F495863
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1840 | 727 | 1654 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10100918|Ga0157380_101009183 |
| Length | 179 |
| Sequence | LRRRLSARWPDAGRRHSIGVTNNDKWEGFPMNRIATTLSLAAAFAAGCSVTHLLRPAIAAENITAQVIHTGELEGDALGMPSGTGMRSKMFVSADGMTISVQDGNVPKHMHPNTNEIQYILEGTGTVWLGDKEVRVKPGDLVVIPKGTPHGGTKPDGRTLKAIAIKTPPQAPDDTKMLN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 10 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 16 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 17 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 18 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 19 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 20 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 21 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 22 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 23 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 24 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 25 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 26 | 2791355199 | |||
| 27 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 28 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 29 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 30 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 31 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 32 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 33 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 34 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 35 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 36 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 37 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 38 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 39 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 40 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 41 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 42 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 43 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 44 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 45 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 46 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 47 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 48 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 49 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 50 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 51 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 52 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 53 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 54 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 55 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 56 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 57 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 58 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 59 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 60 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 61 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 62 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 63 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 64 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 65 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 66 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 67 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 68 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 69 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 70 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 71 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 72 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 73 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 74 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 75 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 76 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 77 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 78 | 2904699407 | |||
| 79 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 80 | 2906610324 | |||
| 81 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 82 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 83 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 84 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 85 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 86 | 2922368715 | |||
| 87 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 88 | 2922425934 | |||
| 89 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 90 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 91 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 92 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 93 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 94 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 95 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 96 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 97 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 98 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 99 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 100 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 101 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 102 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 103 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 104 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 105 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 106 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 107 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 108 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 109 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 110 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 111 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 112 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 113 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 114 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 115 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 116 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 117 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 118 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 119 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 120 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 121 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 122 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 123 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 124 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 125 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 126 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 127 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 128 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 129 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 130 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 131 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 132 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 133 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 134 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 135 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 136 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 137 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 138 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 139 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 140 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 141 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 142 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 143 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 144 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 145 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 146 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 147 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 148 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 149 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 150 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 151 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 152 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 153 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 154 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 155 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 156 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 157 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 158 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 159 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 160 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 161 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 162 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 163 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 164 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 166 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 167 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 168 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 171 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 172 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 175 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 177 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 178 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 180 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 181 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 182 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 190 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 193 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 194 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 196 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 197 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 198 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 199 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 200 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 204 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 205 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 206 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 207 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 209 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 210 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 211 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 213 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 217 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 218 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 220 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 221 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 222 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 224 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 225 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 226 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 227 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 228 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 229 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 230 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 231 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 232 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 233 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 234 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 235 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 236 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 237 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 238 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 239 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 240 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 241 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 242 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 243 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 244 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 245 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 247 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 248 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 249 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 250 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 251 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 252 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 253 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 254 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 256 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 257 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 258 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 259 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 260 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 269 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 271 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 272 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 273 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 274 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 275 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 276 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 277 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 279 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 280 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 281 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 282 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 283 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 284 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 285 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 286 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 287 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 288 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 289 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 290 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 291 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 292 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 293 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 294 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 295 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 296 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 297 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 298 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 299 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 300 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 301 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 302 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 303 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 304 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 307 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 308 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 309 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 310 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 311 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 312 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 313 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 314 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 315 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 380 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 381 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 382 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 383 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 384 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 385 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 389 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 390 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 391 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 392 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 393 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 394 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 