	Ga0265339_10114179	3300031249	Bacteria	1394
1003	Ga0265331_10000568	3300031250	Bacteria	33224
1004	Ga0265331_10111058	3300031250	Bacteria	1257
1005	Ga0265331_10265497	3300031250	Bacteria	769
1006	Ga0265327_10002315	3300031251	Bacteria	20368
1007	Ga0265327_10002769	3300031251	Bacteria	17741
1008	Ga0265327_10242643	3300031251	Bacteria	805
1009	Ga0265316_10000700	3300031344	Bacteria	37322
1010	Ga0265316_10187809	3300031344	Bacteria	1536
1011	Ga0265316_10363297	3300031344	Bacteria	1046
1012	Ga0307408_100674006	3300031548	Bacteria	927
1013	Ga0265313_10000754	3300031595	Bacteria	33060
1014	Ga0265313_10018405	3300031595	Bacteria	3923
1015	Ga0265314_10000982	3300031711	Bacteria	33556
1016	Ga0265314_10052402	3300031711	Bacteria	2836
1017	Ga0265342_10001473	3300031712	Bacteria	21888
1018	Ga0307413_10081243	3300031824	Bacteria	2078
1019	Ga0307413_11954195	3300031824	Bacteria	528
1020	Ga0307410_11414056	3300031852	Bacteria	611
1021	Ga0307406_10574494	3300031901	Bacteria	926
1022	Ga0307407_10871817	3300031903	Bacteria	689
1023	Ga0307412_11580603	3300031911	Unclassified	598
1024	Ga0307409_100043167	3300031995	Bacteria	3383
1025	Ga0307409_100935893	3300031995	Bacteria	882
1026	Ga0307416_100300162	3300032002	Bacteria	1596
1027	Ga0307416_100307840	3300032002	Bacteria	1579
1028	Ga0307416_100359645	3300032002	Unclassified	1477
1029	Ga0307416_100708228	3300032002	Bacteria	1096
1030	Ga0307416_101832574	3300032002	Bacteria	710
1031	Ga0307416_102393278	3300032002	Bacteria	628
1032	Ga0307411_11328095	3300032005	Bacteria	656
1033	Ga0307415_100220495	3300032126	Bacteria	1520
1034	Ga0307415_100272992	3300032126	Bacteria	1386
1035	Ga0373930_0012464	3300034816	Bacteria	1551
1036	Ga0373948_0027660	3300034817	Bacteria	1124
1037	Ga0373958_0000860	3300034819	Bacteria	3903
1038	Ga0373959_0111291	3300034820	Unclassified	661
1039	Ga0373938_0016046	3300034957	Bacteria	1459
1040	Ga0373926_0042015	3300035083	Bacteria	1635
1041	Ga0373926_0049343	3300035083	Bacteria	1516
1042	Ga0373928_0003431	3300035084	Bacteria	3016
1043	Ga0373928_0010752	3300035084	Bacteria	1802
1044	Ga0373929_0013357	3300035085	Bacteria	1573
1045	Ga0373929_0117659	3300035085	Unclassified	685
1046	Ga0373934_0249836	3300035086	Unclassified	733
1047	Ga0373940_0000514	3300035088	Bacteria	6071
1048	Ga0373944_0002467	3300035089	Bacteria	4699
1049	Ga0373944_0028640	3300035089	Bacteria	1659
1050	Ga0373949_0002898	3300035090	Bacteria	4228
1051	Ga0373949_0075398	3300035090	Bacteria	890
1052	Ga0373949_0185786	3300035090	Bacteria	618
1053	Ga0373951_0003415	3300035091	Bacteria	3854
1054	Ga0373952_0004762	3300035092	Bacteria	2468
1055	Ga0373952_0067407	3300035092	Bacteria	888
1056	Ga0373932_0002131	3300035112	Bacteria	5139
1057	Ga0373936_0021221	3300035113	Bacteria	2525
1058	Ga0373936_0107867	3300035113	Bacteria	1180
1059	Ga0373936_0573398	3300035113	Archaea	529
1060	Ga0373939_0001104	3300035114	Bacteria	6635
1061	Ga0373939_0030975	3300035114	Bacteria	1543
1062	Ga0373939_0122261	3300035114	Bacteria	920
1063	Ga0373941_0012114	3300035115	Bacteria	2247
1064	Ga0373945_0012482	3300035116	Bacteria	2823
1065	Ga0373945_0023499	3300035116	Bacteria	2130
1066	Ga0373945_0118285	3300035116	Bacteria	1051
1067	Ga0373945_0530506	3300035116	Archaea	527
1068	Ga0373953_0144071	3300035117	Unclassified	1020
1069	Ga0373956_0288599	3300035119	Unclassified	781
1070	Ga0373960_0000379	3300035121	Bacteria	8622
1071	Ga0373960_0363020	3300035121	Bacteria	551
1072	Ga0373943_0001202	3300035170	Bacteria	11580
1073	Ga0373943_0016176	3300035170	Bacteria	3398
1074	Ga0373943_0036417	3300035170	Bacteria	2356
1075	Ga0373943_0071293	3300035170	Bacteria	1760
1076	Ga0373943_0967211	3300035170	Archaea	510
1077	Ga0373946_0124686	3300035171	Bacteria	1179
1078	Ga0373946_0166952	3300035171	Unclassified	1037
1079	Ga0373946_0371965	3300035171	Unclassified	718
1080	Ga0373955_0125391	3300035172	Bacteria	1496
1081	Ga0373942_0002632	3300035207	Bacteria	4314
1082	Ga0373961_0261216	3300035241	Bacteria	629
1083	Ga0373962_0000833	3300035242	Bacteria	7030
1084	Ga0373924_0394198	3300035410	Unclassified	618
1085	Ga0373931_0004517	3300035691	Bacteria	6364
1086	Ga0373931_0161896	3300035691	Bacteria	1312
1087	Ga0373931_0374500	3300035691	Bacteria	896
1088	Ga0373935_0006516	3300035692	Bacteria	6978
1089	Ga0373935_0113656	3300035692	Bacteria	1800
1090	Ga0373935_1017650	3300035692	Bacteria	616
1091	Ga0373927_0116874	3300035695	Bacteria	1739
1092	Ga0373927_0854450	3300035695	Unclassified	601
1093	Ga0373947_0011350	3300035725	Bacteria	5114
1094	Ga0373947_0013280	3300035725	Bacteria	4718
1095	Ga0373947_0112570	3300035725	Bacteria	1721
1096	Ga0373947_0569286	3300035725	Bacteria	772
1097	Ga0373947_0643399	3300035725	Bacteria	723
1098	Ga0373947_0889564	3300035725	Bacteria	608
1099	Ga0373937_0088261	3300036401	Bacteria	2871
1100	Ga0373937_0321249	3300036401	Bacteria	1465
1101	Ga0373937_0671379	3300036401	Bacteria	982
1102	Ga0373925_0048753	3300037068	Bacteria	3157
1103	Ga0373925_0063084	3300037068	Bacteria	2788
1104	Ga0373925_0117578	3300037068	Bacteria	2060
1105	Ga0373925_0255416	3300037068	Bacteria	1407
1106	Ga0373925_0687416	3300037068	Bacteria	843
1107	Ga0395899_0006500	3300037312	Bacteria	9055
1108	Ga0395899_0006809	3300037312	Bacteria	8854
1109	Ga0395899_0009338	3300037312	Bacteria	7533
1110	Ga0395899_0019523	3300037312	Bacteria	5147
1111	Ga0395899_0056080	3300037312	Bacteria	2913
1112	Ga0395899_0080600	3300037312	Bacteria	2369
1113	Ga0395899_0089619	3300037312	Bacteria	2231
1114	Ga0395899_0097555	3300037312	Bacteria	2124
1115	Ga0395899_0117112	3300037312	Bacteria	1911
1116	Ga0395899_0163994	3300037312	Bacteria	1568
1117	Ga0395899_0168515	3300037312	Bacteria	1543
1118	Ga0395899_0312165	3300037312	Bacteria	1061
1119	Ga0395899_0363982	3300037312	Bacteria	964
1120	Ga0395899_0498595	3300037312	Unclassified	790
1121	Ga0395899_0548775	3300037312	Unclassified	743
1122	Ga0395900_0001841	3300037418	Bacteria	24168
1123	Ga0395900_0003865	3300037418	Bacteria	16006
1124	Ga0395900_0009361	3300037418	Bacteria	10044
1125	Ga0395900_0014932	3300037418	Bacteria	7914
1126	Ga0395900_0026766	3300037418	Bacteria	5902
1127	Ga0395900_0028922	3300037418	Bacteria	5681
1128	Ga0395900_0062116	3300037418	Bacteria	3840
1129	Ga0395900_0072975	3300037418	Bacteria	3528
1130	Ga0395900_0073759	3300037418	Bacteria	3509
1131	Ga0395900_0181098	3300037418	Bacteria	2141
1132	Ga0395900_0233555	3300037418	Bacteria	1848
1133	Ga0395900_0253787	3300037418	Bacteria	1759
1134	Ga0395900_0291584	3300037418	Bacteria	1620
1135	Ga0395900_0349436	3300037418	Bacteria	1452
1136	Ga0395900_0368008	3300037418	Bacteria	1408
1137	Ga0395900_0395846	3300037418	Bacteria	1346
1138	Ga0395900_0532126	3300037418	Unclassified	1122
1139	Ga0395900_0679175	3300037418	Bacteria	964
1140	Ga0395900_0821519	3300037418	Bacteria	856
1141	Ga0395900_0831421	3300037418	Bacteria	850
1142	Ga0395900_0838696	3300037418	Unclassified	845
1143	Ga0395900_1111542	3300037418	Unclassified	707
1144	Ga0395900_1272221	3300037418	Bacteria	650
1145	Ga0395900_1553575	3300037418	Unclassified	573
1146	Ga0395898_0002770	3300037466	Bacteria	20157
1147	Ga0395898_0004964	3300037466	Bacteria	14442
1148	Ga0395898_0006058	3300037466	Bacteria	12981
1149	Ga0395898_0013863	3300037466	Bacteria	8284
1150	Ga0395898_0015946	3300037466	Bacteria	7700
1151	Ga0395898_0026749	3300037466	Bacteria	5798
1152	Ga0395898_0028708	3300037466	Bacteria	5575
1153	Ga0395898_0032963	3300037466	Bacteria	5171
1154	Ga0395898_0038919	3300037466	Bacteria	4709
1155	Ga0395898_0067328	3300037466	Bacteria	3467
1156	Ga0395898_0095920	3300037466	Bacteria	2849
1157	Ga0395898_0121321	3300037466	Unclassified	2504
1158	Ga0395898_0155239	3300037466	Bacteria	2189
1159	Ga0395898_0191415	3300037466	Bacteria	1954
1160	Ga0395898_0201066	3300037466	Bacteria	1902
1161	Ga0395898_0216117	3300037466	Bacteria	1828
1162	Ga0395898_0321376	3300037466	Bacteria	1476
1163	Ga0395898_0488398	3300037466	Bacteria	1171
1164	Ga0395898_0563952	3300037466	Bacteria	1081
1165	Ga0395898_0654813	3300037466	Bacteria	993
1166	Ga0395898_1194623	3300037466	Unclassified	692
1167	Ga0395898_1705697	3300037466	Unclassified	552
1168	Ga0395905_0002146	3300037471	Bacteria	22374
1169	Ga0395905_0009584	3300037471	Bacteria	9456
1170	Ga0395905_0011371	3300037471	Bacteria	8605
1171	Ga0395905_0013021	3300037471	Bacteria	7991
1172	Ga0395905_0019829	3300037471	Bacteria	6372
1173	Ga0395905_0031674	3300037471	Bacteria	4976
1174	Ga0395905_0039460	3300037471	Bacteria	4429
1175	Ga0395905_0040313	3300037471	Bacteria	4381
1176	Ga0395905_0067556	3300037471	Bacteria	3348
1177	Ga0395905_0073344	3300037471	Bacteria	3208
1178	Ga0395905_0120040	3300037471	Bacteria	2471
1179	Ga0395905_0141137	3300037471	Bacteria	2266
1180	Ga0395905_0153235	3300037471	Bacteria	2168
1181	Ga0395905_0178933	3300037471	Bacteria	1991
1182	Ga0395905_0190784	3300037471	Bacteria	1922
1183	Ga0395905_0204253	3300037471	Bacteria	1852
1184	Ga0395905_0309858	3300037471	Bacteria	1467
1185	Ga0395905_0395773	3300037471	Bacteria	1276
1186	Ga0395905_0531690	3300037471	Bacteria	1076
1187	Ga0395905_0536266	3300037471	Bacteria	1071
1188	Ga0395905_1667569	3300037471	Bacteria	542
1189	Ga0436364_1512323	3300037853	Bacteria	1083
1190	Ga0395901_0004052	3300038443	Bacteria	14756
1191	Ga0395901_0005367	3300038443	Bacteria	12957
1192	Ga0395901_0006015	3300038443	Bacteria	12294
1193	Ga0395901_0008667	3300038443	Bacteria	10276
1194	Ga0395901_0011369	3300038443	Bacteria	9021
1195	Ga0395901_0012311	3300038443	Bacteria	8682
1196	Ga0395901_0019014	3300038443	Bacteria	7023
1197	Ga0395901_0022266	3300038443	Bacteria	6493
1198	Ga0395901_0025311	3300038443	Bacteria	6092
1199	Ga0395901_0026619	3300038443	Bacteria	5939
1200	Ga0395901_0037177	3300038443	Bacteria	5036
1201	Ga0395901_0037997	3300038443	Bacteria	4980
1202	Ga0395901_0040023	3300038443	Bacteria	4852
1203	Ga0395901_0040321	3300038443	Bacteria	4836
1204	Ga0395901_0044770	3300038443	Bacteria	4590
1205	Ga0395901_0081430	3300038443	Bacteria	3381
1206	Ga0395901_0124911	3300038443	Bacteria	2704
1207	Ga0395901_0134715	3300038443	Bacteria	2596
1208	Ga0395901_0187607	3300038443	Bacteria	2168
1209	Ga0395901_0187629	3300038443	Bacteria	2168
1210	Ga0395901_0191152	3300038443	Bacteria	2147
1211	Ga0395901_0196005	3300038443	Unclassified	2118
1212	Ga0395901_0237533	3300038443	Bacteria	1901
1213	Ga0395901_0295403	3300038443	Bacteria	1680
1214	Ga0395901_0379547	3300038443	Unclassified	1455
1215	Ga0395901_0496038	3300038443	Bacteria	1243
1216	Ga0395901_0501321	3300038443	Unclassified	1236
1217	Ga0395901_0784578	3300038443	Unclassified	943
1218	Ga0395901_1282804	3300038443	Bacteria	695
1219	Ga0395901_1430990	3300038443	Bacteria	649
1220	Ga0395901_1742827	3300038443	Bacteria	573
1221	Ga0395901_1991898	3300038443	Unclassified	527
1222	Ga0436365_1029760	3300039437	Bacteria	3133
1223	Ga0436360_0994852	3300039438	Unclassified	1053
1224	Ga0436363_0788567	3300039450	Bacteria	1072
1225	Ga0436363_1378044	3300039450	Bacteria	1653
1226	Ga0436363_1615001	3300039450	Bacteria	658
1227	Ga0436362_0813193	3300039453	Bacteria	2775
1228	Ga0451800_0362382	3300041459	Bacteria	856
1229	Ga0451802_0172529	3300041460	Bacteria	556
1230	Ga0451804_0369130	3300041463	Bacteria	601
1231	Ga0451804_0438811	3300041463	Bacteria	648
1232	Ga0451849_1193245	3300041505	Unclassified	565
1233	Ga0451853_2441445	3300041512	Unclassified	772
1234	Ga0439441_042796	3300042001	Bacteria	912
1235	Ga0439448_0009555	3300042005	Bacteria	2861
1236	Ga0439448_0078514	3300042005	Bacteria	1106
1237	Ga0439448_0238190	3300042005	Unclassified	641
1238	Ga0439450_043074	3300042008	Bacteria	1054
1239	Ga0450914_011579	3300042118	Unclassified	871
1240	Ga0450920_101425	3300042122	Bacteria	598
1241	Ga0450891_007515	3300042129	Bacteria	999
1242	Ga0450905_051384	3300042142	Bacteria	673
1243	Ga0450907_018015	3300042146	Bacteria	1180
1244	Ga0450910_043655	3300042147	Bacteria	729
1245	Ga0439446_0001115	3300042156	Bacteria	5945
1246	Ga0450918_028836	3300042531	Bacteria	978
1247	Ga0466969_0151394	3300044656	Bacteria	1069
1248	Ga0466965_0207162	3300044683	Archaea	1042
1249	Ga0466966_0024284	3300044684	Bacteria	3965
1250	Ga0466966_0154970	3300044684	Bacteria	1396
1251	Ga0466966_0176509	3300044684	Bacteria	1297
1252	Ga0466961_0046359	3300044693	Bacteria	2781
1253	Ga0466961_0064330	3300044693	Bacteria	2331
1254	Ga0466961_0075684	3300044693	Bacteria	2134
1255	Ga0466961_0576130	3300044693	Bacteria	677
1256	Ga0466963_0000760	3300044694	Bacteria	15952
1257	Ga0466963_0001436	3300044694	Bacteria	12827
1258	Ga0466963_0001939	3300044694	Bacteria	11340
1259	Ga0466963_0083057	3300044694	Bacteria	2172
1260	Ga0466963_0188651	3300044694	Bacteria	1440
1261	Ga0466963_0210485	3300044694	Bacteria	1360
1262	Ga0466963_0225591	3300044694	Unclassified	1312
1263	Ga0466963_0351928	3300044694	Unclassified	1037
1264	Ga0466963_0355046	3300044694	Bacteria	1032
1265	Ga0466963_0452979	3300044694	Bacteria	905
1266	Ga0466963_0518077	3300044694	Bacteria	842