395 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 396 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 397 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 398 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 399 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 400 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 401 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 402 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 403 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 404 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 405 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 406 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 407 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 408 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 409 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 410 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 411 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 412 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 413 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 414 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 415 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 416 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 417 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 418 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 419 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 420 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 421 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 422 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 423 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 424 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 425 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 426 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 427 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 428 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 429 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 430 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 431 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 432 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 433 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 434 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 435 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 436 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 437 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 438 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 439 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 440 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 441 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 442 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 443 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 444 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 445 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 446 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 447 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 448 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 449 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 450 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 451 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 452 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 453 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 454 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 455 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 456 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 457 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 458 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 459 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 460 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 461 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 462 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 463 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 464 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 465 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 466 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 467 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 468 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 469 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 470 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 471 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 472 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 473 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 474 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 475 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 476 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 477 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 478 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 479 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 480 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 573 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 574 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 575 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 576 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 577 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 578 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 579 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 580 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 581 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 582 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 583 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 584 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 585 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 586 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 587 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 588 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 589 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 590 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 591 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 592 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 593 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 594 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 595 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 596 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 597 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 598 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 600 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 601 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 602 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 603 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 604 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 605 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 606 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 607 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 608 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 609 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 610 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 611 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 612 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 613 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 614 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 615 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 616 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 617 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 618 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 619 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 620 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 621 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 622 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 623 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 624 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 625 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 626 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 627 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 628 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 629 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 630 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 631 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 632 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 633 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 634 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 635 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 638 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 639 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 643 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 644 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 645 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 646 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 647 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 648 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 649 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 650 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 651 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 652 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 653 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 654 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 655 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 656 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 657 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 658 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 659 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 660 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 661 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 662 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 663 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 664 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 665 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 666 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 667 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 668 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 669 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 670 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 671 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 672 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 673 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 674 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 675 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 676 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 677 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 678 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 679 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 680 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 681 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 682 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 683 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 684 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 685 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 686 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 687 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 688 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 689 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 690 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 691 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 692 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 693 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 694 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 695 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 696 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 697 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 698 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 699 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 700 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 701 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 702 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 703 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 704 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 705 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 706 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 707 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 708 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 709 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 710 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 711 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 712 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 713 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 714 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 715 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 716 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 717 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 718 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 719 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 720 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 721 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 722 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 723 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 724 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 725 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 726 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 727 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.32 |
| Metatranscriptomes | 0.82 |
| Isolates | 9.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.45 |
| Nodule | 8.32 |
| Rhizoplane | 6.74 |
| Rhizosphere | 64.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214814962 | 2209111006 | Unclassified | 677 |
| 2 | JGI24739J22299_10053737 | 3300001989 | Bacteria | 1292 |
| 3 | JGI24737J22298_10172787 | 3300001990 | Bacteria | 638 |
| 4 | JGI24738J21930_10096315 | 3300002075 | Bacteria | 629 |
| 5 | JGI24742J22300_10017201 | 3300002244 | Bacteria | 1222 |
| 6 | JGI24751J29686_10040469 | 3300002459 | Bacteria | 965 |
| 7 | JGI25153J46596_10001613 | 3300003215 | Bacteria | 13373 |
| 8 | JGI25153J46596_10006408 | 3300003215 | Bacteria | 5957 |
| 9 | JGI25160J50197_1002315 | 3300003354 | Bacteria | 8917 |
| 10 | JGI25160J50197_1017116 | 3300003354 | Bacteria | 2309 |
| 11 | Ga0055542_1010193 | 3300003762 | Bacteria | 1731 |
| 12 | Ga0055529_1011412 | 3300003763 | Bacteria | 1144 |
| 13 | Ga0058863_11267463 | 3300004799 | Bacteria | 507 |
| 14 | Ga0065165_1000437 | 3300005262 | Bacteria | 65503 |
| 15 | Ga0065165_1001951 | 3300005262 | Bacteria | 19574 |
| 16 | Ga0065712_10184569 | 3300005290 | Bacteria | 1176 |
| 17 | Ga0065715_10166218 | 3300005293 | Bacteria | 1580 |
| 18 | Ga0070658_10214222 | 3300005327 | Bacteria | 1628 |
| 19 | Ga0070676_10125466 | 3300005328 | Bacteria | 1617 |
| 20 | Ga0070676_10127094 | 3300005328 | Bacteria | 1607 |
| 21 | Ga0070676_10187090 | 3300005328 | Bacteria | 1350 |
| 22 | Ga0070676_10341808 | 3300005328 | Bacteria | 1027 |
| 23 | Ga0070683_100162394 | 3300005329 | Bacteria | 2120 |
| 24 | Ga0070683_101478914 | 3300005329 | Bacteria | 653 |
| 25 | Ga0070690_100193209 | 3300005330 | Unclassified | 1412 |
| 26 | Ga0070690_100239189 | 3300005330 | Bacteria | 1280 |
| 27 | Ga0070670_100271810 | 3300005331 | Bacteria | 1479 |
| 28 | Ga0070670_101093918 | 3300005331 | Bacteria | 727 |
| 29 | Ga0070670_101177805 | 3300005331 | Bacteria | 700 |
| 30 | Ga0070677_10029717 | 3300005333 | Bacteria | 2075 |
| 31 | Ga0070677_10094607 | 3300005333 | Bacteria | 1306 |
| 32 | Ga0068869_100267014 | 3300005334 | Bacteria | 1372 |
| 33 | Ga0068869_100269471 | 3300005334 | Bacteria | 1366 |
| 34 | Ga0070666_10008638 | 3300005335 | Bacteria | 6333 |
| 35 | Ga0070666_10075916 | 3300005335 | Bacteria | 2292 |
| 36 | Ga0070666_10268351 | 3300005335 | Bacteria | 1211 |
| 37 | Ga0070680_100018027 | 3300005336 | Bacteria | 5576 |
| 38 | Ga0070680_101545674 | 3300005336 | Bacteria | 575 |
| 39 | Ga0068868_100024743 | 3300005338 | Bacteria | 4558 |
| 40 | Ga0068868_100140422 | 3300005338 | Bacteria | 1983 |
| 41 | Ga0068868_100148090 | 3300005338 | Bacteria | 1932 |
| 42 | Ga0068868_100174997 | 3300005338 | Bacteria | 1778 |
| 43 | Ga0068868_101017958 | 3300005338 | Bacteria | 758 |
| 44 | Ga0068868_101117733 | 3300005338 | Bacteria | 726 |
| 45 | Ga0070660_100364427 | 3300005339 | Bacteria | 1191 |
| 46 | Ga0070660_100372110 | 3300005339 | Bacteria | 1179 |
| 47 | Ga0070660_100903632 | 3300005339 | Bacteria | 745 |
| 48 | Ga0070660_101134627 | 3300005339 | Bacteria | 662 |
| 49 | Ga0070689_101261410 | 3300005340 | Bacteria | 665 |
| 50 | Ga0070691_10096833 | 3300005341 | Bacteria | 1461 |
| 51 | Ga0070687_100138119 | 3300005343 | Bacteria | 1416 |
| 52 | Ga0070687_100542160 | 3300005343 | Bacteria | 790 |
| 53 | Ga0070687_100673168 | 3300005343 | Bacteria | 720 |
| 54 | Ga0070661_100084660 | 3300005344 | Bacteria | 2342 |
| 55 | Ga0070668_100120988 | 3300005347 | Bacteria | 2092 |
| 56 | Ga0070668_100320806 | 3300005347 | Bacteria | 1304 |
| 57 | Ga0070669_100172181 | 3300005353 | Bacteria | 1688 |
| 58 | Ga0070669_100336845 | 3300005353 | Bacteria | 1221 |
| 59 | Ga0070669_100688319 | 3300005353 | Bacteria | 863 |
| 60 | Ga0070669_100834424 | 3300005353 | Bacteria | 785 |
| 61 | Ga0070669_101447885 | 3300005353 | Bacteria | 596 |
| 62 | Ga0070675_100242240 | 3300005354 | Bacteria | 1576 |
| 63 | Ga0070675_100522162 | 3300005354 | Bacteria | 1071 |
| 64 | Ga0070675_100686590 | 3300005354 | Bacteria | 932 |
| 65 | Ga0070675_101261938 | 3300005354 | Bacteria | 680 |
| 66 | Ga0070671_100006274 | 3300005355 | Bacteria | 9475 |
| 67 | Ga0070671_100483066 | 3300005355 | Bacteria | 1065 |
| 68 | Ga0070671_100912787 | 3300005355 | Bacteria | 767 |
| 69 | Ga0070671_101486568 | 3300005355 | Bacteria | 599 |
| 70 | Ga0070674_100074733 | 3300005356 | Bacteria | 2405 |
| 71 | Ga0070674_100258298 | 3300005356 | Bacteria | 1371 |
| 72 | Ga0070674_100392083 | 3300005356 | Unclassified | 1132 |
| 73 | Ga0070673_100116311 | 3300005364 | Bacteria | 2224 |
| 74 | Ga0070673_100153511 | 3300005364 | Bacteria | 1952 |
| 75 | Ga0070673_100413045 | 3300005364 | Bacteria | 1209 |
| 76 | Ga0070673_100480292 | 3300005364 | Bacteria | 1122 |
| 77 | Ga0070688_100251830 | 3300005365 | Bacteria | 1258 |
| 78 | Ga0070688_100395623 | 3300005365 | Bacteria | 1022 |
| 79 | Ga0070688_100861205 | 3300005365 | Unclassified | 712 |
| 80 | Ga0070688_100986016 | 3300005365 | Bacteria | 669 |
| 81 | Ga0070659_100182395 | 3300005366 | Bacteria | 1723 |
| 82 | Ga0070659_100237636 | 3300005366 | Bacteria | 1507 |
| 83 | Ga0070659_100482612 | 3300005366 | Bacteria | 1055 |
| 84 | Ga0070659_100574413 | 3300005366 | Bacteria | 967 |
| 85 | Ga0070659_100760004 | 3300005366 | Bacteria | 841 |
| 86 | Ga0070659_101167680 | 3300005366 | Bacteria | 680 |
| 87 | Ga0070667_100016970 | 3300005367 | Bacteria | 6027 |
| 88 | Ga0070667_100274656 | 3300005367 | Bacteria | 1512 |
| 89 | Ga0070667_100275142 | 3300005367 | Bacteria | 1511 |
| 90 | Ga0070667_100986553 | 3300005367 | Bacteria | 786 |
| 91 | Ga0070667_101290568 | 3300005367 | Bacteria | 684 |
| 92 | Ga0070703_10112008 | 3300005406 | Bacteria | 978 |
| 93 | Ga0070709_10426569 | 3300005434 | Bacteria | 995 |
| 94 | Ga0070709_10534843 | 3300005434 | Bacteria | 895 |
| 95 | Ga0070709_11375871 | 3300005434 | Bacteria | 571 |
| 96 | Ga0070709_11453862 | 3300005434 | Bacteria | 556 |
| 97 | Ga0070714_102210494 | 3300005435 | Bacteria | 536 |
| 98 | Ga0070714_102483409 | 3300005435 | Bacteria | 503 |
| 99 | Ga0070713_100932763 | 3300005436 | Bacteria | 836 |
| 100 | Ga0070701_10666884 | 3300005438 | Bacteria | 696 |
| 101 | Ga0070711_100575500 | 3300005439 | Bacteria | 937 |
| 102 | Ga0070711_100686924 | 3300005439 | Bacteria | 861 |
| 103 | Ga0070711_100829331 | 3300005439 | Bacteria | 786 |
| 104 | Ga0070711_101422535 | 3300005439 | Bacteria | 604 |
| 105 | Ga0070705_100434794 | 3300005440 | Bacteria | 980 |
| 106 | Ga0070700_100048865 | 3300005441 | Bacteria | 2623 |
| 107 | Ga0070700_100076673 | 3300005441 | Bacteria | 2147 |
| 108 | Ga0070700_100719204 | 3300005441 | Bacteria | 796 |
| 109 | Ga0070663_100041743 | 3300005455 | Bacteria | 3220 |
| 110 | Ga0070663_100046047 | 3300005455 | Bacteria | 3085 |
| 111 | Ga0070663_100166126 | 3300005455 | Bacteria | 1702 |
| 112 | Ga0070663_100172906 | 3300005455 | Bacteria | 1671 |
| 113 | Ga0070663_100675713 | 3300005455 | Bacteria | 876 |
| 114 | Ga0070663_100697163 | 3300005455 | Bacteria | 863 |
| 115 | Ga0070678_100040131 | 3300005456 | Bacteria | 3309 |
| 116 | Ga0070678_100074215 | 3300005456 | Bacteria | 2555 |
| 117 | Ga0070678_100287658 | 3300005456 | Unclassified | 1392 |
| 118 | Ga0070678_100313726 | 3300005456 | Bacteria | 1337 |
| 119 | Ga0070678_100386189 | 3300005456 | Bacteria | 1212 |
| 120 | Ga0070678_100443219 | 3300005456 | Bacteria | 1136 |
| 121 | Ga0070678_101436922 | 3300005456 | Bacteria | 645 |
| 122 | Ga0070662_100038911 | 3300005457 | Bacteria | 3381 |
| 123 | Ga0070662_100336141 | 3300005457 | Bacteria | 1235 |
| 124 | Ga0070681_10009008 | 3300005458 | Bacteria | 9810 |
| 125 | Ga0070681_10020592 | 3300005458 | Bacteria | 6610 |
| 126 | Ga0070681_10029069 | 3300005458 | Bacteria | 5549 |
| 127 | Ga0070681_10577783 | 3300005458 | Bacteria | 1038 |
| 128 | Ga0068867_100047151 | 3300005459 | Bacteria | 3167 |
| 129 | Ga0068867_101153755 | 3300005459 | Bacteria | 710 |
| 130 | Ga0070685_10075464 | 3300005466 | Bacteria | 2009 |
| 131 | Ga0070685_10740491 | 3300005466 | Bacteria | 720 |
| 132 | Ga0070698_100152883 | 3300005471 | Bacteria | 2254 |
| 133 | Ga0070699_100051453 | 3300005518 | Bacteria | 3566 |
| 134 | Ga0070679_100013970 | 3300005530 | Bacteria | 7696 |
| 135 | Ga0070679_100051260 | 3300005530 | Bacteria | 4110 |
| 136 | Ga0070679_100069459 | 3300005530 | Bacteria | 3513 |
| 137 | Ga0070679_100216670 | 3300005530 | Bacteria | 1877 |
| 138 | Ga0070679_100293284 | 3300005530 | Bacteria | 1578 |
| 139 | Ga0070679_100743704 | 3300005530 | Bacteria | 923 |
| 140 | Ga0070679_100876830 | 3300005530 | Bacteria | 841 |
| 141 | Ga0070684_100008399 | 3300005535 | Bacteria | 8067 |
| 142 | Ga0070684_100167686 | 3300005535 | Bacteria | 1994 |
| 143 | Ga0070684_101236178 | 3300005535 | Bacteria | 703 |
| 144 | Ga0068853_100083711 | 3300005539 | Bacteria | 2795 |
| 145 | Ga0068853_100304238 | 3300005539 | Bacteria | 1474 |
| 146 | Ga0068853_100699513 | 3300005539 | Bacteria | 967 |
| 147 | Ga0068853_101209706 | 3300005539 | Bacteria | 729 |
| 148 | Ga0068853_101684408 | 3300005539 | Bacteria | 615 |
| 149 | Ga0070672_100012165 | 3300005543 | Bacteria | 6029 |
| 150 | Ga0070672_100059526 | 3300005543 | Bacteria | 3005 |
| 151 | Ga0070672_100141674 | 3300005543 | Bacteria | 1983 |
| 152 | Ga0070672_100816723 | 3300005543 | Bacteria | 821 |
| 153 | Ga0070672_101297178 | 3300005543 | Unclassified | 650 |
| 154 | Ga0070686_100045395 | 3300005544 | Bacteria | 2767 |
| 155 | Ga0070686_100718183 | 3300005544 | Bacteria | 798 |
| 156 | Ga0070696_100770705 | 3300005546 | Bacteria | 790 |
| 157 | Ga0070693_100110410 | 3300005547 | Bacteria | 1691 |
| 158 | Ga0070693_100127685 | 3300005547 | Bacteria | 1585 |
| 159 | Ga0070665_100002836 | 3300005548 | Bacteria | 18755 |
| 160 | Ga0070665_100020991 | 3300005548 | Bacteria | 6566 |
| 161 | Ga0070665_100090862 | 3300005548 | Bacteria | 3059 |
| 162 | Ga0070665_100361634 | 3300005548 | Bacteria | 1457 |
| 163 | Ga0070665_100394107 | 3300005548 | Bacteria | 1392 |
| 164 | Ga0070665_100414850 | 3300005548 | Bacteria | 1355 |
| 165 | Ga0070665_100954742 | 3300005548 | Bacteria | 870 |
| 166 | Ga0070665_101004452 | 3300005548 | Bacteria | 846 |
| 167 | Ga0070665_102292314 | 3300005548 | Bacteria | 543 |
| 168 | Ga0070704_101806829 | 3300005549 | Bacteria | 566 |
| 169 | Ga0068855_100048966 | 3300005563 | Bacteria | 4986 |
| 170 | Ga0068855_100118628 | 3300005563 | Bacteria | 3030 |
| 171 | Ga0068855_100382227 | 3300005563 | Bacteria | 1546 |
| 172 | Ga0068855_100424140 | 3300005563 | Bacteria | 1454 |
| 173 | Ga0068855_100578959 | 3300005563 | Bacteria | 1213 |
| 174 | Ga0068855_100885109 | 3300005563 | Bacteria | 944 |
| 175 | Ga0068855_100953314 | 3300005563 | Bacteria | 904 |
| 176 | Ga0068855_101221266 | 3300005563 | Bacteria | 781 |
| 177 | Ga0068855_101249644 | 3300005563 | Bacteria | 770 |
| 178 | Ga0070664_100055443 | 3300005564 | Bacteria | 3365 |
| 179 | Ga0070664_100724271 | 3300005564 | Bacteria | 928 |
| 180 | Ga0070664_101159151 | 3300005564 | Bacteria | 728 |
| 181 | Ga0070664_101184430 | 3300005564 | Bacteria | 721 |
| 182 | Ga0070664_101988826 | 3300005564 | Bacteria | 552 |
| 183 | Ga0068857_100050231 | 3300005577 | Bacteria | 3700 |
| 184 | Ga0068857_100076130 | 3300005577 | Bacteria | 2992 |
| 185 | Ga0068857_100787166 | 3300005577 | Bacteria | 907 |
| 186 | Ga0068857_100828220 | 3300005577 | Bacteria | 885 |
| 187 | Ga0068857_101349550 | 3300005577 | Bacteria | 693 |
| 188 | Ga0068854_100132186 | 3300005578 | Bacteria | 1907 |
| 189 | Ga0068854_100181384 | 3300005578 | Bacteria | 1645 |
| 190 | Ga0068854_100293190 | 3300005578 | Bacteria | 1313 |
| 191 | Ga0068856_100115016 | 3300005614 | Bacteria | 2689 |
| 192 | Ga0068856_100141100 | 3300005614 | Bacteria | 2416 |
| 193 | Ga0068856_100604436 | 3300005614 | Bacteria | 1118 |
| 194 | Ga0068856_100720495 | 3300005614 | Bacteria | 1018 |
| 195 | Ga0068856_101739441 | 3300005614 | Bacteria | 636 |
| 196 | Ga0070702_100012071 | 3300005615 | Bacteria | 4317 |
| 197 | Ga0070702_100314450 | 3300005615 | Bacteria | 1089 |
| 198 | Ga0068852_100009742 | 3300005616 | Bacteria | 7142 |
| 199 | Ga0068852_100027366 | 3300005616 | Bacteria | 4647 |
| 200 | Ga0068852_100197310 | 3300005616 | Bacteria | 1903 |
| 201 | Ga0068852_100243561 | 3300005616 | Bacteria | 1720 |
| 202 | Ga0068852_100801266 | 3300005616 | Bacteria | 956 |
| 203 | Ga0068859_100068797 | 3300005617 | Bacteria | 3575 |
| 204 | Ga0068859_100280933 | 3300005617 | Bacteria | 1757 |
| 205 | Ga0068859_100760486 | 3300005617 | Bacteria | 1058 |
| 206 | Ga0068859_100871492 | 3300005617 | Bacteria | 986 |
| 207 | Ga0068859_100998106 | 3300005617 | Bacteria | 919 |
| 208 | Ga0068859_101513048 | 3300005617 | Bacteria | 741 |
| 209 | Ga0068864_100183815 | 3300005618 | Bacteria | 1913 |
| 210 | Ga0068864_100377581 | 3300005618 | Bacteria | 1342 |
| 211 | Ga0068864_100531768 | 3300005618 | Bacteria | 1134 |
| 212 | Ga0068864_101432327 | 3300005618 | Bacteria | 693 |
| 213 | Ga0068866_10067829 | 3300005718 | Bacteria | 1874 |
| 214 | Ga0068866_10076509 | 3300005718 | Bacteria | 1785 |
| 215 | Ga0068866_10112938 | 3300005718 | Bacteria | 1519 |
| 216 | Ga0068866_10941699 | 3300005718 | Bacteria | 610 |
| 217 | Ga0068866_10975709 | 3300005718 | Bacteria | 601 |
| 218 | Ga0068861_100026582 | 3300005719 | Bacteria | 4209 |
| 219 | Ga0068861_100121826 | 3300005719 | Bacteria | 2105 |
| 220 | Ga0068861_100646204 | 3300005719 | Bacteria | 977 |
| 221 | Ga0068861_100650641 | 3300005719 | Bacteria | 974 |
| 222 | Ga0068870_10148608 | 3300005840 | Bacteria | 1378 |
| 223 | Ga0068870_10237005 | 3300005840 | Bacteria | 1125 |
| 224 | Ga0068870_10281989 | 3300005840 | Bacteria | 1042 |
| 225 | Ga0068870_10326224 | 3300005840 | Bacteria | 977 |
| 226 | Ga0068870_11111921 | 3300005840 | Bacteria | 569 |
| 227 | Ga0068863_100178497 | 3300005841 | Bacteria | 2038 |
| 228 | Ga0068863_100883288 | 3300005841 | Bacteria | 894 |
| 229 | Ga0068858_100207125 | 3300005842 | Bacteria | 1855 |
| 230 | Ga0068858_100523554 | 3300005842 | Bacteria | 1147 |
| 231 | Ga0068858_100655991 | 3300005842 | Bacteria | 1020 |
| 232 | Ga0068858_101090867 | 3300005842 | Bacteria | 784 |
| 233 | Ga0068858_101203786 | 3300005842 | Bacteria | 745 |
| 234 | Ga0068860_100184261 | 3300005843 | Bacteria | 2018 |
| 235 | Ga0068860_100254850 | 3300005843 | Bacteria | 1709 |
| 236 | Ga0068860_100721029 | 3300005843 | Bacteria | 1008 |
| 237 | Ga0068860_100811235 | 3300005843 | Bacteria | 949 |
| 238 | Ga0068862_100054909 | 3300005844 | Bacteria | 3411 |
| 239 | Ga0068862_100401356 | 3300005844 | Bacteria | 1282 |
| 240 | Ga0068862_100429423 | 3300005844 | Bacteria | 1241 |
| 241 | Ga0081455_10005318 | 3300005937 | Bacteria | 14137 |
| 242 | Ga0081455_10050771 | 3300005937 | Bacteria | 3563 |
| 243 | Ga0081455_10221734 | 3300005937 | Bacteria | 1401 |
| 244 | Ga0081540_1010304 | 3300005983 | Bacteria | 6341 |
| 245 | Ga0081540_1017033 | 3300005983 | Bacteria | 4516 |
| 246 | Ga0081540_1336585 | 3300005983 | Bacteria | 517 |
| 247 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 248 | Ga0081539_10033177 | 3300005985 | Bacteria | 3150 |
| 249 | Ga0081539_10158269 | 3300005985 | Bacteria | 1082 |
| 250 | Ga0075365_10006261 | 3300006038 | Bacteria | 6528 |
| 251 | Ga0075365_10093449 | 3300006038 | Bacteria | 2052 |
| 252 | Ga0075365_10161152 | 3300006038 | Bacteria | 1563 |
| 253 | Ga0075365_10391589 | 3300006038 | Bacteria | 980 |
| 254 | Ga0075365_10638562 | 3300006038 | Bacteria | 752 |
| 255 | Ga0075368_10125154 | 3300006042 | Bacteria | 1066 |
| 256 | Ga0075368_10155787 | 3300006042 | Bacteria | 955 |
| 257 | Ga0075368_10418012 | 3300006042 | Bacteria | 591 |
| 258 | Ga0075363_100017307 | 3300006048 | Bacteria | 3572 |
| 259 | Ga0075363_100039953 | 3300006048 | Bacteria | 2472 |
| 260 | Ga0075363_100337333 | 3300006048 | Bacteria | 879 |
| 261 | Ga0075364_10014626 | 3300006051 | Bacteria | 4852 |
| 262 | Ga0075364_10036555 | 3300006051 | Bacteria | 3175 |
| 263 | Ga0075364_10047544 | 3300006051 | Bacteria | 2795 |
| 264 | Ga0075364_10141493 | 3300006051 | Bacteria | 1618 |
| 265 | Ga0075364_10716470 | 3300006051 | Bacteria | 683 |
| 266 | Ga0070712_100537832 | 3300006175 | Bacteria | 983 |
| 267 | Ga0070712_100759626 | 3300006175 | Bacteria | 830 |
| 268 | Ga0075362_10042082 | 3300006177 | Bacteria | 2018 |
| 269 | Ga0075362_10133856 | 3300006177 | Bacteria | 1181 |
| 270 | Ga0075362_10202294 | 3300006177 | Bacteria | 967 |
| 271 | Ga0075362_10230203 | 3300006177 | Bacteria | 907 |
| 272 | Ga0075362_10551560 | 3300006177 | Bacteria | 593 |
| 273 | Ga0075367_10297684 | 3300006178 | Bacteria | 1015 |
| 274 | Ga0075367_10305623 | 3300006178 | Bacteria | 1001 |
| 275 | Ga0075367_10528756 | 3300006178 | Bacteria | 749 |
| 276 | Ga0075367_11029911 | 3300006178 | Bacteria | 526 |
| 277 | Ga0075369_10058083 | 3300006186 | Bacteria | 1684 |
| 278 | Ga0075369_10070652 | 3300006186 | Bacteria | 1536 |
| 279 | Ga0075366_10001094 | 3300006195 | Bacteria | 13300 |
| 280 | Ga0075366_10215725 | 3300006195 | Bacteria | 1169 |
| 281 | Ga0075366_10270509 | 3300006195 | Bacteria | 1038 |
| 282 | Ga0075366_10298268 | 3300006195 | Bacteria | 986 |
| 283 | Ga0075366_10466057 | 3300006195 | Bacteria | 780 |
| 284 | Ga0097621_100035743 | 3300006237 | Bacteria | 3971 |
| 285 | Ga0097621_100055409 | 3300006237 | Bacteria | 3237 |
| 286 | Ga0097621_100056750 | 3300006237 | Bacteria | 3200 |
| 287 | Ga0097621_100232958 | 3300006237 | Unclassified | 1608 |
| 288 | Ga0097621_100261967 | 3300006237 | Bacteria | 1517 |
| 289 | Ga0097621_101122735 | 3300006237 | Bacteria | 739 |
| 290 | Ga0097621_101189075 | 3300006237 | Bacteria | 718 |
| 291 | Ga0075370_10121882 | 3300006353 | Bacteria | 1518 |
| 292 | Ga0075370_10307095 | 3300006353 | Bacteria | 944 |
| 293 | Ga0075370_10310308 | 3300006353 | Bacteria | 939 |
| 294 | Ga0075370_10354444 | 3300006353 | Bacteria | 877 |
| 295 | Ga0075370_10428933 | 3300006353 | Bacteria | 794 |
| 296 | Ga0068871_100090290 | 3300006358 | Bacteria | 2551 |
| 297 | Ga0068871_100315688 | 3300006358 | Bacteria | 1375 |
| 298 | Ga0068871_100369057 | 3300006358 | Bacteria | 1273 |
| 299 | Ga0068871_100438932 | 3300006358 | Bacteria | 1168 |