1267	Ga0466963_0753599	3300044694	Bacteria	687
1268	Ga0466964_0007478	3300044706	Bacteria	4088
1269	Ga0466964_0044037	3300044706	Bacteria	1812
1270	Ga0466964_0103943	3300044706	Bacteria	1256
1271	Ga0466964_0205624	3300044706	Bacteria	948
1272	Ga0466964_0444567	3300044706	Unclassified	686
1273	Ga0466964_0777258	3300044706	Unclassified	539
1274	Ga0466971_0322027	3300044719	Bacteria	745
1275	Ga0466968_0026313	3300044735	Bacteria	2386
1276	Ga0466968_0060386	3300044735	Bacteria	1634
1277	Ga0466970_0259338	3300044765	Bacteria	975
1278	Ga0466957_0000320	3300044842	Bacteria	23320
1279	Ga0466957_0004574	3300044842	Bacteria	7729
1280	Ga0466957_0048415	3300044842	Bacteria	2584
1281	Ga0466957_0299988	3300044842	Bacteria	1079
1282	Ga0466957_0379433	3300044842	Bacteria	964
1283	Ga0466957_0554799	3300044842	Bacteria	801
1284	Ga0466957_0914530	3300044842	Bacteria	627
1285	Ga0466960_0032027	3300044901	Bacteria	2430
1286	Ga0466960_0812026	3300044901	Unclassified	567
1287	Ga0466959_0035557	3300045049	Bacteria	3683
1288	Ga0466959_0247888	3300045049	Bacteria	1229
1289	Ga0466959_0602735	3300045049	Unclassified	739
1290	Ga0451576_0051706	3300045051	Unclassified	4307
1291	Ga0451576_1250766	3300045051	Bacteria	774
1292	Ga0466958_0002456	3300045836	Bacteria	9308
1293	Ga0466958_0004436	3300045836	Bacteria	7409
1294	Ga0466958_0010455	3300045836	Bacteria	5198
1295	Ga0466958_0028407	3300045836	Bacteria	3316
1296	Ga0466958_0076967	3300045836	Bacteria	2048
1297	Ga0466967_0001643	3300045976	Bacteria	13213
1298	Ga0466967_0003379	3300045976	Bacteria	10393
1299	Ga0466967_0005325	3300045976	Bacteria	8890
1300	Ga0466967_0008300	3300045976	Bacteria	7593
1301	Ga0466967_0011726	3300045976	Bacteria	6662
1302	Ga0466967_0013034	3300045976	Bacteria	6398
1303	Ga0466967_0013420	3300045976	Bacteria	6330
1304	Ga0466967_0015752	3300045976	Bacteria	5938
1305	Ga0466967_0052537	3300045976	Bacteria	3577
1306	Ga0466967_0069610	3300045976	Bacteria	3145
1307	Ga0466967_0099491	3300045976	Bacteria	2656
1308	Ga0466967_0110146	3300045976	Bacteria	2529
1309	Ga0466967_0163992	3300045976	Bacteria	2088
1310	Ga0466967_0268501	3300045976	Bacteria	1634
1311	Ga0466967_0323334	3300045976	Bacteria	1488
1312	Ga0466967_0342433	3300045976	Bacteria	1446
1313	Ga0466967_0457147	3300045976	Bacteria	1248
1314	Ga0466967_0506291	3300045976	Unclassified	1185
1315	Ga0466967_0573148	3300045976	Bacteria	1112
1316	Ga0466967_0748941	3300045976	Bacteria	969
1317	Ga0466967_0845341	3300045976	Unclassified	909
1318	Ga0466967_1218418	3300045976	Unclassified	750
1319	Ga0466967_1311074	3300045976	Bacteria	721
1320	Ga0466967_1374865	3300045976	Bacteria	703
1321	Ga0495592_0216835	3300046454	Bacteria	1282
1322	Ga0495603_0012287	3300046455	Bacteria	5182
1323	Ga0495603_0400261	3300046455	Bacteria	787
1324	Ga0495603_0740840	3300046455	Bacteria	561
1325	Ga0495591_176647	3300046458	Unclassified	509
1326	Ga0495629_0000983	3300046459	Bacteria	22888
1327	Ga0495629_0161392	3300046459	Bacteria	1557
1328	Ga0495629_0508033	3300046459	Bacteria	812
1329	Ga0495641_0000513	3300046461	Bacteria	32468
1330	Ga0495641_0019125	3300046461	Bacteria	3515
1331	Ga0495641_0049158	3300046461	Unclassified	1932
1332	Ga0495641_0058794	3300046461	Bacteria	1739
1333	Ga0495641_0085884	3300046461	Unclassified	1408
1334	Ga0495651_0005516	3300046462	Bacteria	9652
1335	Ga0495651_0200495	3300046462	Bacteria	1397
1336	Ga0495651_0399783	3300046462	Bacteria	897
1337	Ga0495653_0032994	3300046463	Bacteria	4106
1338	Ga0495653_0046943	3300046463	Bacteria	3342
1339	Ga0495653_0319908	3300046463	Bacteria	1006
1340	Ga0495653_0645849	3300046463	Unclassified	647
1341	Ga0495653_0656537	3300046463	Unclassified	640
1342	Ga0495580_0131696	3300046472	Bacteria	1735
1343	Ga0495582_0001245	3300046473	Bacteria	14299
1344	Ga0495582_0013170	3300046473	Bacteria	4551
1345	Ga0495582_0047451	3300046473	Bacteria	2366
1346	Ga0495582_0136770	3300046473	Bacteria	1387
1347	Ga0495582_0265630	3300046473	Bacteria	984
1348	Ga0495605_0179443	3300046474	Bacteria	932
1349	Ga0495605_0195648	3300046474	Bacteria	883
1350	Ga0495639_0057257	3300046475	Bacteria	1781
1351	Ga0495639_0191297	3300046475	Bacteria	999
1352	Ga0495639_0357790	3300046475	Bacteria	733
1353	Ga0495639_0421813	3300046475	Bacteria	676
1354	Ga0495662_0052580	3300046476	Bacteria	1966
1355	Ga0495662_0054330	3300046476	Bacteria	1935
1356	Ga0495662_0519547	3300046476	Bacteria	584
1357	Ga0495664_0024930	3300046477	Bacteria	3479
1358	Ga0495664_0323083	3300046477	Bacteria	930
1359	Ga0495664_0430328	3300046477	Unclassified	791
1360	Ga0495584_0256841	3300046491	Bacteria	888
1361	Ga0495584_0318440	3300046491	Bacteria	790
1362	Ga0495584_0330262	3300046491	Unclassified	774
1363	Ga0495584_0432003	3300046491	Bacteria	670
1364	Ga0495585_0268813	3300046492	Unclassified	846
1365	Ga0495594_0013993	3300046499	Bacteria	4200
1366	Ga0495594_0250133	3300046499	Bacteria	1010
1367	Ga0495594_0310146	3300046499	Bacteria	899
1368	Ga0495594_0545803	3300046499	Bacteria	658
1369	Ga0495596_0142155	3300046500	Bacteria	932
1370	Ga0495596_0143108	3300046500	Bacteria	929
1371	Ga0495596_0396530	3300046500	Bacteria	538
1372	Ga0495607_0114894	3300046501	Unclassified	1422
1373	Ga0495583_0278103	3300046506	Bacteria	668
1374	Ga0495608_0011310	3300046511	Bacteria	6214
1375	Ga0495608_0077939	3300046511	Bacteria	2157
1376	Ga0495608_0087721	3300046511	Bacteria	2015
1377	Ga0495608_0261062	3300046511	Bacteria	1078
1378	Ga0495608_0382161	3300046511	Unclassified	863
1379	Ga0495616_0197194	3300046513	Bacteria	887
1380	Ga0495616_0223990	3300046513	Unclassified	818
1381	Ga0495618_0057577	3300046514	Bacteria	2461
1382	Ga0495618_0150639	3300046514	Bacteria	1486
1383	Ga0495618_0287753	3300046514	Unclassified	1023
1384	Ga0495628_0007971	3300046516	Bacteria	9126
1385	Ga0495628_0100942	3300046516	Bacteria	2227
1386	Ga0495628_0313932	3300046516	Unclassified	1158
1387	Ga0495630_0005552	3300046517	Bacteria	8898
1388	Ga0495630_0026893	3300046517	Bacteria	4263
1389	Ga0495630_0078236	3300046517	Bacteria	2494
1390	Ga0495630_0673972	3300046517	Bacteria	791
1391	Ga0495631_0119627	3300046518	Bacteria	1133
1392	Ga0495637_0175995	3300046520	Bacteria	796
1393	Ga0495637_0236652	3300046520	Unclassified	661
1394	Ga0495644_0083291	3300046523	Bacteria	1206
1395	Ga0495644_0117907	3300046523	Bacteria	1009
1396	Ga0495644_0134824	3300046523	Unclassified	942
1397	Ga0495644_0346849	3300046523	Bacteria	584
1398	Ga0495644_0411917	3300046523	Bacteria	536
1399	Ga0495663_0038880	3300046525	Bacteria	1440
1400	Ga0495663_0330905	3300046525	Unclassified	552
1401	Ga0495642_0036590	3300046528	Bacteria	1984
1402	Ga0495652_0024348	3300046529	Bacteria	5359
1403	Ga0495652_0081792	3300046529	Bacteria	2663
1404	Ga0495652_0646917	3300046529	Unclassified	716
1405	Ga0495652_0723234	3300046529	Unclassified	668
1406	Ga0495665_0010504	3300046531	Bacteria	5011
1407	Ga0495665_0159832	3300046531	Bacteria	1175
1408	Ga0495640_0008531	3300046533	Bacteria	8032
1409	Ga0495640_0029240	3300046533	Bacteria	3959
1410	Ga0495640_0767416	3300046533	Bacteria	576
1411	Ga0495640_0872655	3300046533	Unclassified	534
1412	Ga0495587_0420349	3300046536	Bacteria	742
1413	Ga0495587_0425520	3300046536	Bacteria	737
1414	Ga0495587_0686041	3300046536	Unclassified	562
1415	Ga0495587_0701051	3300046536	Bacteria	555
1416	Ga0495598_0056966	3300046537	Bacteria	1195
1417	Ga0495609_0077193	3300046538	Unclassified	1459
1418	Ga0495645_0023098	3300046543	Bacteria	4503
1419	Ga0495645_0305930	3300046543	Bacteria	1037
1420	Ga0495645_0392251	3300046543	Unclassified	886
1421	Ga0495622_0138971	3300046557	Bacteria	1103
1422	Ga0495622_0303858	3300046557	Unclassified	695
1423	Ga0495633_0469581	3300046558	Bacteria	568
1424	Ga0495667_0201620	3300046559	Unclassified	1273
1425	Ga0495667_0317754	3300046559	Bacteria	985
1426	Ga0495667_0339098	3300046559	Bacteria	950
1427	Ga0495656_0006083	3300046615	Bacteria	4209
1428	Ga0495656_0111967	3300046615	Bacteria	1278
1429	Ga0495656_0156391	3300046615	Bacteria	1105
1430	Ga0495656_0378350	3300046615	Bacteria	738
1431	Ga0495668_0266653	3300046616	Bacteria	938
1432	Ga0495668_0304602	3300046616	Unclassified	874
1433	Ga0495634_0081767	3300046642	Bacteria	2112
1434	Ga0495634_0243400	3300046642	Bacteria	1102
1435	Ga0495611_0128618	3300046648	Bacteria	1182
1436	Ga0495611_0212943	3300046648	Bacteria	900
1437	Ga0495635_0015649	3300046663	Bacteria	5298
1438	Ga0495635_0307960	3300046663	Bacteria	1061
1439	Ga0495659_0094314	3300046664	Bacteria	1153
1440	Ga0495659_0171272	3300046664	Bacteria	881
1441	Ga0495659_0200648	3300046664	Bacteria	818
1442	Ga0495659_0473472	3300046664	Bacteria	547
1443	Ga0495588_0005238	3300046674	Bacteria	5764
1444	Ga0495588_0006455	3300046674	Bacteria	5284
1445	Ga0495588_0725376	3300046674	Unclassified	520
1446	Ga0495657_0063716	3300046675	Bacteria	2431
1447	Ga0495657_0134745	3300046675	Bacteria	1544
1448	Ga0495657_0560160	3300046675	Bacteria	663
1449	Ga0495657_0621229	3300046675	Bacteria	624
1450	Ga0495599_0028928	3300046678	Bacteria	3473
1451	Ga0495599_0212415	3300046678	Bacteria	1186
1452	Ga0495623_0097742	3300046679	Bacteria	1793
1453	Ga0495623_0151249	3300046679	Bacteria	1372
1454	Ga0495623_0274627	3300046679	Unclassified	940
1455	Ga0495646_0159653	3300046680	Bacteria	1249
1456	Ga0495647_0009126	3300046681	Bacteria	3349
1457	Ga0495647_0082903	3300046681	Bacteria	1303
1458	Ga0495647_0172573	3300046681	Bacteria	937
1459	Ga0495658_0012385	3300046683	Bacteria	4318
1460	Ga0495658_0054229	3300046683	Bacteria	2280
1461	Ga0495658_0099660	3300046683	Bacteria	1732
1462	Ga0495658_0199256	3300046683	Bacteria	1247
1463	Ga0495658_0494327	3300046683	Bacteria	782
1464	Ga0495613_0007233	3300046689	Bacteria	8265
1465	Ga0495613_0172484	3300046689	Bacteria	1535
1466	Ga0495613_0794400	3300046689	Bacteria	618
1467	Ga0495624_0044440	3300046690	Bacteria	2831
1468	Ga0495624_0546952	3300046690	Bacteria	691
1469	Ga0495624_0750817	3300046690	Bacteria	578
1470	Ga0495670_0369615	3300046691	Bacteria	773
1471	Ga0495670_0573015	3300046691	Unclassified	615
1472	Ga0495670_0825321	3300046691	Bacteria	506
1473	Ga0495671_0100159	3300046692	Bacteria	1417
1474	Ga0495671_0222425	3300046692	Bacteria	914
1475	Ga0495589_0091199	3300046794	Bacteria	1480
1476	Ga0495589_0148084	3300046794	Bacteria	1122
1477	Ga0495589_0260387	3300046794	Bacteria	809
1478	Ga0495589_0399788	3300046794	Bacteria	631
1479	Ga0495600_0031221	3300046809	Bacteria	3451
1480	Ga0495600_0173525	3300046809	Bacteria	1391
1481	Ga0495600_0502227	3300046809	Unclassified	745
1482	Ga0495581_0012008	3300047315	Bacteria	5011
1483	Ga0495581_0014564	3300047315	Bacteria	4559
1484	Ga0495581_0151222	3300047315	Bacteria	1356
1485	Ga0495581_0527980	3300047315	Unclassified	685
1486	Ga0495604_0036937	3300047317	Bacteria	3849
1487	Ga0495604_0365094	3300047317	Unclassified	957
1488	Ga0495604_0540509	3300047317	Bacteria	752
1489	Ga0495636_0142474	3300047318	Unclassified	1071
1490	Ga0495674_0001926	3300047319	Bacteria	20489
1491	Ga0495674_0078002	3300047319	Bacteria	2847
1492	Ga0495674_0089857	3300047319	Bacteria	2625
1493	Ga0495674_1020033	3300047319	Unclassified	633
1494	Ga0495676_0002145	3300047321	Bacteria	17448
1495	Ga0495676_0033965	3300047321	Bacteria	4285
1496	Ga0495676_0069993	3300047321	Bacteria	2705
1497	Ga0495676_0113574	3300047321	Bacteria	1983
1498	Ga0495676_0141785	3300047321	Bacteria	1721
1499	Ga0495676_0206723	3300047321	Bacteria	1361
1500	Ga0495680_0011628	3300047322	Bacteria	7778
1501	Ga0495680_0233381	3300047322	Bacteria	1309
1502	Ga0495680_0550391	3300047322	Bacteria	777
1503	Ga0495683_0234158	3300047323	Bacteria	813
1504	Ga0495675_0389692	3300047444	Bacteria	814
1505	Ga0495675_0784741	3300047444	Unclassified	528
1506	Ga0495679_079402	3300047446	Bacteria	934
1507	Ga0495684_0008848	3300047471	Bacteria	7780
1508	Ga0495684_0036035	3300047471	Bacteria	3793
1509	Ga0495684_0066161	3300047471	Bacteria	2748
1510	Ga0495593_0191121	3300047673	Bacteria	1030
1511	Ga0495593_0299810	3300047673	Bacteria	803
1512	Ga0495593_0599967	3300047673	Unclassified	553
1513	Ga0495602_0038419	3300048088	Bacteria	4426
1514	Ga0495602_0456426	3300048088	Bacteria	901
1515	Ga0495602_0764617	3300048088	Archaea	651
1516	Ga0495602_0885086	3300048088	Bacteria	595
1517	Ga0495614_0061750	3300048089	Bacteria	1610
1518	Ga0495614_0167503	3300048089	Bacteria	985
1519	Ga0495626_0198898	3300048091	Bacteria	823
1520	Ga0496100_0005486	3300048903	Bacteria	6837
1521	Ga0496100_0043655	3300048903	Bacteria	2868
1522	Ga0496100_0056297	3300048903	Bacteria	2572
1523	Ga0496100_0079020	3300048903	Bacteria	2215
1524	Ga0496100_0093466	3300048903	Bacteria	2058
1525	Ga0496100_0103397	3300048903	Bacteria	1967
1526	Ga0496100_0137383	3300048903	Bacteria	1728
1527	Ga0496100_0172660	3300048903	Bacteria	1558
1528	Ga0496100_0416366	3300048903	Bacteria	1025
1529	Ga0496100_0442275	3300048903	Unclassified	995
1530	Ga0496100_1104927	3300048903	Bacteria	625
1531	Ga0496101_0009617	3300048904	Bacteria	6360
1532	Ga0496101_0037795	3300048904	Bacteria	3427