| 300 | Ga0068871_100868243 | 3300006358 | Bacteria | 835 |
| 301 | Ga0075428_100843747 | 3300006844 | Bacteria | 973 |
| 302 | Ga0075428_102153653 | 3300006844 | Bacteria | 576 |
| 303 | Ga0075431_100991661 | 3300006847 | Bacteria | 807 |
| 304 | Ga0075434_100304337 | 3300006871 | Bacteria | 1614 |
| 305 | Ga0075434_100890683 | 3300006871 | Bacteria | 905 |
| 306 | Ga0075429_100660807 | 3300006880 | Bacteria | 916 |
| 307 | Ga0068865_100029057 | 3300006881 | Bacteria | 3664 |
| 308 | Ga0068865_100096067 | 3300006881 | Bacteria | 2160 |
| 309 | Ga0068865_100166160 | 3300006881 | Bacteria | 1687 |
| 310 | Ga0068865_100889627 | 3300006881 | Bacteria | 774 |
| 311 | Ga0068865_101396759 | 3300006881 | Bacteria | 625 |
| 312 | Ga0075436_100119212 | 3300006914 | Bacteria | 1845 |
| 313 | Ga0097620_100068794 | 3300006931 | Bacteria | 3575 |
| 314 | Ga0097620_100280945 | 3300006931 | Bacteria | 1757 |
| 315 | Ga0097620_100760482 | 3300006931 | Bacteria | 1058 |
| 316 | Ga0097620_100871523 | 3300006931 | Bacteria | 986 |
| 317 | Ga0097620_100998217 | 3300006931 | Bacteria | 919 |
| 318 | Ga0097620_101512944 | 3300006931 | Bacteria | 741 |
| 319 | Ga0099825_1018382 | 3300006941 | Bacteria | 5461 |
| 320 | Ga0099824_1026579 | 3300006942 | Bacteria | 2956 |
| 321 | Ga0099823_1033130 | 3300006944 | Bacteria | 4164 |
| 322 | Ga0075435_100114100 | 3300007076 | Bacteria | 2249 |
| 323 | Ga0075435_100155415 | 3300007076 | Bacteria | 1924 |
| 324 | Ga0099795_10065487 | 3300007788 | Bacteria | 1359 |
| 325 | Ga0105250_10045585 | 3300009092 | Bacteria | 1758 |
| 326 | Ga0105240_10013828 | 3300009093 | Bacteria | 11055 |
| 327 | Ga0105240_10027519 | 3300009093 | Bacteria | 7441 |
| 328 | Ga0105240_10044366 | 3300009093 | Bacteria | 5650 |
| 329 | Ga0105240_10138125 | 3300009093 | Bacteria | 2916 |
| 330 | Ga0105240_10262166 | 3300009093 | Bacteria | 1993 |
| 331 | Ga0105240_10440058 | 3300009093 | Bacteria | 1461 |
| 332 | Ga0105240_12380091 | 3300009093 | Bacteria | 548 |
| 333 | Ga0111539_10188422 | 3300009094 | Bacteria | 2408 |
| 334 | Ga0111539_10659240 | 3300009094 | Bacteria | 1218 |
| 335 | Ga0111539_11053311 | 3300009094 | Bacteria | 945 |
| 336 | Ga0105245_10009595 | 3300009098 | Bacteria | 8440 |
| 337 | Ga0105245_10050761 | 3300009098 | Bacteria | 3719 |
| 338 | Ga0105245_10078640 | 3300009098 | Bacteria | 3010 |
| 339 | Ga0105245_10522359 | 3300009098 | Bacteria | 1206 |
| 340 | Ga0105245_10542236 | 3300009098 | Bacteria | 1184 |
| 341 | Ga0105245_10607399 | 3300009098 | Bacteria | 1121 |
| 342 | Ga0105247_10085968 | 3300009101 | Bacteria | 1990 |
| 343 | Ga0105247_10181627 | 3300009101 | Bacteria | 1404 |
| 344 | Ga0105247_10181866 | 3300009101 | Bacteria | 1403 |
| 345 | Ga0105247_10192544 | 3300009101 | Bacteria | 1366 |
| 346 | Ga0105247_10202702 | 3300009101 | Bacteria | 1334 |
| 347 | Ga0105247_10240311 | 3300009101 | Bacteria | 1234 |
| 348 | Ga0105247_10282214 | 3300009101 | Bacteria | 1146 |
| 349 | Ga0105247_10382440 | 3300009101 | Bacteria | 998 |
| 350 | Ga0105247_10602714 | 3300009101 | Bacteria | 815 |
| 351 | Ga0114129_10945285 | 3300009147 | Bacteria | 1089 |
| 352 | Ga0114129_11426653 | 3300009147 | Bacteria | 853 |
| 353 | Ga0105243_10115754 | 3300009148 | Bacteria | 2252 |
| 354 | Ga0105243_10480224 | 3300009148 | Bacteria | 1173 |
| 355 | Ga0105243_10545240 | 3300009148 | Bacteria | 1107 |
| 356 | Ga0105243_11234157 | 3300009148 | Bacteria | 762 |
| 357 | Ga0105243_11286594 | 3300009148 | Bacteria | 748 |
| 358 | Ga0105243_12080973 | 3300009148 | Bacteria | 603 |
| 359 | Ga0105241_10018533 | 3300009174 | Bacteria | 5120 |
| 360 | Ga0105241_10030488 | 3300009174 | Bacteria | 4031 |
| 361 | Ga0105241_10044097 | 3300009174 | Bacteria | 3379 |
| 362 | Ga0105241_10077496 | 3300009174 | Bacteria | 2595 |
| 363 | Ga0105241_11839943 | 3300009174 | Bacteria | 592 |
| 364 | Ga0105241_11869337 | 3300009174 | Unclassified | 588 |
| 365 | Ga0105242_10031555 | 3300009176 | Bacteria | 4233 |
| 366 | Ga0105242_10232529 | 3300009176 | Bacteria | 1653 |
| 367 | Ga0105242_10236710 | 3300009176 | Bacteria | 1639 |
| 368 | Ga0105242_10343904 | 3300009176 | Bacteria | 1375 |
| 369 | Ga0105242_10522963 | 3300009176 | Bacteria | 1132 |
| 370 | Ga0105248_10031653 | 3300009177 | Bacteria | 5910 |
| 371 | Ga0105248_10260831 | 3300009177 | Bacteria | 1951 |
| 372 | Ga0105248_10308481 | 3300009177 | Bacteria | 1782 |
| 373 | Ga0105248_10385201 | 3300009177 | Bacteria | 1579 |
| 374 | Ga0105248_10683491 | 3300009177 | Bacteria | 1158 |
| 375 | Ga0105248_10755529 | 3300009177 | Bacteria | 1097 |
| 376 | Ga0105248_10805331 | 3300009177 | Bacteria | 1060 |
| 377 | Ga0105248_10833276 | 3300009177 | Bacteria | 1041 |
| 378 | Ga0105248_11274679 | 3300009177 | Bacteria | 831 |
| 379 | Ga0105237_10003348 | 3300009545 | Bacteria | 19080 |
| 380 | Ga0105237_10091843 | 3300009545 | Bacteria | 3026 |
| 381 | Ga0105237_10097904 | 3300009545 | Bacteria | 2924 |
| 382 | Ga0105237_10202631 | 3300009545 | Bacteria | 1985 |
| 383 | Ga0105237_10359153 | 3300009545 | Bacteria | 1461 |
| 384 | Ga0105237_10487553 | 3300009545 | Bacteria | 1239 |
| 385 | Ga0105237_10774716 | 3300009545 | Bacteria | 966 |
| 386 | Ga0105237_10898197 | 3300009545 | Bacteria | 893 |
| 387 | Ga0105237_10906613 | 3300009545 | Bacteria | 888 |
| 388 | Ga0105237_11226549 | 3300009545 | Bacteria | 756 |
| 389 | Ga0105238_10079817 | 3300009551 | Bacteria | 3262 |
| 390 | Ga0105238_10484653 | 3300009551 | Bacteria | 1236 |
| 391 | Ga0105238_10561912 | 3300009551 | Bacteria | 1146 |
| 392 | Ga0105238_10831399 | 3300009551 | Bacteria | 940 |
| 393 | Ga0105249_10302860 | 3300009553 | Bacteria | 1604 |
| 394 | Ga0105249_10440733 | 3300009553 | Bacteria | 1340 |
| 395 | Ga0105249_10898227 | 3300009553 | Bacteria | 953 |
| 396 | Ga0105249_11771734 | 3300009553 | Bacteria | 690 |
| 397 | Ga0105239_10018332 | 3300010375 | Bacteria | 7738 |
| 398 | Ga0105239_10104301 | 3300010375 | Bacteria | 3139 |
| 399 | Ga0105239_10131922 | 3300010375 | Bacteria | 2780 |
| 400 | Ga0105239_10149301 | 3300010375 | Bacteria | 2608 |
| 401 | Ga0105239_10295644 | 3300010375 | Bacteria | 1823 |
| 402 | Ga0105239_10511702 | 3300010375 | Bacteria | 1365 |
| 403 | Ga0105239_10530521 | 3300010375 | Bacteria | 1340 |
| 404 | Ga0105239_10532014 | 3300010375 | Bacteria | 1338 |
| 405 | Ga0105239_10840982 | 3300010375 | Bacteria | 1052 |
| 406 | Ga0105239_10952383 | 3300010375 | Bacteria | 986 |
| 407 | Ga0105239_10973716 | 3300010375 | Bacteria | 975 |
| 408 | Ga0105239_11279412 | 3300010375 | Bacteria | 846 |
| 409 | Ga0105239_11965021 | 3300010375 | Bacteria | 679 |
| 410 | Ga0105246_10038063 | 3300011119 | Bacteria | 3231 |
| 411 | Ga0105246_10088764 | 3300011119 | Bacteria | 2222 |
| 412 | Ga0105246_10115570 | 3300011119 | Bacteria | 1979 |
| 413 | Ga0105246_10136061 | 3300011119 | Bacteria | 1842 |
| 414 | Ga0105246_10579784 | 3300011119 | Bacteria | 966 |
| 415 | Ga0105246_10761716 | 3300011119 | Bacteria | 855 |
| 416 | Ga0105246_10818123 | 3300011119 | Bacteria | 828 |
| 417 | Ga0105246_12280998 | 3300011119 | Bacteria | 528 |
| 418 | Ga0157345_1006877 | 3300012498 | Bacteria | 916 |
| 419 | Ga0157313_1011018 | 3300012503 | Bacteria | 778 |
| 420 | Ga0157373_10458265 | 3300013100 | Bacteria | 918 |
| 421 | Ga0157373_10515056 | 3300013100 | Bacteria | 865 |
| 422 | Ga0157371_10201583 | 3300013102 | Bacteria | 1426 |
| 423 | Ga0157371_10390220 | 3300013102 | Bacteria | 1017 |
| 424 | Ga0157370_10200281 | 3300013104 | Bacteria | 1852 |
| 425 | Ga0157370_10700278 | 3300013104 | Bacteria | 925 |
| 426 | Ga0157370_10718813 | 3300013104 | Bacteria | 911 |
| 427 | Ga0157369_10006967 | 3300013105 | Bacteria | 13032 |
| 428 | Ga0157369_10029245 | 3300013105 | Bacteria | 6090 |
| 429 | Ga0157369_10231572 | 3300013105 | Bacteria | 1931 |
| 430 | Ga0157369_10252747 | 3300013105 | Bacteria | 1839 |
| 431 | Ga0157374_10024124 | 3300013296 | Bacteria | 5449 |
| 432 | Ga0157374_10068209 | 3300013296 | Unclassified | 3346 |
| 433 | Ga0157374_10296880 | 3300013296 | Bacteria | 1598 |
| 434 | Ga0157374_10432369 | 3300013296 | Bacteria | 1316 |
| 435 | Ga0157374_11052100 | 3300013296 | Bacteria | 834 |
| 436 | Ga0157374_11095515 | 3300013296 | Bacteria | 817 |
| 437 | Ga0157374_11262369 | 3300013296 | Bacteria | 760 |
| 438 | Ga0157374_11594968 | 3300013296 | Bacteria | 677 |
| 439 | Ga0157374_11623872 | 3300013296 | Bacteria | 671 |
| 440 | Ga0157378_10154622 | 3300013297 | Bacteria | 2139 |
| 441 | Ga0157378_10232677 | 3300013297 | Bacteria | 1757 |
| 442 | Ga0157378_10249166 | 3300013297 | Bacteria | 1700 |
| 443 | Ga0157378_10255428 | 3300013297 | Bacteria | 1679 |
| 444 | Ga0157378_10257551 | 3300013297 | Bacteria | 1673 |
| 445 | Ga0163162_10059973 | 3300013306 | Bacteria | 3838 |
| 446 | Ga0163162_10428584 | 3300013306 | Bacteria | 1455 |
| 447 | Ga0163162_10608268 | 3300013306 | Bacteria | 1219 |
| 448 | Ga0163162_10644818 | 3300013306 | Bacteria | 1183 |
| 449 | Ga0163162_10731650 | 3300013306 | Bacteria | 1109 |
| 450 | Ga0163162_10735665 | 3300013306 | Bacteria | 1106 |
| 451 | Ga0163162_10849319 | 3300013306 | Bacteria | 1028 |
| 452 | Ga0163162_11144359 | 3300013306 | Bacteria | 882 |
| 453 | Ga0163162_11157027 | 3300013306 | Bacteria | 877 |
| 454 | Ga0157372_10038207 | 3300013307 | Bacteria | 5298 |
| 455 | Ga0157372_10410606 | 3300013307 | Bacteria | 1578 |
| 456 | Ga0157372_10549398 | 3300013307 | Bacteria | 1346 |
| 457 | Ga0157372_10756343 | 3300013307 | Bacteria | 1130 |
| 458 | Ga0157372_10877840 | 3300013307 | Bacteria | 1041 |
| 459 | Ga0157375_10010993 | 3300013308 | Bacteria | 7983 |
| 460 | Ga0157375_10101270 | 3300013308 | Bacteria | 2963 |
| 461 | Ga0157375_10598315 | 3300013308 | Bacteria | 1262 |
| 462 | Ga0157375_10672554 | 3300013308 | Bacteria | 1190 |
| 463 | Ga0157375_10745630 | 3300013308 | Bacteria | 1131 |
| 464 | Ga0157375_11334070 | 3300013308 | Bacteria | 844 |
| 465 | Ga0163163_10006916 | 3300014325 | Bacteria | 9958 |
| 466 | Ga0163163_10062028 | 3300014325 | Bacteria | 3704 |
| 467 | Ga0163163_10341962 | 3300014325 | Bacteria | 1552 |
| 468 | Ga0163163_10536097 | 3300014325 | Bacteria | 1233 |
| 469 | Ga0163163_10652628 | 3300014325 | Bacteria | 1116 |
| 470 | Ga0163163_11007505 | 3300014325 | Bacteria | 896 |
| 471 | Ga0163163_11908193 | 3300014325 | Bacteria | 654 |
| 472 | Ga0163163_12815287 | 3300014325 | Bacteria | 543 |
| 473 | Ga0157380_10100918 | 3300014326 | Bacteria | 2404 |
| 474 | Ga0157380_11033756 | 3300014326 | Bacteria | 857 |
| 475 | Ga0157380_11561973 | 3300014326 | Bacteria | 714 |
| 476 | Ga0182008_10663247 | 3300014497 | Bacteria | 592 |
| 477 | Ga0157377_10026554 | 3300014745 | Bacteria | 3100 |
| 478 | Ga0157377_10338862 | 3300014745 | Bacteria | 1005 |
| 479 | Ga0157379_10296259 | 3300014968 | Bacteria | 1474 |
| 480 | Ga0157379_10340773 | 3300014968 | Bacteria | 1371 |
| 481 | Ga0157379_10388144 | 3300014968 | Bacteria | 1282 |
| 482 | Ga0157379_10714271 | 3300014968 | Bacteria | 941 |
| 483 | Ga0157376_10008762 | 3300014969 | Bacteria | 7315 |
| 484 | Ga0157376_10012225 | 3300014969 | Bacteria | 6364 |
| 485 | Ga0157376_10049941 | 3300014969 | Bacteria | 3467 |
| 486 | Ga0157376_10269468 | 3300014969 | Bacteria | 1599 |
| 487 | Ga0157376_11093359 | 3300014969 | Bacteria | 823 |
| 488 | Ga0157376_11780286 | 3300014969 | Bacteria | 652 |
| 489 | Ga0182007_10252909 | 3300015262 | Bacteria | 633 |
| 490 | Ga0163161_10155939 | 3300017792 | Bacteria | 1738 |
| 491 | Ga0163161_10160410 | 3300017792 | Bacteria | 1714 |
| 492 | Ga0163161_10194624 | 3300017792 | Bacteria | 1560 |
| 493 | Ga0163161_10756901 | 3300017792 | Bacteria | 813 |
| 494 | Ga0163161_10788628 | 3300017792 | Bacteria | 797 |
| 495 | Ga0163161_11800366 | 3300017792 | Bacteria | 544 |
| 496 | Ga0197907_10464309 | 3300020069 | Bacteria | 555 |
| 497 | Ga0197907_10526031 | 3300020069 | Bacteria | 1464 |
| 498 | Ga0197907_10831135 | 3300020069 | Bacteria | 596 |
| 499 | Ga0206356_10656885 | 3300020070 | Bacteria | 1285 |
| 500 | Ga0206356_11377276 | 3300020070 | Bacteria | 723 |
| 501 | Ga0206356_11842844 | 3300020070 | Bacteria | 737 |
| 502 | Ga0206351_10675134 | 3300020077 | Bacteria | 512 |
| 503 | Ga0206352_10265531 | 3300020078 | Bacteria | 658 |
| 504 | Ga0206352_10786040 | 3300020078 | Bacteria | 543 |
| 505 | Ga0206350_10535223 | 3300020080 | Bacteria | 678 |
| 506 | Ga0206353_10765933 | 3300020082 | Bacteria | 549 |
| 507 | Ga0206353_10960214 | 3300020082 | Bacteria | 716 |
| 508 | Ga0213874_10029949 | 3300021377 | Bacteria | 1565 |
| 509 | Ga0213876_10013409 | 3300021384 | Bacteria | 4354 |
| 510 | Ga0213876_10025379 | 3300021384 | Bacteria | 3127 |
| 511 | Ga0224712_10641122 | 3300022467 | Bacteria | 520 |
| 512 | Ga0209563_110550 | 3300025230 | Bacteria | 1341 |
| 513 | Ga0209677_102452 | 3300025253 | Bacteria | 6965 |
| 514 | Ga0209148_1002608 | 3300025254 | Bacteria | 5894 |
| 515 | Ga0209233_1001880 | 3300025261 | Bacteria | 8058 |
| 516 | Ga0209233_1010217 | 3300025261 | Bacteria | 2823 |
| 517 | Ga0209455_1000714 | 3300025272 | Bacteria | 19245 |
| 518 | Ga0209673_1027816 | 3300025273 | Bacteria | 1832 |
| 519 | Ga0209564_1004469 | 3300025295 | Bacteria | 8541 |
| 520 | Ga0209564_1013773 | 3300025295 | Bacteria | 3408 |
| 521 | Ga0209564_1013929 | 3300025295 | Bacteria | 3378 |
| 522 | Ga0209758_1000141 | 3300025297 | Bacteria | 172481 |
| 523 | Ga0209758_1002921 | 3300025297 | Bacteria | 16464 |
| 524 | Ga0209758_1003483 | 3300025297 | Bacteria | 14255 |
| 525 | Ga0209758_1004079 | 3300025297 | Bacteria | 12557 |
| 526 | Ga0209758_1020105 | 3300025297 | Bacteria | 3179 |
| 527 | Ga0209758_1082898 | 3300025297 | Bacteria | 963 |
| 528 | Ga0209758_1129680 | 3300025297 | Bacteria | 668 |
| 529 | Ga0209256_1002956 | 3300025299 | Bacteria | 12733 |
| 530 | Ga0207426_1000437 | 3300025302 | Bacteria | 67439 |
| 531 | Ga0207426_1001139 | 3300025302 | Bacteria | 24022 |
| 532 | Ga0207426_1008512 | 3300025302 | Bacteria | 4128 |
| 533 | Ga0207426_1014295 | 3300025302 | Bacteria | 2911 |
| 534 | Ga0207426_1027953 | 3300025302 | Bacteria | 1873 |
| 535 | Ga0209051_1022867 | 3300025303 | Bacteria | 2617 |
| 536 | Ga0209257_1006467 | 3300025304 | Bacteria | 7527 |
| 537 | Ga0209257_1041881 | 3300025304 | Bacteria | 1355 |
| 538 | Ga0207697_10090616 | 3300025315 | Bacteria | 1296 |
| 539 | Ga0207697_10161404 | 3300025315 | Bacteria | 978 |
| 540 | Ga0207697_10349939 | 3300025315 | Bacteria | 656 |
| 541 | Ga0207696_1163742 | 3300025711 | Bacteria | 591 |
| 542 | Ga0207682_10003043 | 3300025893 | Bacteria | 7362 |
| 543 | Ga0207692_10612950 | 3300025898 | Bacteria | 701 |
| 544 | Ga0207642_10012062 | 3300025899 | Bacteria | 3108 |
| 545 | Ga0207642_10209809 | 3300025899 | Bacteria | 1081 |
| 546 | Ga0207710_10213592 | 3300025900 | Bacteria | 956 |
| 547 | Ga0207710_10265723 | 3300025900 | Bacteria | 861 |
| 548 | Ga0207710_10309245 | 3300025900 | Bacteria | 800 |
| 549 | Ga0207710_10314634 | 3300025900 | Bacteria | 793 |
| 550 | Ga0207688_10020261 | 3300025901 | Bacteria | 3630 |
| 551 | Ga0207688_10021578 | 3300025901 | Bacteria | 3520 |
| 552 | Ga0207688_10025537 | 3300025901 | Bacteria | 3245 |
| 553 | Ga0207688_10211763 | 3300025901 | Bacteria | 1165 |
| 554 | Ga0207680_10085545 | 3300025903 | Bacteria | 1992 |
| 555 | Ga0207680_10265851 | 3300025903 | Bacteria | 1188 |
| 556 | Ga0207680_10850649 | 3300025903 | Bacteria | 654 |
| 557 | Ga0207647_10044022 | 3300025904 | Bacteria | 2791 |
| 558 | Ga0207647_10097140 | 3300025904 | Bacteria | 1752 |
| 559 | Ga0207647_10218637 | 3300025904 | Bacteria | 1098 |
| 560 | Ga0207645_10019706 | 3300025907 | Bacteria | 4421 |
| 561 | Ga0207645_10057779 | 3300025907 | Bacteria | 2477 |
| 562 | Ga0207645_10091167 | 3300025907 | Bacteria | 1960 |
| 563 | Ga0207645_10172579 | 3300025907 | Bacteria | 1418 |
| 564 | Ga0207645_10269356 | 3300025907 | Bacteria | 1129 |
| 565 | Ga0207645_10290778 | 3300025907 | Bacteria | 1087 |
| 566 | Ga0207645_10473006 | 3300025907 | Bacteria | 847 |