1533	Ga0496101_0075364	3300048904	Bacteria	2483
1534	Ga0496101_0093758	3300048904	Bacteria	2236
1535	Ga0496101_0099408	3300048904	Bacteria	2175
1536	Ga0496101_0117196	3300048904	Bacteria	2010
1537	Ga0496101_0202546	3300048904	Bacteria	1535
1538	Ga0496101_0287100	3300048904	Bacteria	1287
1539	Ga0496101_0393617	3300048904	Bacteria	1091
1540	Ga0496101_0405048	3300048904	Bacteria	1074
1541	Ga0496101_0547864	3300048904	Bacteria	914
1542	Ga0496101_0575101	3300048904	Unclassified	891
1543	Ga0496101_1079745	3300048904	Unclassified	630
1544	Ga0496101_1147869	3300048904	Bacteria	609
1545	Ga0496102_0028674	3300048905	Bacteria	4974
1546	Ga0496102_0033041	3300048905	Bacteria	4648
1547	Ga0496102_0039629	3300048905	Bacteria	4258
1548	Ga0496102_0041756	3300048905	Bacteria	4155
1549	Ga0496102_0049308	3300048905	Bacteria	3830
1550	Ga0496102_0098466	3300048905	Bacteria	2714
1551	Ga0496102_0171817	3300048905	Bacteria	2040
1552	Ga0496102_0177945	3300048905	Bacteria	2003
1553	Ga0496102_0278204	3300048905	Bacteria	1578
1554	Ga0496102_0410934	3300048905	Unclassified	1271
1555	Ga0496102_0572050	3300048905	Bacteria	1053
1556	Ga0496102_0599168	3300048905	Bacteria	1025
1557	Ga0496102_0668796	3300048905	Bacteria	961
1558	Ga0496102_0939882	3300048905	Bacteria	786
1559	Ga0496102_1018634	3300048905	Bacteria	748
1560	Ga0496102_1255752	3300048905	Bacteria	660
1561	Ga0496102_1963606	3300048905	Unclassified	502
1562	Ga0496103_0003179	3300048906	Bacteria	10094
1563	Ga0496103_0005385	3300048906	Bacteria	7668
1564	Ga0496103_0017111	3300048906	Bacteria	4335
1565	Ga0496103_0020509	3300048906	Bacteria	3970
1566	Ga0496103_0030696	3300048906	Unclassified	3272
1567	Ga0496103_0053880	3300048906	Bacteria	2493
1568	Ga0496103_0236362	3300048906	Bacteria	1175
1569	Ga0496103_0260053	3300048906	Bacteria	1117
1570	Ga0496103_0267831	3300048906	Bacteria	1099
1571	Ga0496103_0460618	3300048906	Bacteria	815
1572	Ga0496103_0620774	3300048906	Bacteria	688
1573	Ga0496104_0034950	3300048907	Bacteria	4690
1574	Ga0496104_0036343	3300048907	Bacteria	4604
1575	Ga0496104_0054880	3300048907	Bacteria	3766
1576	Ga0496104_0109498	3300048907	Bacteria	2647
1577	Ga0496104_0153243	3300048907	Bacteria	2212
1578	Ga0496104_0193541	3300048907	Bacteria	1945
1579	Ga0496104_0231178	3300048907	Bacteria	1761
1580	Ga0496104_0285975	3300048907	Bacteria	1561
1581	Ga0496104_0448316	3300048907	Bacteria	1202
1582	Ga0496104_0649367	3300048907	Bacteria	964
1583	Ga0496104_0778691	3300048907	Bacteria	863
1584	Ga0496104_0903946	3300048907	Bacteria	788
1585	Ga0496104_0909179	3300048907	Bacteria	785
1586	Ga0496104_1753214	3300048907	Unclassified	523
1587	Ga0496105_0001920	3300048908	Bacteria	14937
1588	Ga0496105_0014154	3300048908	Bacteria	6347
1589	Ga0496105_0016082	3300048908	Bacteria	5968
1590	Ga0496105_0023674	3300048908	Bacteria	4984
1591	Ga0496105_0038776	3300048908	Bacteria	3925
1592	Ga0496105_0057512	3300048908	Bacteria	3211
1593	Ga0496105_0070514	3300048908	Bacteria	2889
1594	Ga0496105_0074744	3300048908	Bacteria	2799
1595	Ga0496105_0126394	3300048908	Unclassified	2108
1596	Ga0496105_0365871	3300048908	Bacteria	1150
1597	Ga0496105_0366739	3300048908	Bacteria	1148
1598	Ga0496105_0370393	3300048908	Bacteria	1141
1599	Ga0496105_0577963	3300048908	Bacteria	874
1600	Ga0496105_0607157	3300048908	Bacteria	848
1601	Ga0496105_0678736	3300048908	Bacteria	792
1602	Ga0496105_0933080	3300048908	Bacteria	653
1603	Ga0496106_0008859	3300048909	Bacteria	7438
1604	Ga0496106_0012914	3300048909	Bacteria	6163
1605	Ga0496106_0041717	3300048909	Bacteria	3439
1606	Ga0496106_0057932	3300048909	Bacteria	2931
1607	Ga0496106_0066614	3300048909	Bacteria	2743
1608	Ga0496106_0071421	3300048909	Bacteria	2653
1609	Ga0496106_0103533	3300048909	Bacteria	2209
1610	Ga0496106_0180217	3300048909	Bacteria	1677
1611	Ga0496106_0331115	3300048909	Unclassified	1222
1612	Ga0496106_0392279	3300048909	Unclassified	1115
1613	Ga0496106_0424210	3300048909	Bacteria	1069
1614	Ga0496106_0726392	3300048909	Bacteria	791
1615	Ga0496107_0001958	3300048910	Bacteria	13084
1616	Ga0496107_0017552	3300048910	Bacteria	5033
1617	Ga0496107_0029542	3300048910	Bacteria	3900
1618	Ga0496107_0035950	3300048910	Bacteria	3552
1619	Ga0496107_0067819	3300048910	Bacteria	2589
1620	Ga0496107_0090718	3300048910	Bacteria	2233
1621	Ga0496107_0142100	3300048910	Bacteria	1774
1622	Ga0496107_0161323	3300048910	Unclassified	1661
1623	Ga0496107_0389422	3300048910	Bacteria	1037
1624	Ga0496107_0393123	3300048910	Bacteria	1031
1625	Ga0496107_0420881	3300048910	Bacteria	993
1626	Ga0496107_0612110	3300048910	Unclassified	804
1627	Ga0496107_0632893	3300048910	Bacteria	789
1628	Ga0496107_1013554	3300048910	Bacteria	602
1629	Ga0496108_0002655	3300048911	Bacteria	14326
1630	Ga0496108_0024762	3300048911	Bacteria	4943
1631	Ga0496108_0031291	3300048911	Bacteria	4414
1632	Ga0496108_0050123	3300048911	Bacteria	3494
1633	Ga0496108_0051848	3300048911	Bacteria	3437
1634	Ga0496108_0124466	3300048911	Bacteria	2213
1635	Ga0496108_0170868	3300048911	Bacteria	1881
1636	Ga0496108_0235271	3300048911	Unclassified	1593
1637	Ga0496108_0246836	3300048911	Bacteria	1553
1638	Ga0496108_0271763	3300048911	Bacteria	1475
1639	Ga0496108_0329485	3300048911	Bacteria	1331
1640	Ga0496108_0379522	3300048911	Bacteria	1234
1641	Ga0496108_0451674	3300048911	Bacteria	1123
1642	Ga0496108_0542566	3300048911	Bacteria	1015
1643	Ga0496108_0790289	3300048911	Unclassified	819
1644	Ga0496108_0957287	3300048911	Bacteria	733
1645	Ga0496108_1004428	3300048911	Unclassified	712
1646	Ga0496109_0005630	3300048912	Bacteria	10482
1647	Ga0496109_0007732	3300048912	Bacteria	9102
1648	Ga0496109_0019915	3300048912	Bacteria	5922
1649	Ga0496109_0022485	3300048912	Bacteria	5586
1650	Ga0496109_0025284	3300048912	Bacteria	5289
1651	Ga0496109_0031833	3300048912	Bacteria	4737
1652	Ga0496109_0038224	3300048912	Bacteria	4339
1653	Ga0496109_0112769	3300048912	Unclassified	2528
1654	Ga0496109_0202001	3300048912	Bacteria	1869
1655	Ga0496109_0381929	3300048912	Bacteria	1331
1656	Ga0496109_0488668	3300048912	Bacteria	1162
1657	Ga0496109_0570950	3300048912	Bacteria	1066
1658	Ga0496109_1146000	3300048912	Unclassified	714
1659	Ga0496110_0006094	3300048913	Bacteria	9501
1660	Ga0496110_0018736	3300048913	Bacteria	5807
1661	Ga0496110_0022099	3300048913	Bacteria	5396
1662	Ga0496110_0029815	3300048913	Bacteria	4700
1663	Ga0496110_0063255	3300048913	Bacteria	3269
1664	Ga0496110_0075288	3300048913	Bacteria	2999
1665	Ga0496110_0083504	3300048913	Bacteria	2850
1666	Ga0496110_0087909	3300048913	Bacteria	2775
1667	Ga0496110_0250038	3300048913	Bacteria	1613
1668	Ga0496110_0340090	3300048913	Bacteria	1367
1669	Ga0496110_0345039	3300048913	Bacteria	1356
1670	Ga0496110_0370360	3300048913	Bacteria	1305
1671	Ga0496110_0373221	3300048913	Bacteria	1300
1672	Ga0496110_0450605	3300048913	Bacteria	1173
1673	Ga0496110_0537381	3300048913	Bacteria	1063
1674	Ga0496110_0661286	3300048913	Bacteria	945
1675	Ga0496110_0699150	3300048913	Bacteria	915
1676	Ga0496110_0806053	3300048913	Bacteria	843
1677	Ga0496111_0000818	3300048914	Bacteria	16715
1678	Ga0496111_0012368	3300048914	Bacteria	5776
1679	Ga0496111_0021852	3300048914	Bacteria	4471
1680	Ga0496111_0024006	3300048914	Bacteria	4287
1681	Ga0496111_0030104	3300048914	Bacteria	3860
1682	Ga0496111_0040485	3300048914	Bacteria	3342
1683	Ga0496111_0044024	3300048914	Bacteria	3208
1684	Ga0496111_0116235	3300048914	Bacteria	1973
1685	Ga0496111_0217754	3300048914	Bacteria	1418
1686	Ga0496111_0265848	3300048914	Bacteria	1272
1687	Ga0496111_0469018	3300048914	Unclassified	928
1688	Ga0496111_0704875	3300048914	Bacteria	734
1689	Ga0496111_0833164	3300048914	Unclassified	666
1690	Ga0496112_0002180	3300048915	Bacteria	15581
1691	Ga0496112_0004262	3300048915	Bacteria	12072
1692	Ga0496112_0010672	3300048915	Bacteria	8347
1693	Ga0496112_0012685	3300048915	Bacteria	7750
1694	Ga0496112_0049399	3300048915	Bacteria	4124
1695	Ga0496112_0049547	3300048915	Bacteria	4118
1696	Ga0496112_0085483	3300048915	Bacteria	3121
1697	Ga0496112_0096032	3300048915	Bacteria	2934
1698	Ga0496112_0164007	3300048915	Bacteria	2188
1699	Ga0496112_0201561	3300048915	Bacteria	1949
1700	Ga0496112_0337564	3300048915	Bacteria	1450
1701	Ga0496112_0348182	3300048915	Bacteria	1424
1702	Ga0496112_0489552	3300048915	Bacteria	1166
1703	Ga0496112_0683536	3300048915	Bacteria	955
1704	Ga0496113_0000051	3300048916	Bacteria	49921
1705	Ga0496113_0023779	3300048916	Bacteria	4348
1706	Ga0496113_0052555	3300048916	Bacteria	3044
1707	Ga0496113_0053825	3300048916	Bacteria	3010
1708	Ga0496113_0104094	3300048916	Bacteria	2202
1709	Ga0496113_0166420	3300048916	Unclassified	1745
1710	Ga0496113_0467628	3300048916	Bacteria	1013
1711	Ga0496113_0476678	3300048916	Bacteria	1002
1712	Ga0496113_0698659	3300048916	Unclassified	809
1713	Ga0496113_1121657	3300048916	Unclassified	616
1714	Ga0496113_1178641	3300048916	Bacteria	599
1715	Ga0496114_0003880	3300048917	Bacteria	11522
1716	Ga0496114_0004690	3300048917	Bacteria	10629
1717	Ga0496114_0020241	3300048917	Bacteria	5400
1718	Ga0496114_0024767	3300048917	Bacteria	4899
1719	Ga0496114_0025728	3300048917	Bacteria	4812
1720	Ga0496114_0036352	3300048917	Bacteria	4071
1721	Ga0496114_0140180	3300048917	Bacteria	2093
1722	Ga0496114_0325382	3300048917	Bacteria	1359
1723	Ga0496114_0363372	3300048917	Bacteria	1280
1724	Ga0496114_0382814	3300048917	Bacteria	1245
1725	Ga0496114_0435457	3300048917	Bacteria	1161
1726	Ga0496114_0440678	3300048917	Bacteria	1154
1727	Ga0496114_0574016	3300048917	Bacteria	995
1728	Ga0496114_0576073	3300048917	Bacteria	993
1729	Ga0496114_0882693	3300048917	Bacteria	775
1730	Ga0496114_1161875	3300048917	Bacteria	657
1731	Ga0496115_0001212	3300048918	Bacteria	18489
1732	Ga0496115_0002156	3300048918	Bacteria	14076
1733	Ga0496115_0032773	3300048918	Bacteria	4100
1734	Ga0496115_0033207	3300048918	Bacteria	4073
1735	Ga0496115_0035301	3300048918	Unclassified	3955
1736	Ga0496115_0037444	3300048918	Bacteria	3843
1737	Ga0496115_0049736	3300048918	Bacteria	3356
1738	Ga0496115_0116517	3300048918	Bacteria	2197
1739	Ga0496115_0135328	3300048918	Bacteria	2032
1740	Ga0496115_0171714	3300048918	Bacteria	1793
1741	Ga0496115_0217024	3300048918	Bacteria	1579
1742	Ga0496115_0288030	3300048918	Bacteria	1348
1743	Ga0496115_0425740	3300048918	Bacteria	1075
1744	Ga0496115_0615069	3300048918	Bacteria	862
1745	Ga0496115_0959581	3300048918	Bacteria	656
1746	Ga0501031_0000867	3300049568	Bacteria	18200
1747	Ga0501032_0124879	3300049569	Bacteria	1700
1748	Ga0501033_0057314	3300049570	Bacteria	2880
1749	Ga0501036_0008436	3300049572	Bacteria	8443
1750	Ga0501036_0195176	3300049572	Bacteria	1703
1751	Ga0501036_0438383	3300049572	Bacteria	1089
1752	Ga0501037_0631443	3300049573	Bacteria	717
1753	Ga0501038_0004809	3300049574	Bacteria	12547
1754	Ga0501039_0019287	3300049575	Bacteria	5230
1755	Ga0501040_0127845	3300049576	Bacteria	1785
1756	Ga0501040_0135139	3300049576	Bacteria	1736
1757	Ga0501041_0000302	3300049577	Bacteria	23917
1758	Ga0501041_0704741	3300049577	Unclassified	646
1759	Ga0501041_1135908	3300049577	Bacteria	504
1760	Ga0501042_0007134	3300049578	Bacteria	7308
1761	Ga0501043_0055950	3300049579	Bacteria	3099
1762	Ga0501043_0594657	3300049579	Bacteria	818
1763	Ga0501046_0012089	3300049580	Bacteria	7361
1764	Ga0501046_0487196	3300049580	Bacteria	884
1765	Ga0501047_0055079	3300049581	Bacteria	3846
1766	Ga0501047_1409531	3300049581	Bacteria	512
1767	Ga0501048_0001369	3300049582	Bacteria	18445
1768	Ga0501067_0014736	3300049583	Bacteria	4325
1769	Ga0501067_0030923	3300049583	Bacteria	2970
1770	Ga0501067_0037266	3300049583	Bacteria	2701
1771	Ga0501067_0040018	3300049583	Bacteria	2603
1772	Ga0501067_0045373	3300049583	Bacteria	2441
1773	Ga0501067_0153364	3300049583	Bacteria	1283
1774	Ga0501067_0298075	3300049583	Bacteria	898
1775	Ga0501068_0090949	3300049584	Bacteria	1883
1776	Ga0501068_0191252	3300049584	Bacteria	1296
1777	Ga0501068_0487202	3300049584	Bacteria	799
1778	Ga0501069_0002785	3300049585	Bacteria	8935
1779	Ga0501069_0016779	3300049585	Bacteria	3934
1780	Ga0501069_0050799	3300049585	Bacteria	2306
1781	Ga0501069_0061317	3300049585	Bacteria	2100
1782	Ga0501069_0069447	3300049585	Bacteria	1972
1783	Ga0501069_0076083	3300049585	Bacteria	1887
1784	Ga0501069_0102592	3300049585	Bacteria	1624
1785	Ga0501069_0192856	3300049585	Bacteria	1179
1786	Ga0501069_0282550	3300049585	Archaea	971
1787	Ga0501069_0425071	3300049585	Bacteria	788
1788	Ga0501070_0000729	3300049586	Bacteria	30064
1789	Ga0501070_0103148	3300049586	Bacteria	2359
1790	Ga0501070_0171232	3300049586	Bacteria	1788
1791	Ga0501071_0003170	3300049587	Bacteria	10227
1792	Ga0501071_1577349	3300049587	Unclassified	507
1793	Ga0501072_0004402	3300049588	Bacteria	10695
1794	Ga0501072_0119923	3300049588	Bacteria	2096
1795	Ga0501072_0335419	3300049588	Bacteria	1201
1796	Ga0501072_0695271	3300049588	Bacteria	799
1797	Ga0501073_1017479	3300049589	Bacteria	570
1798	Ga0501073_1223734	3300049589	Bacteria	515