| 567 | Ga0207643_10626496 | 3300025908 | Bacteria | 693 |
| 568 | Ga0207705_10259019 | 3300025909 | Bacteria | 1328 |
| 569 | Ga0207705_10373921 | 3300025909 | Bacteria | 1100 |
| 570 | Ga0207654_10039611 | 3300025911 | Bacteria | 2651 |
| 571 | Ga0207654_10045872 | 3300025911 | Bacteria | 2490 |
| 572 | Ga0207654_10149230 | 3300025911 | Bacteria | 1499 |
| 573 | Ga0207707_10000754 | 3300025912 | Bacteria | 31878 |
| 574 | Ga0207707_10191557 | 3300025912 | Bacteria | 1784 |
| 575 | Ga0207707_10219014 | 3300025912 | Bacteria | 1657 |
| 576 | Ga0207707_10530243 | 3300025912 | Bacteria | 1002 |
| 577 | Ga0207695_10000062 | 3300025913 | Bacteria | 351979 |
| 578 | Ga0207695_10050638 | 3300025913 | Bacteria | 4367 |
| 579 | Ga0207671_10001897 | 3300025914 | Bacteria | 23245 |
| 580 | Ga0207671_10051511 | 3300025914 | Bacteria | 3051 |
| 581 | Ga0207671_10060968 | 3300025914 | Bacteria | 2799 |
| 582 | Ga0207693_10159079 | 3300025915 | Bacteria | 1777 |
| 583 | Ga0207693_10591358 | 3300025915 | Bacteria | 864 |
| 584 | Ga0207693_11166919 | 3300025915 | Bacteria | 582 |
| 585 | Ga0207663_10705132 | 3300025916 | Bacteria | 799 |
| 586 | Ga0207663_10922191 | 3300025916 | Bacteria | 699 |
| 587 | Ga0207660_10043144 | 3300025917 | Bacteria | 3168 |
| 588 | Ga0207660_10048371 | 3300025917 | Bacteria | 3009 |
| 589 | Ga0207660_10163794 | 3300025917 | Bacteria | 1718 |
| 590 | Ga0207662_10135318 | 3300025918 | Bacteria | 1557 |
| 591 | Ga0207662_10627391 | 3300025918 | Bacteria | 749 |
| 592 | Ga0207662_10734437 | 3300025918 | Bacteria | 693 |
| 593 | Ga0207657_10003905 | 3300025919 | Bacteria | 15817 |
| 594 | Ga0207657_10258482 | 3300025919 | Bacteria | 1386 |
| 595 | Ga0207657_10357412 | 3300025919 | Bacteria | 1151 |
| 596 | Ga0207657_11210963 | 3300025919 | Bacteria | 574 |
| 597 | Ga0207649_10072579 | 3300025920 | Bacteria | 2202 |
| 598 | Ga0207649_10121305 | 3300025920 | Bacteria | 1763 |
| 599 | Ga0207652_10005840 | 3300025921 | Bacteria | 9970 |
| 600 | Ga0207652_10029294 | 3300025921 | Bacteria | 4602 |
| 601 | Ga0207652_10193719 | 3300025921 | Bacteria | 1828 |
| 602 | Ga0207652_10333981 | 3300025921 | Bacteria | 1368 |
| 603 | Ga0207652_10558527 | 3300025921 | Bacteria | 1028 |
| 604 | Ga0207652_11396455 | 3300025921 | Bacteria | 604 |
| 605 | Ga0207646_11222457 | 3300025922 | Bacteria | 658 |
| 606 | Ga0207681_10239480 | 3300025923 | Bacteria | 1412 |
| 607 | Ga0207681_10391042 | 3300025923 | Bacteria | 1121 |
| 608 | Ga0207681_10570152 | 3300025923 | Bacteria | 933 |
| 609 | Ga0207681_10920387 | 3300025923 | Bacteria | 732 |
| 610 | Ga0207694_10273712 | 3300025924 | Bacteria | 1385 |
| 611 | Ga0207694_10350128 | 3300025924 | Bacteria | 1222 |
| 612 | Ga0207694_11004218 | 3300025924 | Bacteria | 706 |
| 613 | Ga0207694_11438027 | 3300025924 | Bacteria | 582 |
| 614 | Ga0207650_10195427 | 3300025925 | Bacteria | 1618 |
| 615 | Ga0207650_10701976 | 3300025925 | Bacteria | 855 |
| 616 | Ga0207650_10744973 | 3300025925 | Bacteria | 829 |
| 617 | Ga0207659_10070799 | 3300025926 | Bacteria | 2544 |
| 618 | Ga0207659_10329702 | 3300025926 | Bacteria | 1261 |
| 619 | Ga0207659_10350653 | 3300025926 | Bacteria | 1224 |
| 620 | Ga0207659_10611148 | 3300025926 | Bacteria | 930 |
| 621 | Ga0207659_10616588 | 3300025926 | Bacteria | 926 |
| 622 | Ga0207659_10941915 | 3300025926 | Bacteria | 743 |
| 623 | Ga0207687_10010386 | 3300025927 | Bacteria | 6084 |
| 624 | Ga0207687_10021894 | 3300025927 | Bacteria | 4249 |
| 625 | Ga0207687_10151887 | 3300025927 | Bacteria | 1768 |
| 626 | Ga0207687_10322087 | 3300025927 | Bacteria | 1252 |
| 627 | Ga0207687_10330403 | 3300025927 | Bacteria | 1236 |
| 628 | Ga0207687_11412429 | 3300025927 | Bacteria | 598 |
| 629 | Ga0207700_10447055 | 3300025928 | Bacteria | 1139 |
| 630 | Ga0207664_10582856 | 3300025929 | Bacteria | 1004 |
| 631 | Ga0207664_11406083 | 3300025929 | Bacteria | 618 |
| 632 | Ga0207644_10051283 | 3300025931 | Bacteria | 2961 |
| 633 | Ga0207644_10089423 | 3300025931 | Bacteria | 2292 |
| 634 | Ga0207644_10292458 | 3300025931 | Bacteria | 1310 |
| 635 | Ga0207644_10373385 | 3300025931 | Bacteria | 1162 |
| 636 | Ga0207644_10409760 | 3300025931 | Bacteria | 1109 |
| 637 | Ga0207644_10607914 | 3300025931 | Bacteria | 908 |
| 638 | Ga0207644_11153061 | 3300025931 | Bacteria | 651 |
| 639 | Ga0207690_10225060 | 3300025932 | Bacteria | 1437 |
| 640 | Ga0207690_10464249 | 3300025932 | Bacteria | 1019 |
| 641 | Ga0207690_10648931 | 3300025932 | Bacteria | 865 |
| 642 | Ga0207690_10984603 | 3300025932 | Bacteria | 701 |
| 643 | Ga0207690_11016117 | 3300025932 | Bacteria | 690 |
| 644 | Ga0207690_11113027 | 3300025932 | Bacteria | 658 |
| 645 | Ga0207706_10034566 | 3300025933 | Bacteria | 4496 |
| 646 | Ga0207706_10177295 | 3300025933 | Bacteria | 1872 |
| 647 | Ga0207706_10255486 | 3300025933 | Bacteria | 1530 |
| 648 | Ga0207706_11191986 | 3300025933 | Bacteria | 633 |
| 649 | Ga0207686_10070784 | 3300025934 | Bacteria | 2242 |
| 650 | Ga0207686_10339537 | 3300025934 | Bacteria | 1128 |
| 651 | Ga0207686_10379580 | 3300025934 | Bacteria | 1071 |
| 652 | Ga0207709_10075840 | 3300025935 | Bacteria | 2151 |
| 653 | Ga0207709_10456047 | 3300025935 | Bacteria | 989 |
| 654 | Ga0207709_10552107 | 3300025935 | Bacteria | 906 |
| 655 | Ga0207709_10815073 | 3300025935 | Bacteria | 754 |
| 656 | Ga0207709_10877478 | 3300025935 | Bacteria | 728 |
| 657 | Ga0207670_10796620 | 3300025936 | Bacteria | 787 |
| 658 | Ga0207669_10006478 | 3300025937 | Bacteria | 5354 |
| 659 | Ga0207669_10028974 | 3300025937 | Bacteria | 3055 |
| 660 | Ga0207669_10110785 | 3300025937 | Unclassified | 1839 |
| 661 | Ga0207669_10251934 | 3300025937 | Bacteria | 1315 |
| 662 | Ga0207704_10390159 | 3300025938 | Bacteria | 1096 |
| 663 | Ga0207704_10943309 | 3300025938 | Bacteria | 727 |
| 664 | Ga0207665_10203125 | 3300025939 | Bacteria | 1445 |
| 665 | Ga0207691_10005845 | 3300025940 | Bacteria | 11900 |
| 666 | Ga0207691_10093331 | 3300025940 | Bacteria | 2695 |
| 667 | Ga0207691_10156366 | 3300025940 | Bacteria | 2002 |
| 668 | Ga0207691_10390768 | 3300025940 | Bacteria | 1187 |
| 669 | Ga0207691_10634759 | 3300025940 | Unclassified | 903 |
| 670 | Ga0207691_10756413 | 3300025940 | Bacteria | 818 |
| 671 | Ga0207691_11593870 | 3300025940 | Bacteria | 531 |
| 672 | Ga0207711_10050250 | 3300025941 | Bacteria | 3569 |
| 673 | Ga0207711_10184988 | 3300025941 | Bacteria | 1896 |
| 674 | Ga0207711_10441642 | 3300025941 | Bacteria | 1211 |
| 675 | Ga0207711_10442707 | 3300025941 | Bacteria | 1209 |
| 676 | Ga0207711_10614434 | 3300025941 | Bacteria | 1014 |
| 677 | Ga0207689_10048255 | 3300025942 | Bacteria | 3512 |
| 678 | Ga0207689_10281584 | 3300025942 | Bacteria | 1377 |
| 679 | Ga0207689_10426439 | 3300025942 | Bacteria | 1107 |
| 680 | Ga0207661_10003055 | 3300025944 | Bacteria | 11584 |
| 681 | Ga0207661_11351331 | 3300025944 | Bacteria | 654 |
| 682 | Ga0207679_10140634 | 3300025945 | Bacteria | 1950 |
| 683 | Ga0207679_10324455 | 3300025945 | Bacteria | 1334 |
| 684 | Ga0207679_10525044 | 3300025945 | Bacteria | 1059 |
| 685 | Ga0207667_10037813 | 3300025949 | Bacteria | 5159 |
| 686 | Ga0207667_10082010 | 3300025949 | Bacteria | 3341 |
| 687 | Ga0207667_10439076 | 3300025949 | Bacteria | 1327 |
| 688 | Ga0207651_10320090 | 3300025960 | Bacteria | 1296 |
| 689 | Ga0207651_10360164 | 3300025960 | Bacteria | 1227 |
| 690 | Ga0207651_10488967 | 3300025960 | Bacteria | 1062 |
| 691 | Ga0207712_10271398 | 3300025961 | Bacteria | 1380 |
| 692 | Ga0207712_10656339 | 3300025961 | Bacteria | 912 |
| 693 | Ga0207712_10675421 | 3300025961 | Bacteria | 900 |
| 694 | Ga0207712_11087175 | 3300025961 | Bacteria | 712 |
| 695 | Ga0207668_10035749 | 3300025972 | Bacteria | 3310 |
| 696 | Ga0207668_10279303 | 3300025972 | Bacteria | 1369 |
| 697 | Ga0207668_10313641 | 3300025972 | Bacteria | 1299 |
| 698 | Ga0207668_10627425 | 3300025972 | Bacteria | 938 |
| 699 | Ga0207668_10807630 | 3300025972 | Bacteria | 831 |
| 700 | Ga0207668_11206295 | 3300025972 | Bacteria | 680 |
| 701 | Ga0207640_10090881 | 3300025981 | Bacteria | 2114 |
| 702 | Ga0207640_10337633 | 3300025981 | Bacteria | 1206 |
| 703 | Ga0207640_10510928 | 3300025981 | Bacteria | 1002 |
| 704 | Ga0207640_10903981 | 3300025981 | Bacteria | 771 |
| 705 | Ga0207658_10030927 | 3300025986 | Bacteria | 3797 |
| 706 | Ga0207658_10134571 | 3300025986 | Bacteria | 1991 |
| 707 | Ga0207658_10196013 | 3300025986 | Bacteria | 1683 |
| 708 | Ga0207658_10232830 | 3300025986 | Bacteria | 1556 |
| 709 | Ga0207658_10699199 | 3300025986 | Bacteria | 916 |
| 710 | Ga0207677_10010248 | 3300026023 | Bacteria | 5298 |
| 711 | Ga0207677_10272560 | 3300026023 | Bacteria | 1385 |
| 712 | Ga0207677_10322327 | 3300026023 | Bacteria | 1284 |
| 713 | Ga0207677_11636900 | 3300026023 | Bacteria | 596 |
| 714 | Ga0207703_10012005 | 3300026035 | Bacteria | 6746 |
| 715 | Ga0207703_10045747 | 3300026035 | Bacteria | 3522 |
| 716 | Ga0207703_10444883 | 3300026035 | Bacteria | 1209 |
| 717 | Ga0207703_10633035 | 3300026035 | Bacteria | 1014 |
| 718 | Ga0207703_10780517 | 3300026035 | Bacteria | 911 |
| 719 | Ga0207639_10059133 | 3300026041 | Bacteria | 2951 |
| 720 | Ga0207639_10149925 | 3300026041 | Bacteria | 1952 |
| 721 | Ga0207639_10306699 | 3300026041 | Bacteria | 1405 |
| 722 | Ga0207639_10981045 | 3300026041 | Unclassified | 791 |
| 723 | Ga0207639_11449589 | 3300026041 | Bacteria | 644 |
| 724 | Ga0207678_10005024 | 3300026067 | Bacteria | 11867 |
| 725 | Ga0207678_10081977 | 3300026067 | Bacteria | 2760 |
| 726 | Ga0207678_10162810 | 3300026067 | Bacteria | 1905 |
| 727 | Ga0207678_10190588 | 3300026067 | Bacteria | 1752 |
| 728 | Ga0207678_10220596 | 3300026067 | Bacteria | 1623 |
| 729 | Ga0207678_10234728 | 3300026067 | Bacteria | 1570 |
| 730 | Ga0207678_10245528 | 3300026067 | Bacteria | 1533 |
| 731 | Ga0207678_10366915 | 3300026067 | Bacteria | 1243 |
| 732 | Ga0207678_10372302 | 3300026067 | Bacteria | 1234 |
| 733 | Ga0207678_10721338 | 3300026067 | Bacteria | 878 |
| 734 | Ga0207708_10115299 | 3300026075 | Bacteria | 2089 |
| 735 | Ga0207708_10170152 | 3300026075 | Bacteria | 1725 |
| 736 | Ga0207702_10427084 | 3300026078 | Bacteria | 1282 |
| 737 | Ga0207702_10805980 | 3300026078 | Bacteria | 928 |
| 738 | Ga0207641_10202741 | 3300026088 | Bacteria | 1830 |
| 739 | Ga0207641_11031056 | 3300026088 | Bacteria | 820 |
| 740 | Ga0207648_10266420 | 3300026089 | Bacteria | 1530 |
| 741 | Ga0207648_10589050 | 3300026089 | Bacteria | 1024 |
| 742 | Ga0207676_10070319 | 3300026095 | Bacteria | 2806 |
| 743 | Ga0207676_10108982 | 3300026095 | Bacteria | 2313 |
| 744 | Ga0207676_10883904 | 3300026095 | Bacteria | 876 |
| 745 | Ga0207676_10990238 | 3300026095 | Bacteria | 828 |
| 746 | Ga0207674_10066105 | 3300026116 | Bacteria | 3643 |
| 747 | Ga0207674_10070326 | 3300026116 | Bacteria | 3519 |
| 748 | Ga0207674_10329357 | 3300026116 | Bacteria | 1477 |
| 749 | Ga0207674_10419592 | 3300026116 | Bacteria | 1293 |
| 750 | Ga0207674_10712038 | 3300026116 | Bacteria | 969 |
| 751 | Ga0207674_10847657 | 3300026116 | Bacteria | 881 |
| 752 | Ga0207674_11028151 | 3300026116 | Bacteria | 793 |
| 753 | Ga0207675_100028089 | 3300026118 | Bacteria | 5238 |
| 754 | Ga0207675_100034859 | 3300026118 | Bacteria | 4693 |
| 755 | Ga0207675_100091356 | 3300026118 | Bacteria | 2863 |
| 756 | Ga0207675_100827403 | 3300026118 | Bacteria | 940 |
| 757 | Ga0207683_10003145 | 3300026121 | Bacteria | 14423 |
| 758 | Ga0207683_10016895 | 3300026121 | Bacteria | 6209 |
| 759 | Ga0207683_10065573 | 3300026121 | Bacteria | 3202 |
| 760 | Ga0207683_10100910 | 3300026121 | Bacteria | 2577 |
| 761 | Ga0207683_10123996 | 3300026121 | Bacteria | 2321 |
| 762 | Ga0207683_10236280 | 3300026121 | Bacteria | 1667 |
| 763 | Ga0207683_10316422 | 3300026121 | Bacteria | 1429 |
| 764 | Ga0207683_10316838 | 3300026121 | Unclassified | 1428 |
| 765 | Ga0207683_10539136 | 3300026121 | Bacteria | 1079 |
| 766 | Ga0207683_12084583 | 3300026121 | Bacteria | 515 |
| 767 | Ga0207698_10054121 | 3300026142 | Bacteria | 3086 |
| 768 | Ga0207698_10237666 | 3300026142 | Bacteria | 1658 |
| 769 | Ga0207698_10595012 | 3300026142 | Bacteria | 1090 |
| 770 | Ga0207698_11205121 | 3300026142 | Bacteria | 771 |
| 771 | Ga0209389_1000004 | 3300027296 | Bacteria | 263759 |
| 772 | Ga0209389_1000023 | 3300027296 | Bacteria | 150730 |
| 773 | Ga0209589_1000010 | 3300027357 | Bacteria | 237657 |
| 774 | Ga0209489_100011 | 3300027361 | Bacteria | 244710 |
| 775 | Ga0209489_100777 | 3300027361 | Bacteria | 63061 |
| 776 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 777 | Ga0209813_10439730 | 3300027866 | Bacteria | 532 |
| 778 | Ga0207428_10353908 | 3300027907 | Bacteria | 1080 |
| 779 | Ga0268266_10009595 | 3300028379 | Bacteria | 8511 |
| 780 | Ga0268266_10012387 | 3300028379 | Bacteria | 7371 |
| 781 | Ga0268266_10027174 | 3300028379 | Bacteria | 4868 |
| 782 | Ga0268266_10029034 | 3300028379 | Bacteria | 4700 |
| 783 | Ga0268266_10060413 | 3300028379 | Bacteria | 3268 |
| 784 | Ga0268266_10101020 | 3300028379 | Bacteria | 2542 |
| 785 | Ga0268266_10244955 | 3300028379 | Bacteria | 1656 |
| 786 | Ga0268266_10445290 | 3300028379 | Bacteria | 1230 |
| 787 | Ga0268266_10900505 | 3300028379 | Bacteria | 855 |
| 788 | Ga0268265_10175616 | 3300028380 | Bacteria | 1835 |
| 789 | Ga0268265_11453198 | 3300028380 | Bacteria | 688 |
| 790 | Ga0268264_10070546 | 3300028381 | Bacteria | 2958 |
| 791 | Ga0268264_10096546 | 3300028381 | Bacteria | 2560 |
| 792 | Ga0268264_10288185 | 3300028381 | Bacteria | 1541 |
| 793 | Ga0268264_10340486 | 3300028381 | Bacteria | 1424 |
| 794 | Ga0268264_10937683 | 3300028381 | Bacteria | 870 |
| 795 | Ga0265334_10074909 | 3300028573 | Bacteria | 1255 |
| 796 | Ga0265334_10219126 | 3300028573 | Bacteria | 658 |
| 797 | Ga0265318_10077310 | 3300028577 | Bacteria | 1230 |
| 798 | Ga0265318_10114355 | 3300028577 | Bacteria | 992 |
| 799 | Ga0307517_10315997 | 3300028786 | Bacteria | 867 |
| 800 | Ga0307517_10337442 | 3300028786 | Bacteria | 825 |
| 801 | Ga0307517_10425343 | 3300028786 | Bacteria | 695 |
| 802 | Ga0307515_10000138 | 3300028794 | Bacteria | 173220 |
| 803 | Ga0307515_10264895 | 3300028794 | Bacteria | 1449 |
| 804 | Ga0265338_10949659 | 3300028800 | Bacteria | 584 |
| 805 | Ga0307511_10279278 | 3300030521 | Bacteria | 774 |
| 806 | Ga0307512_10014863 | 3300030522 | Bacteria | 7239 |
| 807 | Ga0265330_10018939 | 3300031235 | Bacteria | 3159 |
| 808 | Ga0265330_10064203 | 3300031235 | Bacteria | 1595 |
| 809 | Ga0265330_10112575 | 3300031235 | Bacteria | 1161 |
| 810 | Ga0265332_10025346 | 3300031238 | Bacteria | 2605 |
| 811 | Ga0265320_10052783 | 3300031240 | Bacteria | 1966 |
| 812 | Ga0265320_10141408 | 3300031240 | Bacteria | 1090 |
| 813 | Ga0265340_10014105 | 3300031247 | Bacteria | 4183 |
| 814 | Ga0265340_10045752 | 3300031247 | Bacteria | 2136 |
| 815 | Ga0265340_10155304 | 3300031247 | Bacteria | 1041 |
| 816 | Ga0265339_10067321 | 3300031249 | Bacteria | 1916 |
| 817 | Ga0265339_10208319 | 3300031249 | Bacteria | 961 |
| 818 | Ga0265331_10013745 | 3300031250 | Bacteria | 4340 |
| 819 | Ga0265327_10041483 | 3300031251 | Bacteria | 2480 |
| 820 | Ga0265316_10114448 | 3300031344 | Bacteria | 2040 |
| 821 | Ga0307513_10107304 | 3300031456 | Bacteria | 2796 |
| 822 | Ga0307513_10108360 | 3300031456 | Bacteria | 2779 |
| 823 | Ga0307513_10841998 | 3300031456 | Bacteria | 624 |
| 824 | Ga0307513_10999689 | 3300031456 | Bacteria | 546 |
| 825 | Ga0307509_10466932 | 3300031507 | Bacteria | 953 |
| 826 | Ga0307408_100474506 | 3300031548 | Bacteria | 1090 |
| 827 | Ga0307408_100834826 | 3300031548 | Bacteria | 839 |
| 828 | Ga0265313_10007286 | 3300031595 | Bacteria | 7594 |
| 829 | Ga0307508_10218752 | 3300031616 | Bacteria | 1505 |
| 830 | Ga0307508_10463055 | 3300031616 | Bacteria | 861 |
| 831 | Ga0307508_10779389 | 3300031616 | Bacteria | 571 |
| 832 | Ga0265314_10002834 | 3300031711 | Bacteria | 17262 |
| 833 | Ga0265314_10069141 | 3300031711 | Bacteria | 2371 |