1799	Ga0501074_0089300	3300049590	Bacteria	2207
1800	Ga0501074_0091973	3300049590	Bacteria	2172
1801	Ga0501074_0331741	3300049590	Bacteria	1080
1802	Ga0501074_0357792	3300049590	Bacteria	1036
1803	Ga0501074_0419359	3300049590	Bacteria	949
1804	Ga0501075_0000959	3300049591	Bacteria	18370
1805	Ga0501075_0566206	3300049591	Bacteria	867
1806	Ga0501076_0004307	3300049592	Bacteria	10097
1807	Ga0501076_0863888	3300049592	Unclassified	746
1808	Ga0501076_1363744	3300049592	Unclassified	583
1809	Ga0501077_0010956	3300049593	Bacteria	5652
1810	Ga0501079_0009625	3300049741	Bacteria	7329
1811	Ga0501079_0471138	3300049741	Bacteria	987
1812	Ga0501080_0049250	3300049742	Bacteria	3922
1813	Ga0501080_0067595	3300049742	Bacteria	3324
1814	Ga0501080_0257935	3300049742	Bacteria	1589
1815	Ga0501080_0501172	3300049742	Bacteria	1085
1816	Ga0501080_0983023	3300049742	Unclassified	733
1817	Ga0501081_0000989	3300049743	Bacteria	16907
1818	Ga0501081_0090594	3300049743	Bacteria	2150
1819	Ga0501083_0105254	3300049744	Bacteria	1858
1820	Ga0501035_0396983	3300049822	Bacteria	1148
1821	Ga0501044_0307783	3300049823	Bacteria	1512
1822	Ga0501044_0634268	3300049823	Bacteria	959
1823	Ga0501044_0977656	3300049823	Bacteria	719
1824	Ga0501045_0002386	3300049824	Bacteria	12754
1825	nmdc:mga03n38_681882_c1	3300050490	Bacteria	591
1826	nmdc:mga0yw44_640888_c1	3300050492	Unclassified	722
1827	nmdc:mga06z11_195115_c1	3300050494	Bacteria	1173
1828	nmdc:mga05p37_118275_c1	3300050507	Unclassified	3257
1829	nmdc:mga05p37_12268_c1	3300050507	Bacteria	10232
1830	nmdc:mga05p37_159419_c1	3300050507	Unclassified	2756
1831	nmdc:mga05p37_164097_c1	3300050507	Bacteria	2712
1832	nmdc:mga05p37_49820_c1	3300050507	Bacteria	5151
1833	nmdc:mga05p37_6657_c1	3300050507	Bacteria	13632
1834	nmdc:mga05p37_776266_c1	3300050507	Bacteria	713
1835	nmdc:mga09592_289881_c1	3300050508	Unclassified	1419
1836	nmdc:mga0qj67_300686_c1	3300050509	Unclassified	1300
1837	nmdc:mga0qj67_853115_c1	3300050509	Archaea	719
1838	nmdc:mga06r32_18459_c1	3300050510	Bacteria	6385
1839	nmdc:mga06r32_191548_c1	3300050510	Bacteria	2032
1840	nmdc:mga06r32_275439_c1	3300050510	Bacteria	1670
1841	nmdc:mga06r32_59466_c1	3300050510	Bacteria	3675
1842	nmdc:mga08y16_18152_c1	3300050511	Bacteria	7412
1843	nmdc:mga08y16_522012_c1	3300050511	Bacteria	1204
1844	nmdc:mga08y16_970043_c1	3300050511	Bacteria	832
1845	nmdc:mga0n895_120080_c1	3300050512	Bacteria	2650
1846	nmdc:mga0n895_1411302_c1	3300050512	Unclassified	665
1847	nmdc:mga0n895_1571600_c1	3300050512	Bacteria	623
1848	nmdc:mga0n895_214513_c1	3300050512	Unclassified	1955
1849	nmdc:mga0n895_270857_c1	3300050512	Bacteria	1722
1850	nmdc:mga0n895_328198_c1	3300050512	Bacteria	1550
1851	nmdc:mga0n895_42896_c1	3300050512	Bacteria	4405
1852	nmdc:mga0n895_501994_c1	3300050512	Bacteria	1222
1853	nmdc:mga0n895_5894_c1	3300050512	Bacteria	10299
1854	nmdc:mga0n895_9854_c1	3300050512	Bacteria	8401
1855	nmdc:mga0rr50_11436_c1	3300050513	Bacteria	5684
1856	nmdc:mga0rr50_1893640_c1	3300050513	Bacteria	501
1857	nmdc:mga0rr50_275658_c1	3300050513	Bacteria	1403
1858	nmdc:mga0rr50_330744_c1	3300050513	Bacteria	1279
1859	nmdc:mga0rr50_38426_c1	3300050513	Bacteria	3464
1860	nmdc:mga0rr50_4300_c1	3300050513	Bacteria	8342
1861	nmdc:mga0rr50_674083_c1	3300050513	Unclassified	882
1862	nmdc:mga08x19_14444_c1	3300050514	Bacteria	4789
1863	nmdc:mga08x19_168080_c1	3300050514	Bacteria	1492
1864	nmdc:mga08x19_36342_c1	3300050514	Bacteria	3120
1865	nmdc:mga08x19_3892_c1	3300050514	Bacteria	8882
1866	nmdc:mga08x19_429911_c1	3300050514	Bacteria	928
1867	nmdc:mga08x19_467351_c1	3300050514	Bacteria	889
1868	nmdc:mga08x19_50751_c1	3300050514	Bacteria	2662
1869	nmdc:mga08x19_96620_c1	3300050514	Bacteria	1956
1870	nmdc:mga0a205_11170_c1	3300050515	Bacteria	8265
1871	nmdc:mga0a205_1405033_c1	3300050515	Bacteria	546
1872	nmdc:mga0a205_143601_c1	3300050515	Bacteria	2287
1873	nmdc:mga0a205_292_c1	3300050515	Bacteria	29895
1874	nmdc:mga0a205_39972_c1	3300050515	Bacteria	4516
1875	Ga0495601_0045972	3300053077	Bacteria	2747
1876	Ga0495601_0222158	3300053077	Bacteria	1234
1877	Ga0495601_0489131	3300053077	Bacteria	794
1878	Ga0495601_0980708	3300053077	Bacteria	532
1879	Ga0495612_0145827	3300053078	Bacteria	1028
1880	Ga0495612_0251331	3300053078	Bacteria	786
1881	Ga0495655_0155088	3300053083	Bacteria	723
1882	Ga0495595_0034211	3300053084	Bacteria	2297
1883	Ga0495595_0067234	3300053084	Bacteria	1689
1884	Ga0495595_0192857	3300053084	Bacteria	1013
1885	Ga0495619_0037854	3300053085	Bacteria	3145
1886	Ga0495619_0119463	3300053085	Bacteria	1806
1887	Ga0495619_0159403	3300053085	Bacteria	1558
1888	Ga0495619_0398759	3300053085	Bacteria	950
1889	Ga0495619_0601180	3300053085	Unclassified	753
1890	Ga0495619_1019987	3300053085	Unclassified	553
1891	Ga0501084_0002494	3300054114	Bacteria	14815
1892	Ga0501084_0022121	3300054114	Bacteria	5304
1893	Ga0501084_0355389	3300054114	Bacteria	1238
1894	Ga0501084_0850106	3300054114	Unclassified	768
1895	Ga0501084_1007785	3300054114	Unclassified	700
1896	Ga0590075_094863	3300059424	Bacteria	775
1897	Ga0590077_014768	3300059426	Bacteria	1628
1898	Ga0587091_238462	3300059511	Bacteria	505
1899	Ga0501082_0105250	3300060353	Bacteria	2441
1900	Ga0501082_1159121	3300060353	Unclassified	676
1901	Ga0466962_0000378	3300061719	Bacteria	19231
1902	Ga0466962_0048829	3300061719	Bacteria	2022
1903	Ga0466962_0069596	3300061719	Bacteria	1680
1904	Ga0530510_0001957	3300061734	Bacteria	14103
1905	Ga0530510_0091576	3300061734	Bacteria	2219
1906	Ga0530510_0103473	3300061734	Bacteria	2082
1907	Ga0530510_0188225	3300061734	Bacteria	1532
1908	Ga0530510_0262617	3300061734	Bacteria	1288
1909	Ga0530510_1024223	3300061734	Unclassified	632
1910	Ga0530510_1172568	3300061734	Bacteria	589
1911	Ga0530510_1568642	3300061734	Unclassified	506
1912	Ga0105241_12408179
1913	JGI24747J21853_1023008
1914	rootH1_10095669
1915	JGI25404J52841_10021458
1916	Ga0070658_10009506
1917	Ga0070658_10336322
1918	Ga0070658_10404599
1919	Ga0070658_11296507
1920	Ga0070676_11205942
1921	Ga0070676_11293623
1922	Ga0070676_11343178
1923	Ga0070683_100000523
1924	Ga0070683_100009157
1925	Ga0070683_100041671
1926	Ga0070683_100075581
1927	Ga0070683_100082914
1928	Ga0070683_100088974
1929	Ga0070683_100248471
1930	Ga0070683_100301442
1931	Ga0070683_100345724
1932	Ga0070683_101359673
1933	Ga0070683_101988754
1934	Ga0070690_100057143
1935	Ga0070690_101192268
1936	Ga0070677_10658311
1937	Ga0068869_100123677
1938	Ga0068869_100912576
1939	Ga0070666_10075174
1940	Ga0070666_10449620
1941	Ga0070666_10475180
1942	Ga0070680_100010010
1943	Ga0070680_100063065
1944	Ga0070680_100097834
1945	Ga0070680_100117711
1946	Ga0070680_100173956
1947	Ga0070680_100444198
1948	Ga0070680_100570134
1949	Ga0070682_100054940
1950	Ga0070682_100071151
1951	Ga0070682_100081989
1952	Ga0070682_100129479
1953	Ga0070682_100926706
1954	Ga0068868_100110077
1955	Ga0068868_100480488
1956	Ga0068868_100600394
1957	Ga0068868_101425311
1958	Ga0068868_101617723
1959	Ga0070660_100006456
1960	Ga0070660_100041776
1961	Ga0070660_100113166
1962	Ga0070660_100147438
1963	Ga0070660_100211859
1964	Ga0070660_100281989
1965	Ga0070660_100386563
1966	Ga0070689_100203518
1967	Ga0070689_100302479
1968	Ga0070691_10236927
1969	Ga0070691_10306786
1970	Ga0070691_10700854
1971	Ga0070687_100083971
1972	Ga0070687_100540861
1973	Ga0070661_100227156
1974	Ga0070661_100567675
1975	Ga0070661_100599260
1976	Ga0070661_100959211
1977	Ga0070692_10080600
1978	Ga0070692_10332728
1979	Ga0070692_10553813
1980	Ga0070668_100008802
1981	Ga0070668_100068976
1982	Ga0070668_100382669
1983	Ga0070668_100417251
1984	Ga0070668_101113854
1985	Ga0070669_100084021
1986	Ga0070669_100399136
1987	Ga0070671_100158555
1988	Ga0070671_100269660
1989	Ga0070671_100311154
1990	Ga0070671_100586720
1991	Ga0070671_100818257
1992	Ga0070671_102046437
1993	Ga0070674_100040202
1994	Ga0070674_100271402
1995	Ga0070674_101017598
1996	Ga0070674_101293751
1997	Ga0070674_101374208
1998	Ga0070673_100170671
1999	Ga0070673_100354111
2000	Ga0070673_101323817
2001	Ga0070673_101547185
2002	Ga0070688_100078117
2003	Ga0070688_100508417
2004	Ga0070688_100676921
2005	Ga0070688_101389314
2006	Ga0070659_100008088
2007	Ga0070659_100148082
2008	Ga0070659_100175747
2009	Ga0070659_100199290
2010	Ga0070659_100531654
2011	Ga0070667_100007872
2012	Ga0070703_10022773
2013	Ga0070703_10076387
2014	Ga0070709_10013768
2015	Ga0070709_10053705
2016	Ga0070709_10084542
2017	Ga0070709_10157128
2018	Ga0070709_10189194
2019	Ga0070709_10554671
2020	Ga0070714_100018892
2021	Ga0070714_100059592
2022	Ga0070714_100101727
2023	Ga0070714_100103832
2024	Ga0070714_100179929
2025	Ga0070714_100329406
2026	Ga0070714_100344571
2027	Ga0070714_100402142
2028	Ga0070714_100456995
2029	Ga0070714_100900630
2030	Ga0070714_100911139
2031	Ga0070714_101517046
2032	Ga0070713_100017522
2033	Ga0070713_100024336
2034	Ga0070713_100172262
2035	Ga0070713_100227718
2036	Ga0070713_100377168
2037	Ga0070713_100543369
2038	Ga0070713_100570413
2039	Ga0070713_101628196
2040	Ga0070713_101871684
2041	Ga0070710_10075557
2042	Ga0070710_10096594
2043	Ga0070710_10379451
2044	Ga0070710_10961066
2045	Ga0070701_10186184
2046	Ga0070701_10697237
2047	Ga0070701_10952605
2048	Ga0070711_100046539
2049	Ga0070711_100287137
2050	Ga0070711_100384501
2051	Ga0070711_100386646
2052	Ga0070711_100451817
2053	Ga0070711_100459604
2054	Ga0070711_100620694
2055	Ga0070711_100632388
2056	Ga0070711_101810476
2057	Ga0070705_100003732
2058	Ga0070705_100024018
2059	Ga0070705_100027582
2060	Ga0070705_100107539
2061	Ga0070705_100143857
2062	Ga0070705_100241853
2063	Ga0070705_100341689
2064	Ga0070700_100003754
2065	Ga0070700_100217213
2066	Ga0070700_100883226
2067	Ga0070694_100006955
2068	Ga0070694_100016424
2069	Ga0070694_100365309
2070	Ga0070694_100422806
2071	Ga0070694_100460963
2072	Ga0070694_100556864
2073	Ga0070708_100019342
2074	Ga0070708_100036259
2075	Ga0070708_100144787
2076	Ga0070708_100306568
2077	Ga0070708_100415060
2078	Ga0070708_100571914
2079	Ga0070708_101194154
2080	Ga0070663_100071890
2081	Ga0070678_100009863
2082	Ga0070678_100050199
2083	Ga0070678_100154318
2084	Ga0070678_100264504
2085	Ga0070678_100360384
2086	Ga0070678_101765938
2087	Ga0070678_102120611
2088	Ga0070662_100022582
2089	Ga0070662_100024496
2090	Ga0070662_100396268
2091	Ga0070662_101533375
2092	Ga0070681_10019930
2093	Ga0070681_10047248
2094	Ga0070681_10055700
2095	Ga0070681_10095156
2096	Ga0070681_10461469
2097	Ga0070681_10666480
2098	Ga0070681_10705760
2099	Ga0068867_100063199
2100	Ga0068867_100219285
2101	Ga0068867_100622263
2102	Ga0068867_102187901
2103	Ga0070685_10038782
2104	Ga0070685_10980774
2105	Ga0070706_100027782
2106	Ga0070706_100033677
2107	Ga0070706_100233538
2108	Ga0070706_100298356
2109	Ga0070706_100498596
2110	Ga0070706_100710947
2111	Ga0070706_100822449
2112	Ga0070707_100020563
2113	Ga0070707_100029981
2114	Ga0070707_100125358
2115	Ga0070707_100260660
2116	Ga0070707_100644830
2117	Ga0070707_100664723
2118	Ga0070707_101256437
2119	Ga0070698_100014108
2120	Ga0070698_100112573
2121	Ga0070698_100218957
2122	Ga0070698_100246467
2123	Ga0070698_100819948
2124	Ga0070699_100070169
2125	Ga0070699_100085645
2126	Ga0070699_100154863
2127	Ga0070699_100260874
2128	Ga0070699_101017350
2129	Ga0070679_100002176
2130	Ga0070679_100038811
2131	Ga0070679_100051462
2132	Ga0070679_100066844
2133	Ga0070679_100085488
2134	Ga0070679_100155914
2135	Ga0070679_100166100
2136	Ga0070679_100475771
2137	Ga0070679_100925335
2138	Ga0070679_101244656
2139	Ga0070684_100004398
2140	Ga0070684_100007842
2141	Ga0070684_100012575
2142	Ga0070684_100030405
2143	Ga0070684_100048453
2144	Ga0070684_100065555
2145	Ga0070684_100101106
2146	Ga0070684_100204352
2147	Ga0070684_100933287
2148	Ga0070684_101083232
2149	Ga0070684_101402510
2150	Ga0070697_100026565
2151	Ga0070697_100092559
2152	Ga0070697_100142130
2153	Ga0070697_100948871
2154	Ga0070697_100951477
2155	Ga0068853_100132508
2156	Ga0068853_100242748
2157	Ga0068853_100498514
2158	Ga0070672_100342653
2159	Ga0070672_100401560
2160	Ga0070686_100076411
2161	Ga0070686_100093834
2162	Ga0070686_100098681
2163	Ga0070686_100142640
2164	Ga0070686_100143324
2165	Ga0070686_101243504
2166	Ga0070695_100391681
2167	Ga0070696_100013955
2168	Ga0070696_100014346
2169	Ga0070696_100300111
2170	Ga0070696_100302290
2171	Ga0070696_100466581
2172	Ga0070693_100038053
2173	Ga0070693_100073761
2174	Ga0070693_100291545
2175	Ga0070693_100300054
2176	Ga0070693_100584735
2177	Ga0070665_100049475
2178	Ga0070665_101697643
2179	Ga0070704_100007670
2180	Ga0070704_100063059
2181	Ga0070704_100106552
2182	Ga0070704_100410275
2183	Ga0070704_100517826
2184	Ga0070704_100811672
2185	Ga0070704_101063568
2186	Ga0068855_100001318
2187	Ga0068855_100016339
2188	Ga0068855_100020461
2189	Ga0068855_100046067
2190	Ga0068855_100150744
2191	Ga0068855_100244346
2192	Ga0068855_100256970
2193	Ga0068855_100323312
2194	Ga0068855_100588221
2195	Ga0068855_100924253
2196	Ga0068855_100994324
2197	Ga0070664_100009360