| 834 | Ga0265314_10085887 | 3300031711 | Bacteria | 2062 |
| 835 | Ga0265342_10029554 | 3300031712 | Bacteria | 3402 |
| 836 | Ga0265342_10388722 | 3300031712 | Bacteria | 722 |
| 837 | Ga0307516_10090518 | 3300031730 | Bacteria | 2888 |
| 838 | Ga0307413_10056827 | 3300031824 | Bacteria | 2389 |
| 839 | Ga0307413_10336378 | 3300031824 | Bacteria | 1159 |
| 840 | Ga0307410_10366741 | 3300031852 | Bacteria | 1155 |
| 841 | Ga0307410_10453456 | 3300031852 | Bacteria | 1047 |
| 842 | Ga0307407_10130185 | 3300031903 | Bacteria | 1609 |
| 843 | Ga0307407_11064949 | 3300031903 | Bacteria | 627 |
| 844 | Ga0307412_11102560 | 3300031911 | Bacteria | 706 |
| 845 | Ga0307409_100936430 | 3300031995 | Bacteria | 881 |
| 846 | Ga0307416_100377265 | 3300032002 | Bacteria | 1447 |
| 847 | Ga0307416_101033131 | 3300032002 | Bacteria | 925 |
| 848 | Ga0307411_10122442 | 3300032005 | Bacteria | 1885 |
| 849 | Ga0307411_10404440 | 3300032005 | Bacteria | 1129 |
| 850 | Ga0307507_10400362 | 3300033179 | Bacteria | 781 |
| 851 | Ga0307510_10027691 | 3300033180 | Bacteria | 6487 |
| 852 | Ga0307510_10050413 | 3300033180 | Bacteria | 4416 |
| 853 | Ga0307510_10071369 | 3300033180 | Bacteria | 3458 |
| 854 | Ga0307510_10166074 | 3300033180 | Bacteria | 1795 |
| 855 | Ga0307510_10552723 | 3300033180 | Bacteria | 598 |
| 856 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 857 | Ga0373948_0149087 | 3300034817 | Bacteria | 583 |
| 858 | Ga0373948_0210465 | 3300034817 | Bacteria | 511 |
| 859 | Ga0373926_0135979 | 3300035083 | Bacteria | 932 |
| 860 | Ga0373934_0018297 | 3300035086 | Bacteria | 2680 |
| 861 | Ga0373944_0014723 | 3300035089 | Bacteria | 2187 |
| 862 | Ga0373923_0000955 | 3300035111 | Bacteria | 7770 |
| 863 | Ga0373923_0021274 | 3300035111 | Bacteria | 2530 |
| 864 | Ga0373936_0069611 | 3300035113 | Bacteria | 1448 |
| 865 | Ga0373945_0106673 | 3300035116 | Bacteria | 1102 |
| 866 | Ga0373945_0369810 | 3300035116 | Bacteria | 624 |
| 867 | Ga0373953_0000357 | 3300035117 | Bacteria | 12330 |
| 868 | Ga0373954_0000156 | 3300035118 | Bacteria | 24327 |
| 869 | Ga0373954_0019571 | 3300035118 | Bacteria | 3054 |
| 870 | Ga0373956_0000252 | 3300035119 | Bacteria | 21307 |
| 871 | Ga0373957_0000344 | 3300035120 | Bacteria | 11777 |
| 872 | Ga0373943_0019168 | 3300035170 | Bacteria | 3146 |
| 873 | Ga0373946_0009713 | 3300035171 | Bacteria | 3552 |
| 874 | Ga0373946_0318842 | 3300035171 | Bacteria | 772 |
| 875 | Ga0373955_0000229 | 3300035172 | Bacteria | 23386 |
| 876 | Ga0373955_0110994 | 3300035172 | Bacteria | 1585 |
| 877 | Ga0373924_0000488 | 3300035410 | Bacteria | 12126 |
| 878 | Ga0373924_0013574 | 3300035410 | Bacteria | 3062 |
| 879 | Ga0373931_0003537 | 3300035691 | Bacteria | 7043 |
| 880 | Ga0373931_1050708 | 3300035691 | Bacteria | 553 |
| 881 | Ga0373935_0727666 | 3300035692 | Bacteria | 730 |
| 882 | Ga0373935_0833672 | 3300035692 | Bacteria | 681 |
| 883 | Ga0373927_0340136 | 3300035695 | Bacteria | 988 |
| 884 | Ga0373927_0431051 | 3300035695 | Bacteria | 870 |
| 885 | Ga0373933_0000628 | 3300035724 | Bacteria | 22042 |
| 886 | Ga0373933_0563627 | 3300035724 | Bacteria | 747 |
| 887 | Ga0373947_0014655 | 3300035725 | Bacteria | 4496 |
| 888 | Ga0373937_0001337 | 3300036401 | Bacteria | 20615 |
| 889 | Ga0373937_0234160 | 3300036401 | Bacteria | 1730 |
| 890 | Ga0373937_0266048 | 3300036401 | Bacteria | 1617 |
| 891 | Ga0373925_0040808 | 3300037068 | Bacteria | 3437 |
| 892 | Ga0373925_0137551 | 3300037068 | Bacteria | 1910 |
| 893 | Ga0373925_0907524 | 3300037068 | Bacteria | 726 |
| 894 | Ga0373925_0938093 | 3300037068 | Bacteria | 713 |
| 895 | Ga0395899_0109507 | 3300037312 | Bacteria | 1987 |
| 896 | Ga0395899_0315229 | 3300037312 | Bacteria | 1055 |
| 897 | Ga0395900_0033149 | 3300037418 | Bacteria | 5315 |
| 898 | Ga0395900_0360038 | 3300037418 | Bacteria | 1426 |
| 899 | Ga0395898_0003786 | 3300037466 | Bacteria | 16735 |
| 900 | Ga0395898_0015935 | 3300037466 | Bacteria | 7703 |
| 901 | Ga0395898_0134436 | 3300037466 | Bacteria | 2368 |
| 902 | Ga0395905_0048221 | 3300037471 | Bacteria | 3992 |
| 903 | Ga0395905_0363338 | 3300037471 | Bacteria | 1340 |
| 904 | Ga0395901_0059357 | 3300038443 | Bacteria | 3980 |
| 905 | Ga0395901_0233871 | 3300038443 | Bacteria | 1918 |
| 906 | Ga0395901_0553309 | 3300038443 | Bacteria | 1166 |
| 907 | Ga0436365_0088538 | 3300039437 | Bacteria | 655 |
| 908 | Ga0436365_0276774 | 3300039437 | Bacteria | 904 |
| 909 | Ga0436365_0350765 | 3300039437 | Bacteria | 817 |
| 910 | Ga0436365_0488039 | 3300039437 | Bacteria | 664 |
| 911 | Ga0436365_0714504 | 3300039437 | Bacteria | 793 |
| 912 | Ga0436365_1475101 | 3300039437 | Bacteria | 1349 |
| 913 | Ga0436365_1782951 | 3300039437 | Bacteria | 2426 |
| 914 | Ga0436360_0553077 | 3300039438 | Bacteria | 1151 |
| 915 | Ga0436363_0227726 | 3300039450 | Bacteria | 2889 |
| 916 | Ga0439465_0148926 | 3300041413 | Bacteria | 835 |
| 917 | Ga0451791_0856061 | 3300041451 | Bacteria | 663 |
| 918 | Ga0451795_0835100 | 3300041456 | Bacteria | 865 |
| 919 | Ga0451798_0527849 | 3300041458 | Bacteria | 548 |
| 920 | Ga0451800_1247451 | 3300041459 | Bacteria | 743 |
| 921 | Ga0451807_0027761 | 3300041486 | Bacteria | 758 |
| 922 | Ga0451833_0052533 | 3300041491 | Bacteria | 553 |
| 923 | Ga0451833_1385877 | 3300041491 | Bacteria | 931 |
| 924 | Ga0451835_0439563 | 3300041492 | Bacteria | 716 |
| 925 | Ga0451847_0468734 | 3300041503 | Bacteria | 1297 |
| 926 | Ga0451849_0164067 | 3300041505 | Bacteria | 946 |
| 927 | Ga0451855_1457165 | 3300041511 | Bacteria | 506 |
| 928 | Ga0451853_3206365 | 3300041512 | Bacteria | 845 |
| 929 | Ga0439431_0121816 | 3300041997 | Bacteria | 728 |
| 930 | Ga0439448_0287128 | 3300042005 | Bacteria | 583 |
| 931 | Ga0439455_0133576 | 3300042012 | Bacteria | 701 |
| 932 | Ga0439458_0058281 | 3300042157 | Bacteria | 961 |
| 933 | Ga0439464_0143287 | 3300042439 | Bacteria | 745 |
| 934 | Ga0466969_0049764 | 3300044656 | Bacteria | 2067 |
| 935 | Ga0466972_0000998 | 3300044658 | Bacteria | 13595 |
| 936 | Ga0466972_0304179 | 3300044658 | Bacteria | 745 |
| 937 | Ga0466965_0071991 | 3300044683 | Bacteria | 1739 |
| 938 | Ga0466966_0000551 | 3300044684 | Bacteria | 23873 |
| 939 | Ga0466961_0000020 | 3300044693 | Bacteria | 107610 |
| 940 | Ga0466961_0201182 | 3300044693 | Bacteria | 1232 |
| 941 | Ga0466963_0127317 | 3300044694 | Bacteria | 1756 |
| 942 | Ga0466964_0022484 | 3300044706 | Bacteria | 2447 |
| 943 | Ga0466964_0045822 | 3300044706 | Bacteria | 1781 |
| 944 | Ga0466968_0018330 | 3300044735 | Bacteria | 2807 |
| 945 | Ga0466960_0018738 | 3300044901 | Bacteria | 3038 |
| 946 | Ga0466960_0035273 | 3300044901 | Bacteria | 2336 |
| 947 | Ga0466960_0157633 | 3300044901 | Bacteria | 1217 |
| 948 | Ga0466960_0222530 | 3300044901 | Bacteria | 1039 |
| 949 | Ga0466959_0135055 | 3300045049 | Bacteria | 1746 |
| 950 | Ga0466958_0047710 | 3300045836 | Bacteria | 2586 |
| 951 | Ga0466967_0049530 | 3300045976 | Bacteria | 3674 |
| 952 | Ga0466967_0384955 | 3300045976 | Bacteria | 1362 |
| 953 | Ga0466967_0863173 | 3300045976 | Bacteria | 899 |
| 954 | Ga0495617_027271 | 3300046452 | Bacteria | 1922 |
| 955 | Ga0495592_0003818 | 3300046454 | Bacteria | 10889 |
| 956 | Ga0495592_0026973 | 3300046454 | Bacteria | 4355 |
| 957 | Ga0495592_0078412 | 3300046454 | Bacteria | 2393 |
| 958 | Ga0495592_0777290 | 3300046454 | Bacteria | 570 |
| 959 | Ga0495603_0007836 | 3300046455 | Bacteria | 6439 |
| 960 | Ga0495603_0088424 | 3300046455 | Bacteria | 1813 |
| 961 | Ga0495603_0353566 | 3300046455 | Bacteria | 843 |
| 962 | Ga0495603_0539916 | 3300046455 | Bacteria | 668 |
| 963 | Ga0495590_0098438 | 3300046457 | Bacteria | 1038 |
| 964 | Ga0495590_0108269 | 3300046457 | Bacteria | 990 |
| 965 | Ga0495629_0001098 | 3300046459 | Bacteria | 21450 |
| 966 | Ga0495629_0002258 | 3300046459 | Bacteria | 14852 |
| 967 | Ga0495629_0526638 | 3300046459 | Bacteria | 795 |
| 968 | Ga0495629_0952121 | 3300046459 | Bacteria | 561 |
| 969 | Ga0495638_0004483 | 3300046460 | Bacteria | 10577 |
| 970 | Ga0495638_0037446 | 3300046460 | Bacteria | 3085 |
| 971 | Ga0495638_0110489 | 3300046460 | Bacteria | 1633 |
| 972 | Ga0495638_0220113 | 3300046460 | Bacteria | 1061 |
| 973 | Ga0495638_0221466 | 3300046460 | Bacteria | 1057 |
| 974 | Ga0495638_0322130 | 3300046460 | Bacteria | 825 |
| 975 | Ga0495638_0448805 | 3300046460 | Bacteria | 659 |
| 976 | Ga0495641_0289181 | 3300046461 | Bacteria | 738 |
| 977 | Ga0495641_0577651 | 3300046461 | Bacteria | 514 |
| 978 | Ga0495651_0002766 | 3300046462 | Bacteria | 13608 |
| 979 | Ga0495651_0026823 | 3300046462 | Bacteria | 4486 |
| 980 | Ga0495651_0144905 | 3300046462 | Bacteria | 1718 |
| 981 | Ga0495653_0000562 | 3300046463 | Bacteria | 28426 |
| 982 | Ga0495653_0710019 | 3300046463 | Bacteria | 610 |
| 983 | Ga0495653_0758354 | 3300046463 | Bacteria | 586 |
| 984 | Ga0495650_0078899 | 3300046471 | Bacteria | 1274 |
| 985 | Ga0495650_0163114 | 3300046471 | Bacteria | 793 |
| 986 | Ga0495650_0329557 | 3300046471 | Bacteria | 507 |
| 987 | Ga0495580_0059649 | 3300046472 | Bacteria | 2681 |
| 988 | Ga0495582_0031742 | 3300046473 | Bacteria | 2904 |
| 989 | Ga0495582_0124821 | 3300046473 | Bacteria | 1452 |
| 990 | Ga0495582_0606980 | 3300046473 | Bacteria | 633 |
| 991 | Ga0495605_0107267 | 3300046474 | Bacteria | 1278 |
| 992 | Ga0495605_0124937 | 3300046474 | Bacteria | 1164 |
| 993 | Ga0495605_0296553 | 3300046474 | Bacteria | 684 |
| 994 | Ga0495639_0005522 | 3300046475 | Bacteria | 5443 |
| 995 | Ga0495639_0287282 | 3300046475 | Bacteria | 818 |
| 996 | Ga0495662_0351016 | 3300046476 | Bacteria | 725 |
| 997 | Ga0495664_0045364 | 3300046477 | Bacteria | 2607 |
| 998 | Ga0495664_0064925 | 3300046477 | Bacteria | 2176 |
| 999 | Ga0495664_0346055 | 3300046477 | Bacteria | 895 |
| 1000 | Ga0495664_0473968 | 3300046477 | Bacteria | 748 |
| 1001 | Ga0495584_0095822 | 3300046491 | Bacteria | 1498 |
| 1002 | Ga0495584_0108738 | 3300046491 | Bacteria | 1402 |
| 1003 | Ga0495584_0600267 | 3300046491 | Bacteria | 561 |
| 1004 | Ga0495585_0012463 | 3300046492 | Bacteria | 5009 |
| 1005 | Ga0495585_0030579 | 3300046492 | Bacteria | 3062 |
| 1006 | Ga0495585_0100946 | 3300046492 | Bacteria | 1543 |
| 1007 | Ga0495594_0150020 | 3300046499 | Bacteria | 1323 |
| 1008 | Ga0495594_0288174 | 3300046499 | Bacteria | 936 |
| 1009 | Ga0495607_0157633 | 3300046501 | Bacteria | 1156 |
| 1010 | Ga0495607_0169951 | 3300046501 | Bacteria | 1102 |
| 1011 | Ga0495607_0340206 | 3300046501 | Bacteria | 695 |
| 1012 | Ga0495583_0012826 | 3300046506 | Bacteria | 4715 |
| 1013 | Ga0495583_0095646 | 3300046506 | Bacteria | 1274 |
| 1014 | Ga0495583_0117913 | 3300046506 | Bacteria | 1120 |
| 1015 | Ga0495583_0249626 | 3300046506 | Bacteria | 712 |
| 1016 | Ga0495583_0259105 | 3300046506 | Bacteria | 696 |
| 1017 | Ga0495606_0023943 | 3300046507 | Bacteria | 4412 |
| 1018 | Ga0495606_0047831 | 3300046507 | Bacteria | 2818 |
| 1019 | Ga0495606_0100654 | 3300046507 | Bacteria | 1760 |
| 1020 | Ga0495606_0166745 | 3300046507 | Bacteria | 1281 |
| 1021 | Ga0495606_0357107 | 3300046507 | Bacteria | 774 |
| 1022 | Ga0495608_0005591 | 3300046511 | Bacteria | 8974 |
| 1023 | Ga0495608_0098774 | 3300046511 | Bacteria | 1884 |
| 1024 | Ga0495608_0132774 | 3300046511 | Bacteria | 1592 |
| 1025 | Ga0495608_0162907 | 3300046511 | Bacteria | 1418 |
| 1026 | Ga0495610_0035063 | 3300046512 | Bacteria | 2579 |
| 1027 | Ga0495610_0067501 | 3300046512 | Bacteria | 1680 |
| 1028 | Ga0495610_0219535 | 3300046512 | Bacteria | 768 |
| 1029 | Ga0495616_0219405 | 3300046513 | Bacteria | 829 |
| 1030 | Ga0495616_0254434 | 3300046513 | Bacteria | 753 |
| 1031 | Ga0495616_0416327 | 3300046513 | Bacteria | 550 |
| 1032 | Ga0495616_0423651 | 3300046513 | Bacteria | 543 |
| 1033 | Ga0495618_0008913 | 3300046514 | Bacteria | 6054 |
| 1034 | Ga0495618_0024236 | 3300046514 | Bacteria | 3756 |
| 1035 | Ga0495618_0647008 | 3300046514 | Bacteria | 625 |
| 1036 | Ga0495620_0085144 | 3300046515 | Bacteria | 1274 |
| 1037 | Ga0495620_0143201 | 3300046515 | Bacteria | 934 |
| 1038 | Ga0495620_0234790 | 3300046515 | Bacteria | 700 |
| 1039 | Ga0495628_0011937 | 3300046516 | Bacteria | 7327 |
| 1040 | Ga0495628_0063195 | 3300046516 | Bacteria | 2901 |
| 1041 | Ga0495628_0202189 | 3300046516 | Bacteria | 1496 |
| 1042 | Ga0495630_0007480 | 3300046517 | Bacteria | 7806 |
| 1043 | Ga0495630_0272757 | 3300046517 | Bacteria | 1292 |
| 1044 | Ga0495631_0287003 | 3300046518 | Bacteria | 700 |
| 1045 | Ga0495632_0044408 | 3300046519 | Bacteria | 2218 |
| 1046 | Ga0495632_0112610 | 3300046519 | Bacteria | 1276 |
| 1047 | Ga0495632_0268345 | 3300046519 | Bacteria | 762 |
| 1048 | Ga0495632_0402733 | 3300046519 | Bacteria | 597 |
| 1049 | Ga0495643_0183760 | 3300046522 | Bacteria | 1014 |
| 1050 | Ga0495643_0196523 | 3300046522 | Bacteria | 971 |
| 1051 | Ga0495644_0090747 | 3300046523 | Bacteria | 1153 |
| 1052 | Ga0495644_0150411 | 3300046523 | Bacteria | 891 |
| 1053 | Ga0495644_0325423 | 3300046523 | Bacteria | 603 |
| 1054 | Ga0495648_0001038 | 3300046524 | Bacteria | 28176 |
| 1055 | Ga0495648_0051219 | 3300046524 | Bacteria | 2517 |
| 1056 | Ga0495648_0057693 | 3300046524 | Bacteria | 2326 |
| 1057 | Ga0495648_0151294 | 3300046524 | Bacteria | 1210 |
| 1058 | Ga0495648_0241622 | 3300046524 | Bacteria | 877 |
| 1059 | Ga0495648_0325792 | 3300046524 | Bacteria | 710 |
| 1060 | Ga0495666_0100113 | 3300046526 | Bacteria | 1366 |
| 1061 | Ga0495652_0008672 | 3300046529 | Bacteria | 9267 |
| 1062 | Ga0495652_0026299 | 3300046529 | Bacteria | 5142 |
| 1063 | Ga0495652_0032344 | 3300046529 | Bacteria | 4575 |
| 1064 | Ga0495652_0147759 | 3300046529 | Bacteria | 1840 |
| 1065 | Ga0495654_0127169 | 3300046530 | Bacteria | 1147 |
| 1066 | Ga0495654_0132792 | 3300046530 | Bacteria | 1116 |
| 1067 | Ga0495654_0341496 | 3300046530 | Bacteria | 604 |
| 1068 | Ga0495665_0097042 | 3300046531 | Bacteria | 1547 |
| 1069 | Ga0495665_0100779 | 3300046531 | Bacteria | 1516 |
| 1070 | Ga0495640_0013143 | 3300046533 | Bacteria | 6300 |
| 1071 | Ga0495640_0026031 | 3300046533 | Bacteria | 4234 |
| 1072 | Ga0495640_0029945 | 3300046533 | Bacteria | 3901 |
| 1073 | Ga0495586_0428462 | 3300046535 | Bacteria | 762 |
| 1074 | Ga0495586_0880338 | 3300046535 | Bacteria | 516 |
| 1075 | Ga0495587_0003932 | 3300046536 | Bacteria | 9864 |
| 1076 | Ga0495587_0725404 | 3300046536 | Bacteria | 544 |
| 1077 | Ga0495598_0020638 | 3300046537 | Bacteria | 1742 |
| 1078 | Ga0495598_0051329 | 3300046537 | Bacteria | 1242 |
| 1079 | Ga0495598_0088094 | 3300046537 | Bacteria | 1007 |
| 1080 | Ga0495609_0096278 | 3300046538 | Bacteria | 1284 |
| 1081 | Ga0495609_0213858 | 3300046538 | Bacteria | 802 |
| 1082 | Ga0495609_0273470 | 3300046538 | Bacteria | 692 |
| 1083 | Ga0495609_0304751 | 3300046538 | Bacteria | 648 |
| 1084 | Ga0495621_0013157 | 3300046539 | Bacteria | 2595 |
| 1085 | Ga0495621_0033997 | 3300046539 | Bacteria | 1760 |
| 1086 | Ga0495621_0527581 | 3300046539 | Bacteria | 511 |
| 1087 | Ga0495597_0013096 | 3300046542 | Bacteria | 3981 |
| 1088 | Ga0495597_0194201 | 3300046542 | Bacteria | 815 |
| 1089 | Ga0495645_0086399 | 3300046543 | Bacteria | 2244 |
| 1090 | Ga0495645_0130007 | 3300046543 | Bacteria | 1765 |
| 1091 | Ga0495645_0241215 | 3300046543 | Bacteria | 1206 |
| 1092 | Ga0495622_0001657 | 3300046557 | Bacteria | 11014 |
| 1093 | Ga0495622_0035703 | 3300046557 | Bacteria | 2318 |
| 1094 | Ga0495622_0078296 | 3300046557 | Bacteria | 1522 |
| 1095 | Ga0495622_0329488 | 3300046557 | Bacteria | 662 |
| 1096 | Ga0495622_0422520 | 3300046557 | Bacteria | 573 |
| 1097 | Ga0495633_0163362 | 3300046558 | Bacteria | 1027 |
| 1098 | Ga0495633_0349937 | 3300046558 | Bacteria | 669 |
| 1099 | Ga0495667_0001588 | 3300046559 | Bacteria | 15076 |
| 1100 | Ga0495667_0029808 | 3300046559 | Bacteria | 3671 |
| 1101 | Ga0495667_0034368 | 3300046559 | Bacteria | 3390 |
| 1102 | Ga0495667_0398470 | 3300046559 | Bacteria | 867 |