2198	Ga0070664_100054229
2199	Ga0070664_100167473
2200	Ga0068857_100003052
2201	Ga0068857_100017539
2202	Ga0068857_100066279
2203	Ga0068857_100071689
2204	Ga0068857_100468237
2205	Ga0068857_101459816
2206	Ga0068854_100234216
2207	Ga0068854_100706644
2208	Ga0068856_100027335
2209	Ga0068856_100091211
2210	Ga0068856_100130676
2211	Ga0068856_100161025
2212	Ga0068856_100189480
2213	Ga0068856_100333576
2214	Ga0068856_100352694
2215	Ga0068856_100801404
2216	Ga0068856_101242640
2217	Ga0068856_101408454
2218	Ga0068856_101801966
2219	Ga0070702_100082668
2220	Ga0070702_100090818
2221	Ga0070702_100143351
2222	Ga0070702_100711363
2223	Ga0070702_101221462
2224	Ga0068852_100014829
2225	Ga0068852_100980339
2226	Ga0068859_100875185
2227	Ga0068859_100890577
2228	Ga0068864_100181855
2229	Ga0068864_100333355
2230	Ga0068864_100597891
2231	Ga0068864_101393148
2232	Ga0068864_101540093
2233	Ga0068866_10110321
2234	Ga0068866_10123626
2235	Ga0068861_100011239
2236	Ga0068861_100084461
2237	Ga0068861_100234869
2238	Ga0068851_10640910
2239	Ga0068870_10050805
2240	Ga0068870_10115439
2241	Ga0068870_10146176
2242	Ga0068870_10298715
2243	Ga0068863_100470902
2244	Ga0068863_101719264
2245	Ga0068863_101884056
2246	Ga0068858_100243159
2247	Ga0068858_100458434
2248	Ga0068858_101087675
2249	Ga0068858_101115189
2250	Ga0068860_100173793
2251	Ga0068860_100255293
2252	Ga0068860_101508180
2253	Ga0068862_100034106
2254	Ga0068862_100754744
2255	Ga0081455_10008468
2256	Ga0081455_10288718
2257	Ga0081538_10200632
2258	Ga0081540_1000590
2259	Ga0081540_1001254
2260	Ga0081540_1055287
2261	Ga0081539_10171408
2262	Ga0081539_10202245
2263	Ga0070717_10041958
2264	Ga0070717_10052460
2265	Ga0070717_10066197
2266	Ga0070717_10069495
2267	Ga0070717_10082334
2268	Ga0070717_10096383
2269	Ga0070717_10207375
2270	Ga0070717_10228440
2271	Ga0070717_10699674
2272	Ga0070717_10702120
2273	Ga0070717_10720214
2274	Ga0070717_10724787
2275	Ga0070717_11439473
2276	Ga0070717_11735287
2277	Ga0075365_10420319
2278	Ga0075364_10854446
2279	Ga0075432_10024612
2280	Ga0075432_10048617
2281	Ga0075432_10262293
2282	Ga0070715_10062297
2283	Ga0070715_10116667
2284	Ga0070716_100051012
2285	Ga0070716_100217268
2286	Ga0070716_100447328
2287	Ga0070716_100649199
2288	Ga0070716_101100289
2289	Ga0070712_100038563
2290	Ga0070712_100059432
2291	Ga0070712_100066500
2292	Ga0070712_100076067
2293	Ga0070712_100086588
2294	Ga0070712_100087606
2295	Ga0070712_100176265
2296	Ga0070712_100188124
2297	Ga0070712_100368816
2298	Ga0070712_100395229
2299	Ga0070712_101506874
2300	Ga0070712_101855356
2301	Ga0097621_100124759
2302	Ga0097621_100716571
2303	Ga0097621_101418969
2304	Ga0068871_100212915
2305	Ga0068871_100239029
2306	Ga0068871_100546478
2307	Ga0068871_100923291
2308	Ga0068871_101296160
2309	Ga0068871_102068538
2310	Ga0075428_100017889
2311	Ga0075428_100370076
2312	Ga0075428_100861582
2313	Ga0075430_100219807
2314	Ga0075430_100307537
2315	Ga0075431_100165950
2316	Ga0075431_100222421
2317	Ga0075431_100294447
2318	Ga0075431_100323753
2319	Ga0075433_10010135
2320	Ga0075433_10165470
2321	Ga0075433_10212906
2322	Ga0075433_10273154
2323	Ga0075433_11219157
2324	Ga0075434_100015798
2325	Ga0075434_100015868
2326	Ga0075434_100036036
2327	Ga0075434_100104107
2328	Ga0075434_100110662
2329	Ga0075434_100207461
2330	Ga0075434_100530355
2331	Ga0075434_100647452
2332	Ga0075434_100685289
2333	Ga0075434_101366149
2334	Ga0075429_100186049
2335	Ga0068865_100012932
2336	Ga0068865_100142837
2337	Ga0068865_100847274
2338	Ga0075436_100007098
2339	Ga0075436_100016739
2340	Ga0075436_100028265
2341	Ga0075436_100061396
2342	Ga0075436_100074274
2343	Ga0075436_100266501
2344	Ga0075436_100694288
2345	Ga0097620_100875229
2346	Ga0097620_100890429
2347	Ga0075435_100001046
2348	Ga0075435_100006265
2349	Ga0075435_100016752
2350	Ga0075435_100085456
2351	Ga0075435_101032913
2352	Ga0075435_101044799
2353	Ga0075435_101251537
2354	Ga0099794_10636115
2355	Ga0105251_10566023
2356	Ga0105250_10139469
2357	Ga0105240_10037030
2358	Ga0105240_10125511
2359	Ga0105240_10234925
2360	Ga0105240_10296183
2361	Ga0105240_10462212
2362	Ga0105240_10871396
2363	Ga0105240_10920476
2364	Ga0105240_11219350
2365	Ga0111539_10039025
2366	Ga0111539_10505758
2367	Ga0111539_10914744
2368	Ga0111539_10923311
2369	Ga0111539_12967722
2370	Ga0111539_13230618
2371	Ga0111539_13504609
2372	Ga0105245_10005664
2373	Ga0105245_10050690
2374	Ga0105245_10060517
2375	Ga0105245_10251265
2376	Ga0105245_10255600
2377	Ga0105245_10272032
2378	Ga0105245_10429953
2379	Ga0105245_10444987
2380	Ga0105245_10874888
2381	Ga0105245_11102155
2382	Ga0105245_12169829
2383	Ga0105247_10466130
2384	Ga0105247_10695488
2385	Ga0105247_10927721
2386	Ga0114129_10005393
2387	Ga0114129_10014330
2388	Ga0114129_10021521
2389	Ga0114129_10320552
2390	Ga0114129_10375213
2391	Ga0114129_11558758
2392	Ga0114129_11668245
2393	Ga0105243_10013481
2394	Ga0105243_10045390
2395	Ga0105243_10047725
2396	Ga0105243_10070224
2397	Ga0105243_10072695
2398	Ga0105243_10159705
2399	Ga0105243_10200484
2400	Ga0105243_10298879
2401	Ga0105243_10477304
2402	Ga0105243_11137716
2403	Ga0105243_11261390
2404	Ga0105243_12072950
2405	Ga0105243_12196207
2406	Ga0105243_12312822
2407	Ga0105241_10105504
2408	Ga0105241_10124047
2409	Ga0105241_10208932
2410	Ga0105241_10401135
2411	Ga0105241_10441493
2412	Ga0105241_10450983
2413	Ga0105242_10127621
2414	Ga0105242_10193660
2415	Ga0105242_10226867
2416	Ga0105242_10312144
2417	Ga0105242_10347608
2418	Ga0105242_10430680
2419	Ga0105242_10523775
2420	Ga0105242_10615221
2421	Ga0105242_11548776
2422	Ga0105242_11954493
2423	Ga0105248_10668821
2424	Ga0105248_11117863
2425	Ga0105248_11181875
2426	Ga0105248_11488600
2427	Ga0105237_10048627
2428	Ga0105237_10083936
2429	Ga0105237_10094168
2430	Ga0105237_10738182
2431	Ga0105237_11442557
2432	Ga0105237_11596087
2433	Ga0105237_11902750
2434	Ga0105238_10470718
2435	Ga0105238_10929937
2436	Ga0105238_11610160
2437	Ga0105249_10006017
2438	Ga0105249_10708130
2439	Ga0105249_11147554
2440	Ga0099796_10423059
2441	Ga0105239_10064809
2442	Ga0105239_10108699
2443	Ga0105239_10176479
2444	Ga0105239_10222292
2445	Ga0105239_10319356
2446	Ga0105239_10378905
2447	Ga0105239_10771102
2448	Ga0105239_11030747
2449	Ga0105239_11465270
2450	Ga0105239_12023356
2451	Ga0105239_12192547
2452	Ga0105246_10039671
2453	Ga0105246_10322572
2454	Ga0105246_10355778
2455	Ga0105246_10386168
2456	Ga0105246_10471107
2457	Ga0157344_1026555
2458	Ga0157346_1012411
2459	Ga0157318_1006667
2460	Ga0157337_1033438
2461	Ga0157343_1023246
2462	Ga0157335_1014438
2463	Ga0157323_1029068
2464	Ga0157347_1068440
2465	Ga0157327_1003085
2466	Ga0157371_10484932
2467	Ga0157371_10624744
2468	Ga0157371_11322045
2469	Ga0157371_11542781
2470	Ga0157370_10031927
2471	Ga0157370_10045914
2472	Ga0157370_10049951
2473	Ga0157370_10055761
2474	Ga0157370_10145472
2475	Ga0157370_10739647
2476	Ga0157369_10051991
2477	Ga0157369_10143037
2478	Ga0157369_10205262
2479	Ga0157369_10238659
2480	Ga0157369_10495856
2481	Ga0157374_10018647
2482	Ga0157374_10575338
2483	Ga0157374_10888418
2484	Ga0157374_11437191
2485	Ga0157378_10169406
2486	Ga0157378_10943374
2487	Ga0157378_11395209
2488	Ga0157378_11695294
2489	Ga0157378_11696301
2490	Ga0163162_10076626
2491	Ga0163162_10187999
2492	Ga0163162_10601473
2493	Ga0157372_10067977
2494	Ga0157372_10224927
2495	Ga0157372_10598949
2496	Ga0157372_10798933
2497	Ga0157375_10021076
2498	Ga0157375_10075348
2499	Ga0157375_10233076
2500	Ga0157375_10522510
2501	Ga0157375_10542834
2502	Ga0157375_10640161
2503	Ga0157375_10650498
2504	Ga0157375_12309760
2505	Ga0163163_10121140
2506	Ga0163163_10192131
2507	Ga0163163_10450828
2508	Ga0163163_11094753
2509	Ga0163163_11413268
2510	Ga0157380_10259866
2511	Ga0157380_10360179
2512	Ga0157380_10515010
2513	Ga0157380_10991715
2514	Ga0157380_11910999
2515	Ga0182008_10051970
2516	Ga0182008_10132578
2517	Ga0182008_10168170
2518	Ga0182008_10223509
2519	Ga0157377_10074746
2520	Ga0157377_10503630
2521	Ga0157377_10649220
2522	Ga0157377_11487074
2523	Ga0157379_10382484
2524	Ga0157379_10685049
2525	Ga0157379_12334976
2526	Ga0157376_10192603
2527	Ga0157376_10400782
2528	Ga0157376_10724162
2529	Ga0182006_1193313
2530	Ga0163161_10015754
2531	Ga0163161_10200093
2532	Ga0163161_10770822
2533	Ga0197907_10974813
2534	Ga0206356_10019179
2535	Ga0206356_10466495
2536	Ga0206356_10528364
2537	Ga0206356_10753970
2538	Ga0206356_11848280
2539	Ga0206356_11900485
2540	Ga0206355_1228152
2541	Ga0206352_10999200
2542	Ga0206350_10516667
2543	Ga0206354_10421540
2544	Ga0206354_10496823
2545	Ga0206354_11109982
2546	Ga0206353_10700471
2547	Ga0206353_10959294
2548	Ga0206353_11494663
2549	Ga0206353_11682805
2550	Ga0154015_1196527
2551	Ga0154015_1578235
2552	Ga0213873_10069372
2553	Ga0213874_10049470
2554	Ga0213876_10208238
2555	Ga0224712_10097784
2556	Ga0224712_10127434
2557	Ga0224712_10283379
2558	Ga0224712_10561851
2559	Ga0207656_10053163
2560	Ga0207653_10001866
2561	Ga0207653_10002877
2562	Ga0207692_10008105
2563	Ga0207692_10028187
2564	Ga0207692_10134680
2565	Ga0207692_10226310
2566	Ga0207692_10433588
2567	Ga0207692_10534295
2568	Ga0207642_10083706
2569	Ga0207642_10097939
2570	Ga0207642_10629477
2571	Ga0207710_10342328
2572	Ga0207710_10619745
2573	Ga0207688_10018465
2574	Ga0207688_10043987
2575	Ga0207688_10141863
2576	Ga0207688_10282631
2577	Ga0207688_11006280
2578	Ga0207680_10281737
2579	Ga0207647_10440882
2580	Ga0207685_10009323
2581	Ga0207685_10070512
2582	Ga0207685_10135899
2583	Ga0207685_10642425
2584	Ga0207699_10010874
2585	Ga0207699_10119996
2586	Ga0207699_10145495
2587	Ga0207699_10161826
2588	Ga0207699_10280331
2589	Ga0207699_10348746
2590	Ga0207699_11022676
2591	Ga0207643_10087232
2592	Ga0207643_10112153
2593	Ga0207643_10177046
2594	Ga0207643_10289462
2595	Ga0207705_10019252
2596	Ga0207705_10034743
2597	Ga0207705_10332392
2598	Ga0207705_10446229
2599	Ga0207684_10024861
2600	Ga0207684_10167344
2601	Ga0207684_10207376
2602	Ga0207654_10068328
2603	Ga0207654_10084664
2604	Ga0207654_10131007
2605	Ga0207654_10241210
2606	Ga0207654_10590729
2607	Ga0207654_11059730
2608	Ga0207707_10019035
2609	Ga0207707_10024482
2610	Ga0207707_10037899
2611	Ga0207707_10052903
2612	Ga0207707_10065089
2613	Ga0207707_10096476
2614	Ga0207707_10208199
2615	Ga0207707_10288308
2616	Ga0207707_10402835
2617	Ga0207695_10034316
2618	Ga0207695_10198896
2619	Ga0207695_10351630
2620	Ga0207695_10409690
2621	Ga0207695_10556145
2622	Ga0207671_10280621
2623	Ga0207671_10319881
2624	Ga0207671_10633138
2625	Ga0207693_10001702
2626	Ga0207693_10008511
2627	Ga0207693_10022388
2628	Ga0207693_10046006
2629	Ga0207693_10070758
2630	Ga0207693_10085365
2631	Ga0207693_10096081
2632	Ga0207693_10102694
2633	Ga0207693_10106237
2634	Ga0207693_10153386
2635	Ga0207693_10161496
2636	Ga0207693_10171044
2637	Ga0207693_10399334
2638	Ga0207693_10462267
2639	Ga0207693_11129766
2640	Ga0207663_10003839
2641	Ga0207663_10023722
2642	Ga0207663_10041881
2643	Ga0207663_10088782
2644	Ga0207663_10198174
2645	Ga0207663_10227950
2646	Ga0207663_10756089
2647	Ga0207663_10842514
2648	Ga0207660_10010825
2649	Ga0207660_10097736
2650	Ga0207660_10208707
2651	Ga0207660_10890811
2652	Ga0207660_11070923
2653	Ga0207662_10552688
2654	Ga0207657_10000486
2655	Ga0207657_10020525
2656	Ga0207657_10029003
2657	Ga0207657_10069360
2658	Ga0207657_10211250
2659	Ga0207657_10243118
2660	Ga0207657_11187346
2661	Ga0207649_10020343
2662	Ga0207649_10234246
2663	Ga0207649_10428825
2664	Ga0207652_10024240
2665	Ga0207652_10148650
2666	Ga0207652_10187592
2667	Ga0207652_10587723
2668	Ga0207652_10638974
2669	Ga0207652_10722120
2670	Ga0207652_10726145
2671	Ga0207646_10019475
2672	Ga0207646_10077558
2673	Ga0207646_10091083
2674	Ga0207646_10242481
2675	Ga0207681_10067909
2676	Ga0207681_10470553
2677	Ga0207694_10028485
2678	Ga0207694_10294369
2679	Ga0207694_10888537
2680	Ga0207694_11039551
2681	Ga0207659_10325565
2682	Ga0207687_10004254
2683	Ga0207687_10058493
2684	Ga0207687_10113889
2685	Ga0207687_10146127
2686	Ga0207687_10176299
2687	Ga0207687_10275873
2688	Ga0207687_10833946
2689	Ga0207700_10000001
2690	Ga0207700_10047933
2691	Ga0207700_10061103
2692	Ga0207700_10192678
2693	Ga0207700_10356432
2694	Ga0207700_10398038
2695	Ga0207700_10472997
2696	Ga0207700_10488766
2697	Ga0207700_10708073
2698	Ga0207700_10885183
2699	Ga0207700_10911504
2700	Ga0207664_10024395
2701	Ga0207664_10029771
2702	Ga0207664_10065326
2703	Ga0207664_10065955
2704	Ga0207664_10132232
2705	Ga0207664_10133047
2706	Ga0207664_10210224
2707	Ga0207664_10337969
2708	Ga0207664_10493709
2709	Ga0207664_10508097
2710	Ga0207664_10726475
2711	Ga0207664_10842028
2712	Ga0207644_10122251
2713	Ga0207644_10507612
2714	Ga0207644_10588513
2715	Ga0207690_10047787
2716	Ga0207690_10050298
2717	Ga0207690_10671299
2718	Ga0207690_10779089
2719	Ga0207706_10015841
2720	Ga0207706_10017665
2721	Ga0207706_10054683
2722	Ga0207706_10201317
2723	Ga0207706_10699764
2724	Ga0207686_10187941
2725	Ga0207686_10304470
2726	Ga0207686_10372647
2727	Ga0207686_10377961