| 1103 | Ga0495656_0011088 | 3300046615 | Bacteria | 3299 |
| 1104 | Ga0495656_0069986 | 3300046615 | Bacteria | 1556 |
| 1105 | Ga0495656_0120824 | 3300046615 | Bacteria | 1236 |
| 1106 | Ga0495656_0149617 | 3300046615 | Bacteria | 1126 |
| 1107 | Ga0495656_0278044 | 3300046615 | Bacteria | 852 |
| 1108 | Ga0495668_0090246 | 3300046616 | Bacteria | 1679 |
| 1109 | Ga0495668_0111608 | 3300046616 | Bacteria | 1495 |
| 1110 | Ga0495668_0276874 | 3300046616 | Bacteria | 919 |
| 1111 | Ga0495668_0441184 | 3300046616 | Bacteria | 716 |
| 1112 | Ga0495668_0509948 | 3300046616 | Bacteria | 663 |
| 1113 | Ga0495634_0002373 | 3300046642 | Bacteria | 15688 |
| 1114 | Ga0495634_0006397 | 3300046642 | Bacteria | 8952 |
| 1115 | Ga0495634_0883147 | 3300046642 | Bacteria | 506 |
| 1116 | Ga0495611_0087276 | 3300046648 | Bacteria | 1440 |
| 1117 | Ga0495611_0163188 | 3300046648 | Bacteria | 1041 |
| 1118 | Ga0495611_0170791 | 3300046648 | Bacteria | 1016 |
| 1119 | Ga0495611_0200653 | 3300046648 | Bacteria | 930 |
| 1120 | Ga0495611_0335740 | 3300046648 | Bacteria | 694 |
| 1121 | Ga0495611_0350887 | 3300046648 | Bacteria | 677 |
| 1122 | Ga0495625_0035691 | 3300046660 | Bacteria | 3662 |
| 1123 | Ga0495625_0086733 | 3300046660 | Bacteria | 2171 |
| 1124 | Ga0495625_0149756 | 3300046660 | Bacteria | 1569 |
| 1125 | Ga0495625_0231837 | 3300046660 | Bacteria | 1205 |
| 1126 | Ga0495625_0363792 | 3300046660 | Bacteria | 911 |
| 1127 | Ga0495625_0415194 | 3300046660 | Bacteria | 838 |
| 1128 | Ga0495635_0000346 | 3300046663 | Bacteria | 29602 |
| 1129 | Ga0495635_0001380 | 3300046663 | Bacteria | 16199 |
| 1130 | Ga0495635_0119709 | 3300046663 | Bacteria | 1796 |
| 1131 | Ga0495635_0269841 | 3300046663 | Bacteria | 1144 |
| 1132 | Ga0495659_0024844 | 3300046664 | Bacteria | 2046 |
| 1133 | Ga0495659_0092874 | 3300046664 | Bacteria | 1160 |
| 1134 | Ga0495661_0189773 | 3300046665 | Bacteria | 1083 |
| 1135 | Ga0495661_0211192 | 3300046665 | Bacteria | 1010 |
| 1136 | Ga0495661_0287916 | 3300046665 | Bacteria | 826 |
| 1137 | Ga0495661_0294470 | 3300046665 | Bacteria | 814 |
| 1138 | Ga0495661_0386476 | 3300046665 | Bacteria | 683 |
| 1139 | Ga0495588_0007097 | 3300046674 | Bacteria | 5078 |
| 1140 | Ga0495588_0124350 | 3300046674 | Bacteria | 1360 |
| 1141 | Ga0495588_0199828 | 3300046674 | Bacteria | 1056 |
| 1142 | Ga0495588_0559621 | 3300046674 | Bacteria | 599 |
| 1143 | Ga0495588_0658749 | 3300046674 | Bacteria | 548 |
| 1144 | Ga0495657_0010298 | 3300046675 | Bacteria | 7041 |
| 1145 | Ga0495657_0011353 | 3300046675 | Bacteria | 6664 |
| 1146 | Ga0495657_0034813 | 3300046675 | Bacteria | 3495 |
| 1147 | Ga0495657_0337918 | 3300046675 | Bacteria | 893 |
| 1148 | Ga0495599_0000522 | 3300046678 | Bacteria | 22066 |
| 1149 | Ga0495599_0046395 | 3300046678 | Bacteria | 2725 |
| 1150 | Ga0495599_0092868 | 3300046678 | Bacteria | 1883 |
| 1151 | Ga0495599_0139647 | 3300046678 | Bacteria | 1503 |
| 1152 | Ga0495623_0005412 | 3300046679 | Bacteria | 8340 |
| 1153 | Ga0495623_0091055 | 3300046679 | Bacteria | 1872 |
| 1154 | Ga0495646_0000537 | 3300046680 | Bacteria | 20375 |
| 1155 | Ga0495647_0051142 | 3300046681 | Bacteria | 1605 |
| 1156 | Ga0495658_0017128 | 3300046683 | Bacteria | 3738 |
| 1157 | Ga0495658_0457918 | 3300046683 | Bacteria | 815 |
| 1158 | Ga0495669_0003415 | 3300046684 | Bacteria | 6539 |
| 1159 | Ga0495669_0048084 | 3300046684 | Bacteria | 1907 |
| 1160 | Ga0495669_0263510 | 3300046684 | Bacteria | 828 |
| 1161 | Ga0495669_0453859 | 3300046684 | Bacteria | 622 |
| 1162 | Ga0495613_0027437 | 3300046689 | Bacteria | 4237 |
| 1163 | Ga0495613_0047407 | 3300046689 | Bacteria | 3174 |
| 1164 | Ga0495613_0256867 | 3300046689 | Bacteria | 1218 |
| 1165 | Ga0495624_0004020 | 3300046690 | Bacteria | 10818 |
| 1166 | Ga0495624_0108267 | 3300046690 | Bacteria | 1709 |
| 1167 | Ga0495624_0198871 | 3300046690 | Bacteria | 1218 |
| 1168 | Ga0495624_0234435 | 3300046690 | Bacteria | 1111 |
| 1169 | Ga0495624_0393044 | 3300046690 | Bacteria | 833 |
| 1170 | Ga0495670_0000757 | 3300046691 | Bacteria | 15507 |
| 1171 | Ga0495670_0026769 | 3300046691 | Bacteria | 2855 |
| 1172 | Ga0495671_0117840 | 3300046692 | Bacteria | 1296 |
| 1173 | Ga0495671_0127622 | 3300046692 | Bacteria | 1240 |
| 1174 | Ga0495671_0222292 | 3300046692 | Bacteria | 914 |
| 1175 | Ga0495671_0249479 | 3300046692 | Bacteria | 857 |
| 1176 | Ga0495671_0440731 | 3300046692 | Bacteria | 623 |
| 1177 | Ga0495649_0022922 | 3300046694 | Bacteria | 3490 |
| 1178 | Ga0495649_0213505 | 3300046694 | Bacteria | 999 |
| 1179 | Ga0495649_0375921 | 3300046694 | Bacteria | 715 |
| 1180 | Ga0495649_0390316 | 3300046694 | Bacteria | 700 |
| 1181 | Ga0495649_0521523 | 3300046694 | Bacteria | 590 |
| 1182 | Ga0495589_0101402 | 3300046794 | Bacteria | 1393 |
| 1183 | Ga0495589_0235451 | 3300046794 | Bacteria | 858 |
| 1184 | Ga0495589_0333251 | 3300046794 | Bacteria | 700 |
| 1185 | Ga0495600_0000398 | 3300046809 | Bacteria | 22465 |
| 1186 | Ga0495600_0008503 | 3300046809 | Bacteria | 6308 |
| 1187 | Ga0495600_0024296 | 3300046809 | Bacteria | 3900 |
| 1188 | Ga0495600_0147695 | 3300046809 | Bacteria | 1523 |
| 1189 | Ga0495600_0219559 | 3300046809 | Bacteria | 1216 |
| 1190 | Ga0495600_0320235 | 3300046809 | Bacteria | 975 |
| 1191 | Ga0495600_0417361 | 3300046809 | Bacteria | 833 |
| 1192 | Ga0495581_0051626 | 3300047315 | Bacteria | 2374 |
| 1193 | Ga0495581_0187432 | 3300047315 | Bacteria | 1210 |
| 1194 | Ga0495604_0004007 | 3300047317 | Bacteria | 11715 |
| 1195 | Ga0495604_0005171 | 3300047317 | Bacteria | 10334 |
| 1196 | Ga0495604_0007540 | 3300047317 | Bacteria | 8607 |
| 1197 | Ga0495604_0034557 | 3300047317 | Bacteria | 3999 |
| 1198 | Ga0495604_0443734 | 3300047317 | Bacteria | 849 |
| 1199 | Ga0495636_0011599 | 3300047318 | Bacteria | 3489 |
| 1200 | Ga0495636_0467951 | 3300047318 | Bacteria | 607 |
| 1201 | Ga0495674_0004134 | 3300047319 | Bacteria | 14015 |
| 1202 | Ga0495674_0006731 | 3300047319 | Bacteria | 11003 |
| 1203 | Ga0495674_0076952 | 3300047319 | Bacteria | 2869 |
| 1204 | Ga0495672_0165212 | 3300047320 | Bacteria | 1134 |
| 1205 | Ga0495672_0333381 | 3300047320 | Bacteria | 709 |
| 1206 | Ga0495676_0025537 | 3300047321 | Bacteria | 5099 |
| 1207 | Ga0495676_0034955 | 3300047321 | Bacteria | 4210 |
| 1208 | Ga0495676_0117815 | 3300047321 | Bacteria | 1937 |
| 1209 | Ga0495680_0002197 | 3300047322 | Bacteria | 20191 |
| 1210 | Ga0495680_0006139 | 3300047322 | Bacteria | 11212 |
| 1211 | Ga0495680_0770156 | 3300047322 | Bacteria | 631 |
| 1212 | Ga0495683_0167698 | 3300047323 | Bacteria | 1011 |
| 1213 | Ga0495687_075687 | 3300047443 | Bacteria | 1334 |
| 1214 | Ga0495675_0001020 | 3300047444 | Bacteria | 17009 |
| 1215 | Ga0495675_0087204 | 3300047444 | Bacteria | 1961 |
| 1216 | Ga0495677_0128474 | 3300047445 | Bacteria | 969 |
| 1217 | Ga0495685_059079 | 3300047447 | Bacteria | 1294 |
| 1218 | Ga0495673_0083555 | 3300047469 | Bacteria | 1318 |
| 1219 | Ga0495673_0092356 | 3300047469 | Bacteria | 1235 |
| 1220 | Ga0495673_0140598 | 3300047469 | Bacteria | 941 |
| 1221 | Ga0495673_0173904 | 3300047469 | Bacteria | 819 |
| 1222 | Ga0495673_0217501 | 3300047469 | Bacteria | 708 |
| 1223 | Ga0495681_0318410 | 3300047470 | Bacteria | 598 |
| 1224 | Ga0495684_0001669 | 3300047471 | Bacteria | 17830 |
| 1225 | Ga0495684_0004704 | 3300047471 | Bacteria | 10654 |
| 1226 | Ga0495684_0024356 | 3300047471 | Bacteria | 4660 |
| 1227 | Ga0495686_0055110 | 3300047472 | Bacteria | 2488 |
| 1228 | Ga0495686_0310311 | 3300047472 | Bacteria | 868 |
| 1229 | Ga0495593_0000190 | 3300047673 | Bacteria | 32323 |
| 1230 | Ga0495593_0021782 | 3300047673 | Bacteria | 3576 |
| 1231 | Ga0495593_0022440 | 3300047673 | Bacteria | 3516 |
| 1232 | Ga0495602_0001719 | 3300048088 | Bacteria | 21809 |
| 1233 | Ga0495602_0004841 | 3300048088 | Bacteria | 14086 |
| 1234 | Ga0495602_0044617 | 3300048088 | Bacteria | 4020 |
| 1235 | Ga0495615_0003530 | 3300048090 | Bacteria | 2629 |
| 1236 | Ga0495626_0212925 | 3300048091 | Bacteria | 788 |
| 1237 | Ga0496100_0065196 | 3300048903 | Bacteria | 2412 |
| 1238 | Ga0496100_0362376 | 3300048903 | Bacteria | 1097 |
| 1239 | Ga0496100_0932015 | 3300048903 | Bacteria | 682 |
| 1240 | Ga0496101_0018829 | 3300048904 | Bacteria | 4702 |
| 1241 | Ga0496101_0188809 | 3300048904 | Bacteria | 1590 |
| 1242 | Ga0496101_0205581 | 3300048904 | Bacteria | 1523 |
| 1243 | Ga0496101_0212782 | 3300048904 | Bacteria | 1498 |
| 1244 | Ga0496101_0334223 | 3300048904 | Bacteria | 1189 |
| 1245 | Ga0496101_0340419 | 3300048904 | Bacteria | 1178 |
| 1246 | Ga0496101_0427283 | 3300048904 | Bacteria | 1044 |
| 1247 | Ga0496101_0610706 | 3300048904 | Bacteria | 862 |
| 1248 | Ga0496101_1189213 | 3300048904 | Bacteria | 598 |
| 1249 | Ga0496101_1266611 | 3300048904 | Bacteria | 577 |
| 1250 | Ga0496102_0010809 | 3300048905 | Bacteria | 7862 |
| 1251 | Ga0496102_0059740 | 3300048905 | Bacteria | 3487 |
| 1252 | Ga0496102_0090008 | 3300048905 | Bacteria | 2839 |
| 1253 | Ga0496102_0108748 | 3300048905 | Bacteria | 2583 |
| 1254 | Ga0496102_0347586 | 3300048905 | Bacteria | 1396 |
| 1255 | Ga0496102_0458804 | 3300048905 | Bacteria | 1195 |
| 1256 | Ga0496102_0641467 | 3300048905 | Bacteria | 985 |
| 1257 | Ga0496102_0701273 | 3300048905 | Bacteria | 935 |
| 1258 | Ga0496102_0855582 | 3300048905 | Unclassified | 831 |
| 1259 | Ga0496102_1361471 | 3300048905 | Bacteria | 629 |
| 1260 | Ga0496103_0006115 | 3300048906 | Bacteria | 7191 |
| 1261 | Ga0496103_0083756 | 3300048906 | Bacteria | 2008 |
| 1262 | Ga0496103_0157727 | 3300048906 | Bacteria | 1455 |
| 1263 | Ga0496103_0206929 | 3300048906 | Bacteria | 1262 |
| 1264 | Ga0496103_0258809 | 3300048906 | Bacteria | 1120 |
| 1265 | Ga0496103_0658467 | 3300048906 | Bacteria | 665 |
| 1266 | Ga0496103_0935536 | 3300048906 | Bacteria | 542 |
| 1267 | Ga0496104_0002128 | 3300048907 | Bacteria | 17188 |
| 1268 | Ga0496104_0006775 | 3300048907 | Bacteria | 10091 |
| 1269 | Ga0496104_0049600 | 3300048907 | Bacteria | 3958 |
| 1270 | Ga0496104_0101083 | 3300048907 | Bacteria | 2760 |
| 1271 | Ga0496104_0263757 | 3300048907 | Bacteria | 1635 |
| 1272 | Ga0496104_0757248 | 3300048907 | Bacteria | 878 |
| 1273 | Ga0496104_0786942 | 3300048907 | Bacteria | 857 |
| 1274 | Ga0496105_0005208 | 3300048908 | Bacteria | 9852 |
| 1275 | Ga0496105_0009083 | 3300048908 | Bacteria | 7754 |
| 1276 | Ga0496105_0029203 | 3300048908 | Bacteria | 4513 |
| 1277 | Ga0496105_0111707 | 3300048908 | Bacteria | 2255 |
| 1278 | Ga0496105_0171132 | 3300048908 | Bacteria | 1780 |
| 1279 | Ga0496105_0205500 | 3300048908 | Bacteria | 1606 |
| 1280 | Ga0496105_0247020 | 3300048908 | Bacteria | 1447 |
| 1281 | Ga0496105_0335751 | 3300048908 | Bacteria | 1209 |
| 1282 | Ga0496105_0572776 | 3300048908 | Bacteria | 879 |
| 1283 | Ga0496106_0004764 | 3300048909 | Bacteria | 10028 |
| 1284 | Ga0496106_0058382 | 3300048909 | Bacteria | 2921 |
| 1285 | Ga0496106_0121811 | 3300048909 | Bacteria | 2039 |
| 1286 | Ga0496106_0133749 | 3300048909 | Bacteria | 1946 |
| 1287 | Ga0496106_0342849 | 3300048909 | Bacteria | 1200 |
| 1288 | Ga0496106_0376869 | 3300048909 | Bacteria | 1140 |
| 1289 | Ga0496106_0911546 | 3300048909 | Bacteria | 694 |
| 1290 | Ga0496107_0001840 | 3300048910 | Bacteria | 13399 |
| 1291 | Ga0496107_0008370 | 3300048910 | Bacteria | 7156 |
| 1292 | Ga0496107_0026974 | 3300048910 | Bacteria | 4077 |
| 1293 | Ga0496107_0129249 | 3300048910 | Bacteria | 1864 |
| 1294 | Ga0496107_0320513 | 3300048910 | Bacteria | 1153 |
| 1295 | Ga0496107_0602014 | 3300048910 | Bacteria | 812 |
| 1296 | Ga0496107_0852801 | 3300048910 | Bacteria | 665 |
| 1297 | Ga0496108_0001980 | 3300048911 | Bacteria | 16402 |
| 1298 | Ga0496108_0024345 | 3300048911 | Bacteria | 4983 |
| 1299 | Ga0496108_0054851 | 3300048911 | Bacteria | 3345 |
| 1300 | Ga0496108_0062831 | 3300048911 | Bacteria | 3126 |
| 1301 | Ga0496108_0325002 | 3300048911 | Bacteria | 1341 |
| 1302 | Ga0496108_0410058 | 3300048911 | Bacteria | 1183 |
| 1303 | Ga0496109_0015085 | 3300048912 | Bacteria | 6725 |
| 1304 | Ga0496109_0029396 | 3300048912 | Bacteria | 4921 |
| 1305 | Ga0496109_0031537 | 3300048912 | Bacteria | 4756 |
| 1306 | Ga0496109_0172858 | 3300048912 | Bacteria | 2027 |
| 1307 | Ga0496109_0317776 | 3300048912 | Bacteria | 1469 |
| 1308 | Ga0496109_0593596 | 3300048912 | Bacteria | 1043 |
| 1309 | Ga0496110_0006296 | 3300048913 | Bacteria | 9370 |
| 1310 | Ga0496110_0020595 | 3300048913 | Bacteria | 5571 |
| 1311 | Ga0496110_0031676 | 3300048913 | Bacteria | 4563 |
| 1312 | Ga0496110_0227924 | 3300048913 | Bacteria | 1694 |
| 1313 | Ga0496110_0312467 | 3300048913 | Bacteria | 1431 |
| 1314 | Ga0496110_0318973 | 3300048913 | Bacteria | 1415 |
| 1315 | Ga0496110_0349333 | 3300048913 | Bacteria | 1347 |
| 1316 | Ga0496110_0796989 | 3300048913 | Bacteria | 849 |
| 1317 | Ga0496111_0240487 | 3300048914 | Bacteria | 1344 |
| 1318 | Ga0496111_0281550 | 3300048914 | Bacteria | 1233 |
| 1319 | Ga0496111_0285343 | 3300048914 | Bacteria | 1224 |
| 1320 | Ga0496111_0289130 | 3300048914 | Bacteria | 1215 |
| 1321 | Ga0496111_0305041 | 3300048914 | Bacteria | 1180 |
| 1322 | Ga0496111_0393252 | 3300048914 | Bacteria | 1025 |
| 1323 | Ga0496111_0402074 | 3300048914 | Bacteria | 1012 |
| 1324 | Ga0496112_0004485 | 3300048915 | Bacteria | 11845 |
| 1325 | Ga0496112_0019812 | 3300048915 | Bacteria | 6363 |
| 1326 | Ga0496112_0057366 | 3300048915 | Bacteria | 3833 |
| 1327 | Ga0496112_0079729 | 3300048915 | Bacteria | 3238 |
| 1328 | Ga0496112_0188187 | 3300048915 | Bacteria | 2027 |
| 1329 | Ga0496112_0253295 | 3300048915 | Bacteria | 1711 |
| 1330 | Ga0496112_0305707 | 3300048915 | Bacteria | 1535 |
| 1331 | Ga0496112_0659880 | 3300048915 | Bacteria | 975 |
| 1332 | Ga0496113_0175413 | 3300048916 | Bacteria | 1698 |
| 1333 | Ga0496113_0232226 | 3300048916 | Bacteria | 1471 |
| 1334 | Ga0496113_0268418 | 3300048916 | Bacteria | 1363 |
| 1335 | Ga0496113_0355584 | 3300048916 | Bacteria | 1175 |
| 1336 | Ga0496113_0372887 | 3300048916 | Bacteria | 1145 |
| 1337 | Ga0496113_0427384 | 3300048916 | Bacteria | 1064 |
| 1338 | Ga0496114_0008932 | 3300048917 | Bacteria | 7944 |
| 1339 | Ga0496114_0060493 | 3300048917 | Bacteria | 3166 |
| 1340 | Ga0496114_0071900 | 3300048917 | Bacteria | 2908 |
| 1341 | Ga0496114_0093078 | 3300048917 | Bacteria | 2562 |
| 1342 | Ga0496114_0517443 | 3300048917 | Bacteria | 1055 |
| 1343 | Ga0496114_0520904 | 3300048917 | Bacteria | 1051 |
| 1344 | Ga0496114_0887600 | 3300048917 | Bacteria | 772 |
| 1345 | Ga0496115_0001528 | 3300048918 | Bacteria | 16623 |
| 1346 | Ga0496115_0014005 | 3300048918 | Bacteria | 6071 |
| 1347 | Ga0496115_0067015 | 3300048918 | Bacteria | 2902 |
| 1348 | Ga0496115_0107934 | 3300048918 | Bacteria | 2285 |
| 1349 | Ga0496115_0149426 | 3300048918 | Bacteria | 1928 |
| 1350 | Ga0496115_0149762 | 3300048918 | Bacteria | 1926 |
| 1351 | Ga0496115_0435765 | 3300048918 | Bacteria | 1060 |
| 1352 | Ga0496115_0503641 | 3300048918 | Bacteria | 973 |
| 1353 | Ga0496115_0842098 | 3300048918 | Bacteria | 711 |
| 1354 | Ga0496115_1311962 | 3300048918 | Bacteria | 538 |
| 1355 | Ga0496116_0002360 | 3300048919 | Bacteria | 19968 |
| 1356 | Ga0496116_0055335 | 3300048919 | Bacteria | 2607 |
| 1357 | Ga0496117_0024592 | 3300048920 | Bacteria | 4759 |
| 1358 | Ga0496117_0055499 | 3300048920 | Bacteria | 2768 |
| 1359 | Ga0496117_0069138 | 3300048920 | Bacteria | 2380 |
| 1360 | Ga0496117_0098446 | 3300048920 | Bacteria | 1859 |
| 1361 | Ga0496117_0147648 | 3300048920 | Bacteria | 1397 |
| 1362 | Ga0496117_0247274 | 3300048920 | Bacteria | 975 |
| 1363 | Ga0496117_0319027 | 3300048920 | Bacteria | 815 |
| 1364 | Ga0496117_0353543 | 3300048920 | Bacteria | 758 |
| 1365 | Ga0496118_0037036 | 3300048921 | Bacteria | 3933 |
| 1366 | Ga0496118_0108199 | 3300048921 | Bacteria | 1854 |
| 1367 | Ga0496118_0190023 | 3300048921 | Bacteria | 1229 |
| 1368 | Ga0496118_0254707 | 3300048921 | Bacteria | 995 |