2728	Ga0207686_10949012
2729	Ga0207709_10015535
2730	Ga0207709_10140030
2731	Ga0207709_10168690
2732	Ga0207709_10503042
2733	Ga0207709_10795398
2734	Ga0207709_11765147
2735	Ga0207709_11769923
2736	Ga0207669_10169339
2737	Ga0207669_10236887
2738	Ga0207669_10695316
2739	Ga0207669_10935620
2740	Ga0207704_10204716
2741	Ga0207704_10297628
2742	Ga0207704_10748286
2743	Ga0207704_11366652
2744	Ga0207704_11388089
2745	Ga0207665_10006909
2746	Ga0207665_10007382
2747	Ga0207665_10008549
2748	Ga0207665_10020551
2749	Ga0207665_10198345
2750	Ga0207665_10560610
2751	Ga0207691_10323663
2752	Ga0207691_10811322
2753	Ga0207691_10850185
2754	Ga0207691_11074852
2755	Ga0207689_10273603
2756	Ga0207689_10610310
2757	Ga0207689_11239316
2758	Ga0207661_10034132
2759	Ga0207661_10054438
2760	Ga0207661_10055071
2761	Ga0207661_10087029
2762	Ga0207661_10133641
2763	Ga0207661_10193455
2764	Ga0207661_10382193
2765	Ga0207661_10940229
2766	Ga0207661_11731735
2767	Ga0207679_10019315
2768	Ga0207679_10101510
2769	Ga0207679_10214098
2770	Ga0207679_10588546
2771	Ga0207679_11120337
2772	Ga0207679_11852546
2773	Ga0207667_10033657
2774	Ga0207667_10052550
2775	Ga0207667_10093704
2776	Ga0207667_10120032
2777	Ga0207667_10162617
2778	Ga0207667_10209389
2779	Ga0207667_10323170
2780	Ga0207667_10367618
2781	Ga0207667_10488163
2782	Ga0207667_11516923
2783	Ga0207651_10184902
2784	Ga0207651_10366202
2785	Ga0207712_10015044
2786	Ga0207712_10103593
2787	Ga0207712_10387120
2788	Ga0207712_11706340
2789	Ga0207668_10011409
2790	Ga0207668_10254655
2791	Ga0207668_10444041
2792	Ga0207668_11538079
2793	Ga0207668_11626459
2794	Ga0207668_11890381
2795	Ga0207640_10745180
2796	Ga0207640_10746621
2797	Ga0207640_11308970
2798	Ga0207658_10020350
2799	Ga0207658_11072635
2800	Ga0207677_10015921
2801	Ga0207677_10176005
2802	Ga0207677_10694713
2803	Ga0207677_10853475
2804	Ga0207677_11579061
2805	Ga0207703_10213799
2806	Ga0207703_10527194
2807	Ga0207703_10691683
2808	Ga0207703_11962184
2809	Ga0207639_10194243
2810	Ga0207678_10077817
2811	Ga0207678_10286144
2812	Ga0207678_11346924
2813	Ga0207708_10007846
2814	Ga0207708_10062648
2815	Ga0207708_10113738
2816	Ga0207708_11023482
2817	Ga0207702_10019475
2818	Ga0207702_10046950
2819	Ga0207702_10168557
2820	Ga0207702_10169868
2821	Ga0207702_10175752
2822	Ga0207702_10180710
2823	Ga0207702_10729753
2824	Ga0207702_11582796
2825	Ga0207702_12016608
2826	Ga0207702_12323859
2827	Ga0207648_10025309
2828	Ga0207648_10233020
2829	Ga0207648_10318116
2830	Ga0207648_10487025
2831	Ga0207648_11290594
2832	Ga0207676_10194178
2833	Ga0207676_10312176
2834	Ga0207676_10455555
2835	Ga0207674_10006401
2836	Ga0207674_10018554
2837	Ga0207674_10055428
2838	Ga0207674_10118840
2839	Ga0207674_10432115
2840	Ga0207674_10691849
2841	Ga0207674_11498837
2842	Ga0207674_11694651
2843	Ga0207675_100000456
2844	Ga0207675_100027462
2845	Ga0207675_100041096
2846	Ga0207675_100133303
2847	Ga0207675_101991972
2848	Ga0207683_10008677
2849	Ga0207683_10129968
2850	Ga0207683_10182679
2851	Ga0207683_10227881
2852	Ga0207683_10266845
2853	Ga0207683_10609437
2854	Ga0207683_10821772
2855	Ga0207683_11009747
2856	Ga0207698_10009525
2857	Ga0207698_10043186
2858	Ga0207698_10522411
2859	Ga0207698_10699441
2860	Ga0207698_11753808
2861	Ga0207428_10098665
2862	Ga0207428_10230385
2863	Ga0207428_11054577
2864	Ga0207428_11237744
2865	Ga0268266_10049246
2866	Ga0268266_10544619
2867	Ga0268266_10995896
2868	Ga0268265_10220518
2869	Ga0268265_10417212
2870	Ga0268265_10796555
2871	Ga0268264_10680413
2872	Ga0268264_10921257
2873	Ga0268264_11119527
2874	Ga0268264_11542297
2875	Ga0268264_12058820
2876	Ga0265337_1024713
2877	Ga0265326_10012763
2878	Ga0265326_10107237
2879	Ga0265319_1001553
2880	Ga0265319_1043575
2881	Ga0265334_10001519
2882	Ga0265334_10249635
2883	Ga0265318_10000286
2884	Ga0265318_10003745
2885	Ga0265318_10081970
2886	Ga0265318_10100317
2887	Ga0265318_10203192
2888	Ga0265323_10039216
2889	Ga0265322_10002000
2890	Ga0265336_10030818
2891	Ga0265336_10032603
2892	Ga0265338_10004064
2893	Ga0265338_10004582
2894	Ga0265338_10029019
2895	Ga0265338_10057309
2896	Ga0265338_10074499
2897	Ga0265338_10967195
2898	Ga0265330_10000170
2899	Ga0265330_10055589
2900	Ga0265332_10053278
2901	Ga0265332_10165449
2902	Ga0265328_10000396
2903	Ga0265320_10004950
2904	Ga0265320_10011270
2905	Ga0265320_10073140
2906	Ga0265325_10000058
2907	Ga0265325_10026134
2908	Ga0265325_10340994
2909	Ga0265329_10002680
2910	Ga0265340_10008073
2911	Ga0265339_10001168
2912	Ga0265339_10002081
2913	Ga0265339_10114179
2914	Ga0265331_10000568
2915	Ga0265331_10111058
2916	Ga0265331_10265497
2917	Ga0265327_10002315
2918	Ga0265327_10002769
2919	Ga0265327_10242643
2920	Ga0265316_10000700
2921	Ga0265316_10187809
2922	Ga0265316_10363297
2923	Ga0307408_100674006
2924	Ga0265313_10000754
2925	Ga0265313_10018405
2926	Ga0265314_10000982
2927	Ga0265314_10052402
2928	Ga0265342_10001473
2929	Ga0307413_10081243
2930	Ga0307413_11954195
2931	Ga0307410_11414056
2932	Ga0307406_10574494
2933	Ga0307407_10871817
2934	Ga0307412_11580603
2935	Ga0307409_100043167
2936	Ga0307409_100935893
2937	Ga0307416_100300162
2938	Ga0307416_100307840
2939	Ga0307416_100359645
2940	Ga0307416_100708228
2941	Ga0307416_101832574
2942	Ga0307416_102393278
2943	Ga0307411_11328095
2944	Ga0307415_100220495
2945	Ga0307415_100272992
2946	Ga0373930_0012464
2947	Ga0373948_0027660
2948	Ga0373958_0000860
2949	Ga0373959_0111291
2950	Ga0373938_0016046
2951	Ga0373926_0042015
2952	Ga0373926_0049343
2953	Ga0373928_0003431
2954	Ga0373928_0010752
2955	Ga0373929_0013357
2956	Ga0373929_0117659
2957	Ga0373934_0249836
2958	Ga0373940_0000514
2959	Ga0373944_0002467
2960	Ga0373944_0028640
2961	Ga0373949_0002898
2962	Ga0373949_0075398
2963	Ga0373949_0185786
2964	Ga0373951_0003415
2965	Ga0373952_0004762
2966	Ga0373952_0067407
2967	Ga0373932_0002131
2968	Ga0373936_0021221
2969	Ga0373936_0107867
2970	Ga0373936_0573398
2971	Ga0373939_0001104
2972	Ga0373939_0030975
2973	Ga0373939_0122261
2974	Ga0373941_0012114
2975	Ga0373945_0012482
2976	Ga0373945_0023499
2977	Ga0373945_0118285
2978	Ga0373945_0530506
2979	Ga0373953_0144071
2980	Ga0373956_0288599
2981	Ga0373960_0000379
2982	Ga0373960_0363020
2983	Ga0373943_0001202
2984	Ga0373943_0016176
2985	Ga0373943_0036417
2986	Ga0373943_0071293
2987	Ga0373943_0967211
2988	Ga0373946_0124686
2989	Ga0373946_0166952
2990	Ga0373946_0371965
2991	Ga0373955_0125391
2992	Ga0373942_0002632
2993	Ga0373961_0261216
2994	Ga0373962_0000833
2995	Ga0373924_0394198
2996	Ga0373931_0004517
2997	Ga0373931_0161896
2998	Ga0373931_0374500
2999	Ga0373935_0006516
3000	Ga0373935_0113656
3001	Ga0373935_1017650
3002	Ga0373927_0116874
3003	Ga0373927_0854450
3004	Ga0373947_0011350
3005	Ga0373947_0013280
3006	Ga0373947_0112570
3007	Ga0373947_0569286
3008	Ga0373947_0643399
3009	Ga0373947_0889564
3010	Ga0373937_0088261
3011	Ga0373937_0321249
3012	Ga0373937_0671379
3013	Ga0373925_0048753
3014	Ga0373925_0063084
3015	Ga0373925_0117578
3016	Ga0373925_0255416
3017	Ga0373925_0687416
3018	Ga0395899_0006500
3019	Ga0395899_0006809
3020	Ga0395899_0009338
3021	Ga0395899_0019523
3022	Ga0395899_0056080
3023	Ga0395899_0080600
3024	Ga0395899_0089619
3025	Ga0395899_0097555
3026	Ga0395899_0117112
3027	Ga0395899_0163994
3028	Ga0395899_0168515
3029	Ga0395899_0312165
3030	Ga0395899_0363982
3031	Ga0395899_0498595
3032	Ga0395899_0548775
3033	Ga0395900_0001841
3034	Ga0395900_0003865
3035	Ga0395900_0009361
3036	Ga0395900_0014932
3037	Ga0395900_0026766
3038	Ga0395900_0028922
3039	Ga0395900_0062116
3040	Ga0395900_0072975
3041	Ga0395900_0073759
3042	Ga0395900_0181098
3043	Ga0395900_0233555
3044	Ga0395900_0253787
3045	Ga0395900_0291584
3046	Ga0395900_0349436
3047	Ga0395900_0368008
3048	Ga0395900_0395846
3049	Ga0395900_0532126
3050	Ga0395900_0679175
3051	Ga0395900_0821519
3052	Ga0395900_0831421
3053	Ga0395900_0838696
3054	Ga0395900_1111542
3055	Ga0395900_1272221
3056	Ga0395900_1553575
3057	Ga0395898_0002770
3058	Ga0395898_0004964
3059	Ga0395898_0006058
3060	Ga0395898_0013863
3061	Ga0395898_0015946
3062	Ga0395898_0026749
3063	Ga0395898_0028708
3064	Ga0395898_0032963
3065	Ga0395898_0038919
3066	Ga0395898_0067328
3067	Ga0395898_0095920
3068	Ga0395898_0121321
3069	Ga0395898_0155239
3070	Ga0395898_0191415
3071	Ga0395898_0201066
3072	Ga0395898_0216117
3073	Ga0395898_0321376
3074	Ga0395898_0488398
3075	Ga0395898_0563952
3076	Ga0395898_0654813
3077	Ga0395898_1194623
3078	Ga0395898_1705697
3079	Ga0395905_0002146
3080	Ga0395905_0009584
3081	Ga0395905_0011371
3082	Ga0395905_0013021
3083	Ga0395905_0019829
3084	Ga0395905_0031674
3085	Ga0395905_0039460
3086	Ga0395905_0040313
3087	Ga0395905_0067556
3088	Ga0395905_0073344
3089	Ga0395905_0120040
3090	Ga0395905_0141137
3091	Ga0395905_0153235
3092	Ga0395905_0178933
3093	Ga0395905_0190784
3094	Ga0395905_0204253
3095	Ga0395905_0309858
3096	Ga0395905_0395773
3097	Ga0395905_0531690
3098	Ga0395905_0536266
3099	Ga0395905_1667569
3100	Ga0436364_1512323
3101	Ga0395901_0004052
3102	Ga0395901_0005367
3103	Ga0395901_0006015
3104	Ga0395901_0008667
3105	Ga0395901_0011369
3106	Ga0395901_0012311
3107	Ga0395901_0019014
3108	Ga0395901_0022266
3109	Ga0395901_0025311
3110	Ga0395901_0026619
3111	Ga0395901_0037177
3112	Ga0395901_0037997
3113	Ga0395901_0040023
3114	Ga0395901_0040321
3115	Ga0395901_0044770
3116	Ga0395901_0081430
3117	Ga0395901_0124911
3118	Ga0395901_0134715
3119	Ga0395901_0187607
3120	Ga0395901_0187629
3121	Ga0395901_0191152
3122	Ga0395901_0196005
3123	Ga0395901_0237533
3124	Ga0395901_0295403
3125	Ga0395901_0379547
3126	Ga0395901_0496038
3127	Ga0395901_0501321
3128	Ga0395901_0784578
3129	Ga0395901_1282804
3130	Ga0395901_1430990
3131	Ga0395901_1742827
3132	Ga0395901_1991898
3133	Ga0436365_1029760
3134	Ga0436360_0994852
3135	Ga0436363_0788567
3136	Ga0436363_1378044
3137	Ga0436363_1615001
3138	Ga0436362_0813193
3139	Ga0451800_0362382
3140	Ga0451802_0172529
3141	Ga0451804_0369130
3142	Ga0451804_0438811
3143	Ga0451849_1193245
3144	Ga0451853_2441445
3145	Ga0439441_042796
3146	Ga0439448_0009555
3147	Ga0439448_0078514
3148	Ga0439448_0238190
3149	Ga0439450_043074
3150	Ga0450914_011579
3151	Ga0450920_101425
3152	Ga0450891_007515
3153	Ga0450905_051384
3154	Ga0450907_018015
3155	Ga0450910_043655
3156	Ga0439446_0001115
3157	Ga0450918_028836
3158	Ga0466969_0151394
3159	Ga0466965_0207162
3160	Ga0466966_0024284
3161	Ga0466966_0154970
3162	Ga0466966_0176509
3163	Ga0466961_0046359
3164	Ga0466961_0064330
3165	Ga0466961_0075684
3166	Ga0466961_0576130
3167	Ga0466963_0000760
3168	Ga0466963_0001436
3169	Ga0466963_0001939
3170	Ga0466963_0083057
3171	Ga0466963_0188651
3172	Ga0466963_0210485
3173	Ga0466963_0225591
3174	Ga0466963_0351928
3175	Ga0466963_0355046
3176	Ga0466963_0452979
3177	Ga0466963_0518077
3178	Ga0466963_0753599
3179	Ga0466964_0007478
3180	Ga0466964_0044037
3181	Ga0466964_0103943
3182	Ga0466964_0205624
3183	Ga0466964_0444567
3184	Ga0466964_0777258
3185	Ga0466971_0322027
3186	Ga0466968_0026313
3187	Ga0466968_0060386
3188	Ga0466970_0259338
3189	Ga0466957_0000320
3190	Ga0466957_0004574
3191	Ga0466957_0048415
3192	Ga0466957_0299988
3193	Ga0466957_0379433
3194	Ga0466957_0554799
3195	Ga0466957_0914530
3196	Ga0466960_0032027
3197	Ga0466960_0812026
3198	Ga0466959_0035557
3199	Ga0466959_0247888
3200	Ga0466959_0602735
3201	Ga0451576_0051706
3202	Ga0451576_1250766
3203	Ga0466958_0002456
3204	Ga0466958_0004436
3205	Ga0466958_0010455
3206	Ga0466958_0028407
3207	Ga0466958_0076967
3208	Ga0466967_0001643
3209	Ga0466967_0003379
3210	Ga0466967_0005325
3211	Ga0466967_0008300
3212	Ga0466967_0011726
3213	Ga0466967_0013034
3214	Ga0466967_0013420
3215	Ga0466967_0015752
3216	Ga0466967_0052537
3217	Ga0466967_0069610
3218	Ga0466967_0099491
3219	Ga0466967_0110146
3220	Ga0466967_0163992
3221	Ga0466967_0268501
3222	Ga0466967_0323334
3223	Ga0466967_0342433
3224	Ga0466967_0457147
3225	Ga0466967_0506291
3226	Ga0466967_0573148
3227	Ga0466967_0748941
3228	Ga0466967_0845341
3229	Ga0466967_1218418
3230	Ga0466967_1311074
3231	Ga0466967_1374865
3232	Ga0495592_0216835
3233	Ga0495603_0012287
3234	Ga0495603_0400261
3235	Ga0495603_0740840
3236	Ga0495591_176647
3237	Ga0495629_0000983
3238	Ga0495629_0161392
3239	Ga0495629_0508033
3240	Ga0495641_0000513
3241	Ga0495641_0019125
3242	Ga0495641_0049158
3243	Ga0495641_0058794
3244	Ga0495641_0085884
3245	Ga0495651_0005516
3246	Ga0495651_0200495
3247	Ga0495651_0399783
3248	Ga0495653_0032994
3249	Ga0495653_0046943
3250	Ga0495653_0319908
3251	Ga0495653_0645849
3252	Ga0495653_0656537
3253	Ga0495580_0131696
3254	Ga0495582_0001245
3255	Ga0495582_0013170
3256	Ga0495582_0047451
3257	Ga0495582_0136770
3258	Ga0495582_0265630
3259	Ga0495605_0179443
3260	Ga0495605_0195648
3261	Ga0495639_0057257
3262	Ga0495639_0191297
3263	Ga0495639_0357790
3264	Ga0495639_0421813
3265	Ga0495662_0052580
3266	Ga0495662_0054330
3267	Ga0495662_0519547
3268	Ga0495664_0024930
3269	Ga0495664_0323083
3270	Ga0495664_0430328
3271	Ga0495584_0256841
3272	Ga0495584_0318440
3273	Ga0495584_0330262
3274	Ga0495584_0432003
3275	Ga0495585_0268813
3276	Ga0495594_0013993
3277	Ga0495594_0250133
3278	Ga0495594_0310146
3279	Ga0495594_0545803
3280	Ga0495596_0142155
3281	Ga0495596_0143108
3282	Ga0495596_0396530
3283	Ga0495607_0114894
3284	Ga0495583_0278103
3285	Ga0495608_0011310
3286	Ga0495608_0077939
3287	Ga0495608_0087721
3288	Ga0495608_0261062
3289	Ga0495608_0382161
3290	Ga0495616_0197194
3291	Ga0495616_0223990
3292	Ga0495618_0057577
3293	Ga0495618_0150639
3294	Ga0495618_0287753
3295	Ga0495628_0007971
3296	Ga0495628_0100942
3297	Ga0495628_0313932
3298	Ga0495630_0005552
3299	Ga0495630_0026893
3300	Ga0495630_0078236
3301	Ga0495630_0673972
3302	Ga0495631_0119627
3303	Ga0495637_0175995
3304	Ga0495637_0236652
3305	Ga0495644_0083291
3306	Ga0495644_0117907
3307	Ga0495644_0134824
3308	Ga0495644_0346849
3309	Ga0495644_0411917
3310	Ga0495663_0038880
3311	Ga0495663_0330905
3312	Ga0495642_0036590
3313	Ga0495652_0024348
3314	Ga0495652_0081792
3315	Ga0495652_0646917
3316	Ga0495652_0723234
3317	Ga0495665_0010504
3318	Ga0495665_0159832
3319	Ga0495640_0008531
3320	Ga0495640_0029240
3321	Ga0495640_0767416
3322	Ga0495640_0872655
3323	Ga0495587_0420349
3324	Ga0495587_0425520
3325	Ga0495587_0686041
3326	Ga0495587_0701051
3327	Ga0495598_0056966
3328	Ga0495609_0077193
3329	Ga0495645_0023098
3330	Ga0495645_0305930
3331	Ga0495645_0392251
3332	Ga0495622_0138971
3333	Ga0495622_0303858
3334	Ga0495633_0469581
3335	Ga0495667_0201620
3336	Ga0495667_0317754
3337	Ga0495667_0339098
3338	Ga0495656_0006083
3339	Ga0495656_0111967
3340	Ga0495656_0156391
3341	Ga0495656_0378350
3342	Ga0495668_0266653
3343	Ga0495668_0304602
3344	Ga0495634_0081767
3345	Ga0495634_0243400
3346	Ga0495611_0128618
3347	Ga0495611_0212943
3348	Ga0495635_0015649
3349	Ga0495635_0307960
3350	Ga0495659_0094314
3351	Ga0495659_0171272
3352	Ga0495659_0200648
3353	Ga0495659_0473472
3354	Ga0495588_0005238
3355	Ga0495588_0006455
3356	Ga0495588_0725376
3357	Ga0495657_0063716
3358	Ga0495657_0134745
3359	Ga0495657_0560160
3360	Ga0495657_0621229
3361	Ga0495599_0028928
3362	Ga0495599_0212415
3363	Ga0495623_0097742
3364	Ga0495623_0151249
3365	Ga0495623_0274627
3366	Ga0495646_0159653
3367	Ga0495647_0009126
3368	Ga0495647_0082903
3369	Ga0495647_0172573
3370	Ga0495658_0012385
3371	Ga0495658_0054229
3372	Ga0495658_0099660
3373	Ga0495658_0199256
3374	Ga0495658_0494327
3375	Ga0495613_0007233
3376	Ga0495613_0172484
3377	Ga0495613_0794400
3378	Ga0495624_0044440
3379	Ga0495624_0546952
3380	Ga0495624_0750817
3381	Ga0495670_0369615
3382	Ga0495670_0573015
3383	Ga0495670_0825321
3384	Ga0495671_0100159
3385	Ga0495671_0222425
3386	Ga0495589_0091199
3387	Ga0495589_0148084
3388	Ga0495589_0260387
3389	Ga0495589_0399788
3390	Ga0495600_0031221
3391	Ga0495600_0173525
3392	Ga0495600_0502227
3393	Ga0495581_0012008
3394	Ga0495581_0014564
3395	Ga0495581_0151222
3396	Ga0495581_0527980
3397	Ga0495604_0036937
3398	Ga0495604_0365094
3399	Ga0495604_0540509
3400	Ga0495636_0142474
3401	Ga0495674_0001926
3402	Ga0495674_0078002
3403	Ga0495674_0089857
3404	Ga0495674_1020033
3405	Ga0495676_0002145
3406	Ga0495676_0033965
3407	Ga0495676_0069993
3408	Ga0495676_0113574
3409	Ga0495676_0141785
3410	Ga0495676_0206723
3411	Ga0495680_0011628
3412	Ga0495680_0233381
3413	Ga0495680_0550391
3414	Ga0495683_0234158
3415	Ga0495675_0389692
3416	Ga0495675_0784741
3417	Ga0495679_079402
3418	Ga0495684_0008848
3419	Ga0495684_0036035
3420	Ga0495684_0066161
3421	Ga0495593_0191121
3422	Ga0495593_0299810
3423	Ga0495593_0599967
3424	Ga0495602_0038419
3425	Ga0495602_0456426
3426	Ga0495602_0764617
3427	Ga0495602_0885086
3428	Ga0495614_0061750
3429	Ga0495614_0167503
3430	Ga0495626_0198898
3431	Ga0496100_0005486
3432	Ga0496100_0043655
3433	Ga0496100_0056297
3434	Ga0496100_0079020
3435	Ga0496100_0093466
3436	Ga0496100_0103397
3437	Ga0496100_0137383
3438	Ga0496100_0172660
3439	Ga0496100_0416366
3440	Ga0496100_0442275
3441	Ga0496100_1104927
3442	Ga0496101_0009617
3443	Ga0496101_0037795
3444	Ga0496101_0075364
3445	Ga0496101_0093758
3446	Ga0496101_0099408
3447	Ga0496101_0117196
3448	Ga0496101_0202546
3449	Ga0496101_0287100
3450	Ga0496101_0393617
3451	Ga0496101_0405048
3452	Ga0496101_0547864
3453	Ga0496101_0575101
3454	Ga0496101_1079745
3455	Ga0496101_1147869
3456	Ga0496102_0028674
3457	Ga0496102_0033041
3458	Ga0496102_0039629
3459	Ga0496102_0041756
3460	Ga0496102_0049308
3461	Ga0496102_0098466
3462	Ga0496102_0171817
3463	Ga0496102_0177945
3464	Ga0496102_0278204
3465	Ga0496102_0410934
3466	Ga0496102_0572050
3467	Ga0496102_0599168
3468	Ga0496102_0668796
3469	Ga0496102_0939882
3470	Ga0496102_1018634
3471	Ga0496102_1255752
3472	Ga0496102_1963606
3473	Ga0496103_0003179
3474	Ga0496103_0005385
3475	Ga0496103_0017111
3476	Ga0496103_0020509
3477	Ga0496103_0030696
3478	Ga0496103_0053880
3479	Ga0496103_0236362
3480	Ga0496103_0260053
3481	Ga0496103_0267831
3482	Ga0496103_0460618
3483	Ga0496103_0620774
3484	Ga0496104_0034950
3485	Ga0496104_0036343
3486	Ga0496104_0054880
3487	Ga0496104_0109498
3488	Ga0496104_0153243
3489	Ga0496104_0193541
3490	Ga0496104_0231178
3491	Ga0496104_0285975
3492	Ga0496104_0448316
3493	Ga0496104_0649367
3494	Ga0496104_0778691
3495	Ga0496104_0903946
3496	Ga0496104_0909179
3497	Ga0496104_1753214
3498	Ga0496105_0001920
3499	Ga0496105_0014154
3500	Ga0496105_0016082
3501	Ga0496105_0023674
3502	Ga0496105_0038776
3503	Ga0496105_0057512
3504	Ga0496105_0070514
3505	Ga0496105_0074744
3506	Ga0496105_0126394
3507	Ga0496105_0365871
3508	Ga0496105_0366739
3509	Ga0496105_0370393
3510	Ga0496105_0577963
3511	Ga0496105_0607157
3512	Ga0496105_0678736
3513	Ga0496105_0933080
3514	Ga0496106_0008859
3515	Ga0496106_0012914
3516	Ga0496106_0041717
3517	Ga0496106_0057932
3518	Ga0496106_0066614
3519	Ga0496106_0071421
3520	Ga0496106_0103533
3521	Ga0496106_0180217
3522	Ga0496106_0331115
3523	Ga0496106_0392279
3524	Ga0496106_0424210
3525	Ga0496106_0726392
3526	Ga0496107_0001958
3527	Ga0496107_0017552
3528	Ga0496107_0029542
3529	Ga0496107_0035950
3530	Ga0496107_0067819
3531	Ga0496107_0090718
3532	Ga0496107_0142100
3533	Ga0496107_0161323
3534	Ga0496107_0389422
3535	Ga0496107_0393123
3536	Ga0496107_0420881
3537	Ga0496107_0612110
3538	Ga0496107_0632893
3539	Ga0496107_1013554
3540	Ga0496108_0002655
3541	Ga0496108_0024762
3542	Ga0496108_0031291
3543	Ga0496108_0050123
3544	Ga0496108_0051848
3545	Ga0496108_0124466
3546	Ga0496108_0170868
3547	Ga0496108_0235271
3548	Ga0496108_0246836
3549	Ga0496108_0271763
3550	Ga0496108_0329485
3551	Ga0496108_0379522
3552	Ga0496108_0451674
3553	Ga0496108_0542566
3554	Ga0496108_0790289
3555	Ga0496108_0957287
3556	Ga0496108_1004428
3557	Ga0496109_0005630
3558	Ga0496109_0007732
3559	Ga0496109_0019915
3560	Ga0496109_0022485
3561	Ga0496109_0025284
3562	Ga0496109_0031833
3563	Ga0496109_0038224
3564	Ga0496109_0112769
3565	Ga0496109_0202001
3566	Ga0496109_0381929
3567	Ga0496109_0488668
3568	Ga0496109_0570950
3569	Ga0496109_1146000
3570	Ga0496110_0006094
3571	Ga0496110_0018736
3572	Ga0496110_0022099
3573	Ga0496110_0029815
3574	Ga0496110_0063255
3575	Ga0496110_0075288
3576	Ga0496110_0083504
3577	Ga0496110_0087909
3578	Ga0496110_0250038
3579	Ga0496110_0340090
3580	Ga0496110_0345039
3581	Ga0496110_0370360
3582	Ga0496110_0373221
3583	Ga0496110_0450605
3584	Ga0496110_0537381
3585	Ga0496110_0661286
3586	Ga0496110_0699150
3587	Ga0496110_0806053
3588	Ga0496111_0000818
3589	Ga0496111_0012368
3590	Ga0496111_0021852
3591	Ga0496111_0024006
3592	Ga0496111_0030104
3593	Ga0496111_0040485
3594	Ga0496111_0044024
3595	Ga0496111_0116235
3596	Ga0496111_0217754
3597	Ga0496111_0265848
3598	Ga0496111_0469018
3599	Ga0496111_0704875
3600	Ga0496111_0833164
3601	Ga0496112_0002180
3602	Ga0496112_0004262
3603	Ga0496112_0010672
3604	Ga0496112_0012685
3605	Ga0496112_0049399
3606	Ga0496112_0049547
3607	Ga0496112_0085483
3608	Ga0496112_0096032
3609	Ga0496112_0164007
3610	Ga0496112_0201561
3611	Ga0496112_0337564
3612	Ga0496112_0348182
3613	Ga0496112_0489552
3614	Ga0496112_0683536
3615	Ga0496113_0000051
3616	Ga0496113_0023779
3617	Ga0496113_0052555
3618	Ga0496113_0053825
3619	Ga0496113_0104094
3620	Ga0496113_0166420
3621	Ga0496113_0467628
3622	Ga0496113_0476678
3623	Ga0496113_0698659
3624	Ga0496113_1121657
3625	Ga0496113_1178641
3626	Ga0496114_0003880
3627	Ga0496114_0004690
3628	Ga0496114_0020241
3629	Ga0496114_0024767
3630	Ga0496114_0025728
3631	Ga0496114_0036352
3632	Ga0496114_0140180
3633	Ga0496114_0325382
3634	Ga0496114_0363372
3635	Ga0496114_0382814
3636	Ga0496114_0435457
3637	Ga0496114_0440678
3638	Ga0496114_0574016
3639	Ga0496114_0576073
3640	Ga0496114_0882693
3641	Ga0496114_1161875
3642	Ga0496115_0001212
3643	Ga0496115_0002156
3644	Ga0496115_0032773
3645	Ga0496115_0033207
3646	Ga0496115_0035301
3647	Ga0496115_0037444
3648	Ga0496115_0049736
3649	Ga0496115_0116517
3650	Ga0496115_0135328
3651	Ga0496115_0171714
3652	Ga0496115_0217024
3653	Ga0496115_0288030
3654	Ga0496115_0425740
3655	Ga0496115_0615069
3656	Ga0496115_0959581
3657	Ga0501031_0000867
3658	Ga0501032_0124879
3659	Ga0501033_0057314
3660	Ga0501036_0008436
3661	Ga0501036_0195176
3662	Ga0501036_0438383
3663	Ga0501037_0631443
3664	Ga0501038_0004809
3665	Ga0501039_0019287
3666	Ga0501040_0127845
3667	Ga0501040_0135139
3668	Ga0501041_0000302
3669	Ga0501041_0704741
3670	Ga0501041_1135908
3671	Ga0501042_0007134
3672	Ga0501043_0055950
3673	Ga0501043_0594657
3674	Ga0501046_0012089
3675	Ga0501046_0487196
3676	Ga0501047_0055079
3677	Ga0501047_1409531
3678	Ga0501048_0001369
3679	Ga0501067_0014736
3680	Ga0501067_0030923
3681	Ga0501067_0037266
3682	Ga0501067_0040018
3683	Ga0501067_0045373
3684	Ga0501067_0153364
3685	Ga0501067_0298075
3686	Ga0501068_0090949
3687	Ga0501068_0191252
3688	Ga0501068_0487202
3689	Ga0501069_0002785
3690	Ga0501069_0016779
3691	Ga0501069_0050799
3692	Ga0501069_0061317
3693	Ga0501069_0069447
3694	Ga0501069_0076083
3695	Ga0501069_0102592
3696	Ga0501069_0192856
3697	Ga0501069_0282550
3698	Ga0501069_0425071
3699	Ga0501070_0000729
3700	Ga0501070_0103148
3701	Ga0501070_0171232
3702	Ga0501071_0003170
3703	Ga0501071_1577349
3704	Ga0501072_0004402
3705	Ga0501072_0119923
3706	Ga0501072_0335419
3707	Ga0501072_0695271
3708	Ga0501073_1017479
3709	Ga0501073_1223734
3710	Ga0501074_0089300
3711	Ga0501074_0091973
3712	Ga0501074_0331741
3713	Ga0501074_0357792
3714	Ga0501074_0419359
3715	Ga0501075_0000959
3716	Ga0501075_0566206
3717	Ga0501076_0004307
3718	Ga0501076_0863888
3719	Ga0501076_1363744
3720	Ga0501077_0010956
3721	Ga0501079_0009625
3722	Ga0501079_0471138
3723	Ga0501080_0049250
3724	Ga0501080_0067595
3725	Ga0501080_0257935
3726	Ga0501080_0501172
3727	Ga0501080_0983023
3728	Ga0501081_0000989
3729	Ga0501081_0090594
3730	Ga0501083_0105254
3731	Ga0501035_0396983
3732	Ga0501044_0307783
3733	Ga0501044_0634268
3734	Ga0501044_0977656
3735	Ga0501045_0002386
3736	nmdc:mga03n38_681882_c1
3737	nmdc:mga0yw44_640888_c1
3738	nmdc:mga06z11_195115_c1
3739	nmdc:mga05p37_118275_c1
3740	nmdc:mga05p37_12268_c1
3741	nmdc:mga05p37_159419_c1
3742	nmdc:mga05p37_164097_c1
3743	nmdc:mga05p37_49820_c1
3744	nmdc:mga05p37_6657_c1
3745	nmdc:mga05p37_776266_c1
3746	nmdc:mga09592_289881_c1
3747	nmdc:mga0qj67_300686_c1
3748	nmdc:mga0qj67_853115_c1
3749	nmdc:mga06r32_18459_c1
3750	nmdc:mga06r32_191548_c1
3751	nmdc:mga06r32_275439_c1
3752	nmdc:mga06r32_59466_c1
3753	nmdc:mga08y16_18152_c1
3754	nmdc:mga08y16_522012_c1
3755	nmdc:mga08y16_970043_c1
3756	nmdc:mga0n895_120080_c1
3757	nmdc:mga0n895_1411302_c1
3758	nmdc:mga0n895_1571600_c1
3759	nmdc:mga0n895_214513_c1
3760	nmdc:mga0n895_270857_c1
3761	nmdc:mga0n895_328198_c1
3762	nmdc:mga0n895_42896_c1
3763	nmdc:mga0n895_501994_c1
3764	nmdc:mga0n895_5894_c1
3765	nmdc:mga0n895_9854_c1
3766	nmdc:mga0rr50_11436_c1
3767	nmdc:mga0rr50_1893640_c1
3768	nmdc:mga0rr50_275658_c1
3769	nmdc:mga0rr50_330744_c1
3770	nmdc:mga0rr50_38426_c1
3771	nmdc:mga0rr50_4300_c1
3772	nmdc:mga0rr50_674083_c1
3773	nmdc:mga08x19_14444_c1
3774	nmdc:mga08x19_168080_c1
3775	nmdc:mga08x19_36342_c1
3776	nmdc:mga08x19_3892_c1
3777	nmdc:mga08x19_429911_c1
3778	nmdc:mga08x19_467351_c1
3779	nmdc:mga08x19_50751_c1
3780	nmdc:mga08x19_96620_c1
3781	nmdc:mga0a205_11170_c1
3782	nmdc:mga0a205_1405033_c1
3783	nmdc:mga0a205_143601_c1
3784	nmdc:mga0a205_292_c1
3785	nmdc:mga0a205_39972_c1
3786	Ga0495601_0045972
3787	Ga0495601_0222158
3788	Ga0495601_0489131
3789	Ga0495601_0980708
3790	Ga0495612_0145827
3791	Ga0495612_0251331
3792	Ga0495655_0155088
3793	Ga0495595_0034211
3794	Ga0495595_0067234
3795	Ga0495595_0192857
3796	Ga0495619_0037854
3797	Ga0495619_0119463
3798	Ga0495619_0159403
3799	Ga0495619_0398759
3800	Ga0495619_0601180
3801	Ga0495619_1019987
3802	Ga0501084_0002494
3803	Ga0501084_0022121
3804	Ga0501084_0355389
3805	Ga0501084_0850106
3806	Ga0501084_1007785
3807	Ga0590075_094863
3808	Ga0590077_014768
3809	Ga0587091_238462
3810	Ga0501082_0105250
3811	Ga0501082_1159121
3812	Ga0466962_0000378
3813	Ga0466962_0048829
3814	Ga0466962_0069596
3815	Ga0530510_0001957
3816	Ga0530510_0091576
3817	Ga0530510_0103473
3818	Ga0530510_0188225
3819	Ga0530510_0262617
3820	Ga0530510_1024223
3821	Ga0530510_1172568
3822	Ga0530510_1568642

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10611

DUF2469

Protein of unknown function (DUF2469)

2

100

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5o9z-assembly1.cif.gz_d	cryo-em structure of a pre-catalytic human spliceosome primed for activation (b complex)	0.6771	34	95
1i4k-assembly2.cif.gz_I	crystal structure of an sm-like protein (af-sm1) from archaeoglobus fulgidus at 2.5a resolution	0.6749	33	98
3cax-assembly1.cif.gz_A-2	crystal structure of uncharacterized protein pf0695	0.6608	48	89
4f7u-assembly2.cif.gz_I	the 6s snrnp assembly intermediate	0.6527	33	98
1m8v-assembly1.cif.gz_N	structure of pyrococcus abyssii sm protein in complex with a uridine heptamer	0.642	33	96

ID	Description	Score	Start	End	Superfamily
af_Q57760_1_206_3.30.1380.20	Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3	0.7828	46	67	3.30.1380.20
1i4kP00	Mainly Beta;Roll;SH3 type barrels.;	0.7023	33	94	2.30.30.100
af_A4HRD7_2_71_2.30.30.100	Mainly Beta;Roll;SH3 type barrels.;	0.6971	33	99	2.30.30.100
af_Q75L16_221_413_3.30.2130.10	Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like	0.6645	48	68	3.30.2130.10
3caxA02	Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain	0.6608	48	89	3.30.450.20

ID	Description	Score	Start	End
AF-A0A7Y5XTS5-F1-model_v4	DUF2469 family protein	0.9524	6	89
AF-A0A399XWC8-F1-model_v4	DUF2469 domain-containing protein	0.939	9	99
AF-A0A163SMV5-F1-model_v4	Protein often found in actinomycetes clustered with signal peptidase and/or RNaseHII	0.939	19	98
AF-A0A5N5W231-F1-model_v4	DUF2469 family protein	0.9387	9	98
AF-A0A359IT57-F1-model_v4	deleted	0.9377	9	86

F496038

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF10611

DUF2469

Protein of unknown function (DUF2469)

2

100

0.97

Structural Annotation

Top 5 Hits

Map