| 1369 | Ga0496118_0431380 | 3300048921 | Bacteria | 675 |
| 1370 | Ga0496118_0505845 | 3300048921 | Bacteria | 599 |
| 1371 | Ga0496118_0559530 | 3300048921 | Bacteria | 556 |
| 1372 | Ga0496119_0044767 | 3300048922 | Bacteria | 2782 |
| 1373 | Ga0496119_0083600 | 3300048922 | Bacteria | 1832 |
| 1374 | Ga0496119_0177088 | 3300048922 | Bacteria | 1121 |
| 1375 | Ga0496119_0293595 | 3300048922 | Bacteria | 804 |
| 1376 | Ga0496119_0566901 | 3300048922 | Bacteria | 520 |
| 1377 | Ga0496120_0021422 | 3300048923 | Bacteria | 4086 |
| 1378 | Ga0496120_0026469 | 3300048923 | Bacteria | 3581 |
| 1379 | Ga0496121_0004217 | 3300048924 | Bacteria | 19593 |
| 1380 | Ga0496121_0024578 | 3300048924 | Bacteria | 5756 |
| 1381 | Ga0496121_0026133 | 3300048924 | Bacteria | 5514 |
| 1382 | Ga0496121_0042542 | 3300048924 | Bacteria | 3948 |
| 1383 | Ga0496121_0059217 | 3300048924 | Bacteria | 3159 |
| 1384 | Ga0496121_0146344 | 3300048924 | Bacteria | 1745 |
| 1385 | Ga0496121_0308783 | 3300048924 | Bacteria | 1070 |
| 1386 | Ga0496121_0335526 | 3300048924 | Bacteria | 1012 |
| 1387 | Ga0496121_0383863 | 3300048924 | Bacteria | 925 |
| 1388 | Ga0496121_0393818 | 3300048924 | Bacteria | 909 |
| 1389 | Ga0496121_0409651 | 3300048924 | Bacteria | 885 |
| 1390 | Ga0496121_0445241 | 3300048924 | Bacteria | 836 |
| 1391 | Ga0496121_0619446 | 3300048924 | Bacteria | 664 |
| 1392 | Ga0496121_0691491 | 3300048924 | Bacteria | 615 |
| 1393 | Ga0496123_0041651 | 3300048926 | Bacteria | 3180 |
| 1394 | Ga0496123_0129019 | 3300048926 | Bacteria | 1405 |
| 1395 | Ga0496124_0107574 | 3300048927 | Bacteria | 2250 |
| 1396 | Ga0496124_0131041 | 3300048927 | Bacteria | 1992 |
| 1397 | Ga0496124_0282785 | 3300048927 | Bacteria | 1208 |
| 1398 | Ga0496124_0300355 | 3300048927 | Bacteria | 1160 |
| 1399 | Ga0496124_0656285 | 3300048927 | Bacteria | 672 |
| 1400 | Ga0496124_0714667 | 3300048927 | Bacteria | 633 |
| 1401 | Ga0496125_0022040 | 3300048928 | Bacteria | 5923 |
| 1402 | Ga0496125_0022335 | 3300048928 | Bacteria | 5878 |
| 1403 | Ga0496125_0060254 | 3300048928 | Bacteria | 3052 |
| 1404 | Ga0496125_0062839 | 3300048928 | Bacteria | 2966 |
| 1405 | Ga0496125_0091796 | 3300048928 | Bacteria | 2273 |
| 1406 | Ga0496125_0283924 | 3300048928 | Bacteria | 1023 |
| 1407 | Ga0496125_0618190 | 3300048928 | Bacteria | 589 |
| 1408 | Ga0496126_0014622 | 3300048929 | Bacteria | 7924 |
| 1409 | Ga0496126_0025409 | 3300048929 | Bacteria | 5698 |
| 1410 | Ga0496126_0037954 | 3300048929 | Bacteria | 4485 |
| 1411 | Ga0496126_0054823 | 3300048929 | Bacteria | 3608 |
| 1412 | Ga0496126_0061444 | 3300048929 | Bacteria | 3374 |
| 1413 | Ga0496126_0130622 | 3300048929 | Bacteria | 2171 |
| 1414 | Ga0496126_0140303 | 3300048929 | Bacteria | 2081 |
| 1415 | Ga0496126_0252266 | 3300048929 | Bacteria | 1470 |
| 1416 | Ga0496126_0260491 | 3300048929 | Bacteria | 1442 |
| 1417 | Ga0496126_0316920 | 3300048929 | Bacteria | 1283 |
| 1418 | Ga0496126_0422499 | 3300048929 | Bacteria | 1077 |
| 1419 | Ga0496126_1009061 | 3300048929 | Bacteria | 624 |
| 1420 | Ga0496126_1060356 | 3300048929 | Bacteria | 604 |
| 1421 | Ga0495682_0112000 | 3300049460 | Bacteria | 978 |
| 1422 | Ga0495682_0150374 | 3300049460 | Bacteria | 830 |
| 1423 | Ga0495682_0225797 | 3300049460 | Bacteria | 663 |
| 1424 | Ga0501032_0000076 | 3300049569 | Bacteria | 83609 |
| 1425 | Ga0501032_0001266 | 3300049569 | Bacteria | 20268 |
| 1426 | Ga0501033_0000093 | 3300049570 | Bacteria | 85243 |
| 1427 | Ga0501034_0001640 | 3300049571 | Bacteria | 28905 |
| 1428 | Ga0501034_0235039 | 3300049571 | Bacteria | 1781 |
| 1429 | Ga0501034_1162371 | 3300049571 | Bacteria | 651 |
| 1430 | Ga0501036_0000035 | 3300049572 | Bacteria | 88062 |
| 1431 | Ga0501037_0000026 | 3300049573 | Bacteria | 142936 |
| 1432 | Ga0501038_0000037 | 3300049574 | Bacteria | 124444 |
| 1433 | Ga0501038_0000133 | 3300049574 | Bacteria | 63587 |
| 1434 | Ga0501039_0000263 | 3300049575 | Bacteria | 38312 |
| 1435 | Ga0501043_0000115 | 3300049579 | Bacteria | 75659 |
| 1436 | Ga0501046_0000210 | 3300049580 | Bacteria | 60801 |
| 1437 | Ga0501047_0000094 | 3300049581 | Bacteria | 109928 |
| 1438 | Ga0501047_0045478 | 3300049581 | Bacteria | 4245 |
| 1439 | Ga0501048_0000306 | 3300049582 | Bacteria | 33320 |
| 1440 | Ga0501048_0012411 | 3300049582 | Bacteria | 6338 |
| 1441 | Ga0501048_0125237 | 3300049582 | Bacteria | 1817 |
| 1442 | Ga0501067_0001472 | 3300049583 | Bacteria | 12790 |
| 1443 | Ga0501067_0026617 | 3300049583 | Bacteria | 3203 |
| 1444 | Ga0501067_0140788 | 3300049583 | Bacteria | 1343 |
| 1445 | Ga0501068_0001034 | 3300049584 | Bacteria | 14700 |
| 1446 | Ga0501068_0017076 | 3300049584 | Bacteria | 4194 |
| 1447 | Ga0501069_0004848 | 3300049585 | Bacteria | 6968 |
| 1448 | Ga0501069_0009809 | 3300049585 | Bacteria | 5062 |
| 1449 | Ga0501069_0155153 | 3300049585 | Bacteria | 1317 |
| 1450 | Ga0501070_0000134 | 3300049586 | Bacteria | 66993 |
| 1451 | Ga0501070_0053140 | 3300049586 | Bacteria | 3361 |
| 1452 | Ga0501072_0059293 | 3300049588 | Bacteria | 3018 |
| 1453 | Ga0501073_0007576 | 3300049589 | Bacteria | 8067 |
| 1454 | Ga0501073_0207705 | 3300049589 | Bacteria | 1353 |
| 1455 | Ga0501073_0275856 | 3300049589 | Bacteria | 1160 |
| 1456 | Ga0501073_1063235 | 3300049589 | Bacteria | 556 |
| 1457 | Ga0501074_0005960 | 3300049590 | Bacteria | 8792 |
| 1458 | Ga0501074_0166763 | 3300049590 | Bacteria | 1572 |
| 1459 | Ga0501080_0000076 | 3300049742 | Bacteria | 66341 |
| 1460 | Ga0501080_0040484 | 3300049742 | Bacteria | 4346 |
| 1461 | Ga0501080_0162213 | 3300049742 | Bacteria | 2064 |
| 1462 | Ga0501083_0085514 | 3300049744 | Bacteria | 2086 |
| 1463 | Ga0501083_0978690 | 3300049744 | Bacteria | 550 |
| 1464 | Ga0501035_0000533 | 3300049822 | Bacteria | 42510 |
| 1465 | Ga0501044_0000507 | 3300049823 | Bacteria | 47418 |
| 1466 | Ga0501044_0555403 | 3300049823 | Bacteria | 1045 |
| 1467 | nmdc:mga03683_183258_c1 | 3300050489 | Bacteria | 956 |
| 1468 | nmdc:mga03683_353232_c1 | 3300050489 | Bacteria | 696 |
| 1469 | nmdc:mga03683_385757_c1 | 3300050489 | Bacteria | 667 |
| 1470 | nmdc:mga03n38_222446_c1 | 3300050490 | Bacteria | 986 |
| 1471 | nmdc:mga00v17_157454_c1 | 3300050491 | Bacteria | 1461 |
| 1472 | nmdc:mga00v17_23984_c1 | 3300050491 | Bacteria | 3534 |
| 1473 | nmdc:mga00v17_332290_c1 | 3300050491 | Bacteria | 988 |
| 1474 | nmdc:mga00v17_337861_c1 | 3300050491 | Bacteria | 979 |
| 1475 | nmdc:mga00v17_928073_c1 | 3300050491 | Bacteria | 550 |
| 1476 | nmdc:mga0yw44_118957_c1 | 3300050492 | Bacteria | 1700 |
| 1477 | nmdc:mga0yw44_18253_c1 | 3300050492 | Bacteria | 3836 |
| 1478 | nmdc:mga0yw44_490286_c1 | 3300050492 | Bacteria | 834 |
| 1479 | nmdc:mga0yw44_61539_c1 | 3300050492 | Bacteria | 2304 |
| 1480 | nmdc:mga0yw44_69378_c1 | 3300050492 | Bacteria | 2183 |
| 1481 | nmdc:mga0k408_218381_c1 | 3300050493 | Bacteria | 1138 |
| 1482 | nmdc:mga0k408_284606_c1 | 3300050493 | Bacteria | 987 |
| 1483 | nmdc:mga0k408_29471_c1 | 3300050493 | Bacteria | 2628 |
| 1484 | nmdc:mga0k408_663762_c1 | 3300050493 | Bacteria | 612 |
| 1485 | nmdc:mga0k408_73771_c1 | 3300050493 | Bacteria | 1993 |
| 1486 | nmdc:mga06z11_172523_c1 | 3300050494 | Bacteria | 1243 |
| 1487 | nmdc:mga06z11_180910_c1 | 3300050494 | Bacteria | 1216 |
| 1488 | nmdc:mga06z11_424049_c1 | 3300050494 | Bacteria | 802 |
| 1489 | nmdc:mga06z11_471066_c1 | 3300050494 | Bacteria | 760 |
| 1490 | nmdc:mga04h51_221672_c1 | 3300050495 | Bacteria | 750 |
| 1491 | nmdc:mga04h51_223004_c1 | 3300050495 | Bacteria | 748 |
| 1492 | nmdc:mga07m45_184829_c1 | 3300050496 | Bacteria | 1212 |
| 1493 | nmdc:mga07m45_204325_c1 | 3300050496 | Bacteria | 1149 |
| 1494 | nmdc:mga07m45_218851_c1 | 3300050496 | Bacteria | 1108 |
| 1495 | nmdc:mga07m45_322869_c1 | 3300050496 | Bacteria | 897 |
| 1496 | nmdc:mga07m45_35536_c1 | 3300050496 | Bacteria | 2772 |
| 1497 | nmdc:mga07m45_377597_c1 | 3300050496 | Bacteria | 823 |
| 1498 | nmdc:mga07m45_531301_c1 | 3300050496 | Bacteria | 681 |
| 1499 | nmdc:mga07m45_65834_c1 | 3300050496 | Bacteria | 2058 |
| 1500 | nmdc:mga07m45_702870_c1 | 3300050496 | Bacteria | 581 |
| 1501 | nmdc:mga07m45_85017_c1 | 3300050496 | Bacteria | 1809 |
| 1502 | nmdc:mga05p37_318829_c1 | 3300050507 | Bacteria | 1840 |
| 1503 | nmdc:mga05p37_974915_c1 | 3300050507 | Bacteria | 904 |
| 1504 | nmdc:mga09592_733831_c1 | 3300050508 | Bacteria | 839 |
| 1505 | nmdc:mga08y16_120205_c1 | 3300050511 | Bacteria | 2734 |
| 1506 | nmdc:mga08y16_1963255_c1 | 3300050511 | Bacteria | 535 |
| 1507 | nmdc:mga08y16_862629_c1 | 3300050511 | Bacteria | 894 |
| 1508 | nmdc:mga0n895_14081_c1 | 3300050512 | Bacteria | 7251 |
| 1509 | nmdc:mga08x19_920167_c1 | 3300050514 | Bacteria | 621 |
| 1510 | nmdc:mga0sz30_21570_c1 | 3300050516 | Bacteria | 2608 |
| 1511 | nmdc:mga0sz30_539945_c1 | 3300050516 | Bacteria | 526 |
| 1512 | nmdc:mga0sz30_83531_c1 | 3300050516 | Bacteria | 1384 |
| 1513 | Ga0495601_0013705 | 3300053077 | Bacteria | 4877 |
| 1514 | Ga0495601_0050280 | 3300053077 | Bacteria | 2629 |
| 1515 | Ga0495601_0120675 | 3300053077 | Bacteria | 1702 |
| 1516 | Ga0495601_0285131 | 3300053077 | Bacteria | 1077 |
| 1517 | Ga0495601_0477811 | 3300053077 | Bacteria | 805 |
| 1518 | Ga0495612_0023553 | 3300053078 | Bacteria | 2471 |
| 1519 | Ga0495612_0058623 | 3300053078 | Bacteria | 1591 |
| 1520 | Ga0500610_0072351 | 3300053079 | Bacteria | 1798 |
| 1521 | Ga0500635_0092661 | 3300053080 | Bacteria | 1101 |
| 1522 | Ga0495655_0052088 | 3300053083 | Bacteria | 1087 |
| 1523 | Ga0495655_0058818 | 3300053083 | Bacteria | 1042 |
| 1524 | Ga0495655_0136904 | 3300053083 | Bacteria | 759 |
| 1525 | Ga0495655_0181156 | 3300053083 | Bacteria | 679 |
| 1526 | Ga0495595_0000170 | 3300053084 | Bacteria | 25705 |
| 1527 | Ga0495595_0167853 | 3300053084 | Bacteria | 1085 |
| 1528 | Ga0495595_0242386 | 3300053084 | Bacteria | 902 |
| 1529 | Ga0495619_0000803 | 3300053085 | Bacteria | 20555 |
| 1530 | Ga0495619_0006966 | 3300053085 | Bacteria | 7154 |
| 1531 | Ga0495619_0192320 | 3300053085 | Bacteria | 1412 |
| 1532 | Ga0495619_0680058 | 3300053085 | Bacteria | 701 |
| 1533 | Ga0495619_0802659 | 3300053085 | Bacteria | 636 |
| 1534 | Ga0500578_0202710 | 3300053086 | Bacteria | 1213 |
| 1535 | Ga0500578_0211384 | 3300053086 | Bacteria | 1183 |
| 1536 | Ga0500578_0233959 | 3300053086 | Bacteria | 1112 |
| 1537 | Ga0500578_0272475 | 3300053086 | Bacteria | 1012 |
| 1538 | Ga0500578_0286372 | 3300053086 | Bacteria | 981 |
| 1539 | Ga0500578_0453092 | 3300053086 | Bacteria | 730 |
| 1540 | Ga0500578_0606971 | 3300053086 | Bacteria | 601 |
| 1541 | Ga0500643_000018 | 3300053087 | Bacteria | 296505 |
| 1542 | Ga0500643_054343 | 3300053087 | Bacteria | 1137 |
| 1543 | Ga0500644_0071203 | 3300053088 | Bacteria | 1254 |
| 1544 | Ga0500644_0412800 | 3300053088 | Bacteria | 589 |
| 1545 | Ga0500581_038250 | 3300053089 | Bacteria | 2459 |
| 1546 | Ga0500646_0096244 | 3300053090 | Bacteria | 923 |
| 1547 | Ga0500647_0045892 | 3300053091 | Bacteria | 2099 |
| 1548 | Ga0500647_0062219 | 3300053091 | Bacteria | 1796 |
| 1549 | Ga0500651_0055493 | 3300053093 | Bacteria | 2481 |
| 1550 | Ga0500651_0091172 | 3300053093 | Bacteria | 1876 |
| 1551 | Ga0500651_0126865 | 3300053093 | Bacteria | 1545 |
| 1552 | Ga0500651_0180309 | 3300053093 | Bacteria | 1255 |
| 1553 | Ga0500651_0293463 | 3300053093 | Bacteria | 934 |
| 1554 | Ga0500651_0590600 | 3300053093 | Bacteria | 603 |
| 1555 | Ga0500566_0000066 | 3300053094 | Bacteria | 50309 |
| 1556 | Ga0500566_0264962 | 3300053094 | Bacteria | 827 |
| 1557 | Ga0500640_063827 | 3300053095 | Bacteria | 1591 |
| 1558 | Ga0500641_0085253 | 3300053096 | Bacteria | 1344 |
| 1559 | Ga0500641_0097248 | 3300053096 | Bacteria | 1260 |
| 1560 | Ga0500650_0000287 | 3300053098 | Bacteria | 12200 |
| 1561 | Ga0500650_0283182 | 3300053098 | Bacteria | 737 |
| 1562 | Ga0500555_003373 | 3300053103 | Bacteria | 4554 |
| 1563 | Ga0500555_128064 | 3300053103 | Bacteria | 631 |
| 1564 | Ga0500556_0000058 | 3300053104 | Bacteria | 114257 |
| 1565 | Ga0500557_000008 | 3300053105 | Bacteria | 127284 |
| 1566 | Ga0500562_001778 | 3300053108 | Bacteria | 5386 |
| 1567 | Ga0500562_012928 | 3300053108 | Bacteria | 2125 |
| 1568 | Ga0500562_016626 | 3300053108 | Bacteria | 1893 |
| 1569 | Ga0500562_072939 | 3300053108 | Bacteria | 927 |
| 1570 | Ga0500569_005296 | 3300053109 | Bacteria | 2764 |
| 1571 | Ga0500569_023221 | 3300053109 | Bacteria | 1664 |
| 1572 | Ga0500569_181696 | 3300053109 | Bacteria | 714 |
| 1573 | Ga0500592_010653 | 3300053116 | Bacteria | 1467 |
| 1574 | Ga0500592_025793 | 3300053116 | Bacteria | 948 |
| 1575 | Ga0500592_032094 | 3300053116 | Bacteria | 847 |
| 1576 | Ga0500594_0125961 | 3300053118 | Bacteria | 808 |
| 1577 | Ga0500595_000146 | 3300053119 | Bacteria | 46362 |
| 1578 | Ga0500595_016698 | 3300053119 | Bacteria | 2728 |
| 1579 | Ga0500595_021184 | 3300053119 | Bacteria | 2324 |
| 1580 | Ga0500595_035545 | 3300053119 | Bacteria | 1640 |
| 1581 | Ga0500595_044103 | 3300053119 | Bacteria | 1415 |
| 1582 | Ga0500595_108409 | 3300053119 | Bacteria | 791 |
| 1583 | Ga0500597_078318 | 3300053120 | Bacteria | 1433 |
| 1584 | Ga0500607_254200 | 3300053121 | Bacteria | 695 |
| 1585 | Ga0500608_078190 | 3300053122 | Bacteria | 1564 |
| 1586 | Ga0500608_147819 | 3300053122 | Bacteria | 1033 |
| 1587 | Ga0500621_190292 | 3300053126 | Bacteria | 736 |
| 1588 | Ga0500626_113230 | 3300053128 | Bacteria | 1169 |
| 1589 | Ga0500642_0000025 | 3300053130 | Bacteria | 130425 |
| 1590 | Ga0500642_0000294 | 3300053130 | Bacteria | 18100 |
| 1591 | Ga0500642_0006956 | 3300053130 | Bacteria | 3769 |
| 1592 | Ga0500642_0284256 | 3300053130 | Bacteria | 751 |
| 1593 | Ga0500642_0365903 | 3300053130 | Bacteria | 637 |
| 1594 | Ga0500652_010275 | 3300053131 | Bacteria | 3201 |
| 1595 | Ga0500652_273446 | 3300053131 | Bacteria | 662 |
| 1596 | Ga0500655_047627 | 3300053133 | Bacteria | 850 |
| 1597 | Ga0500655_084418 | 3300053133 | Bacteria | 656 |
| 1598 | Ga0500658_0015391 | 3300053134 | Bacteria | 2839 |
| 1599 | Ga0500658_0145854 | 3300053134 | Bacteria | 1064 |
| 1600 | Ga0500559_0001270 | 3300053136 | Bacteria | 14757 |
| 1601 | Ga0500559_0209412 | 3300053136 | Bacteria | 919 |
| 1602 | Ga0500559_0374340 | 3300053136 | Bacteria | 664 |
| 1603 | Ga0500568_0000833 | 3300053139 | Bacteria | 21699 |
| 1604 | Ga0500568_0018742 | 3300053139 | Bacteria | 3020 |
| 1605 | Ga0500568_0077476 | 3300053139 | Bacteria | 1265 |
| 1606 | Ga0500568_0081189 | 3300053139 | Bacteria | 1231 |
| 1607 | Ga0500577_0196826 | 3300053142 | Bacteria | 869 |
| 1608 | Ga0500577_0223639 | 3300053142 | Bacteria | 815 |
| 1609 | Ga0500577_0230969 | 3300053142 | Bacteria | 802 |
| 1610 | Ga0500586_008323 | 3300053145 | Bacteria | 2820 |
| 1611 | Ga0500590_134736 | 3300053148 | Bacteria | 1138 |
| 1612 | Ga0500590_268625 | 3300053148 | Bacteria | 664 |
| 1613 | Ga0500590_284628 | 3300053148 | Bacteria | 632 |
| 1614 | Ga0500604_0001603 | 3300053151 | Bacteria | 6347 |
| 1615 | Ga0500604_0055233 | 3300053151 | Bacteria | 1235 |
| 1616 | Ga0500604_0172857 | 3300053151 | Bacteria | 739 |
| 1617 | Ga0500604_0288003 | 3300053151 | Bacteria | 569 |
| 1618 | Ga0500616_0000031 | 3300053153 | Bacteria | 415013 |
| 1619 | Ga0500619_036636 | 3300053154 | Bacteria | 1528 |
| 1620 | Ga0500622_0000783 | 3300053156 | Bacteria | 27611 |
| 1621 | Ga0500622_0006295 | 3300053156 | Bacteria | 6929 |
| 1622 | Ga0500627_0139073 | 3300053158 | Bacteria | 1097 |
| 1623 | Ga0500627_0172235 | 3300053158 | Bacteria | 975 |
| 1624 | Ga0500627_0368277 | 3300053158 | Bacteria | 617 |
| 1625 | Ga0500627_0406239 | 3300053158 | Bacteria | 579 |
| 1626 | Ga0500633_0016500 | 3300053160 | Bacteria | 2145 |
| 1627 | Ga0500633_0173307 | 3300053160 | Bacteria | 809 |
| 1628 | Ga0500634_0040764 | 3300053161 | Bacteria | 2523 |
| 1629 | Ga0500634_0175751 | 3300053161 | Bacteria | 970 |
| 1630 | Ga0500638_071504 | 3300053162 | Bacteria | 1658 |
| 1631 | Ga0500638_146932 | 3300053162 | Bacteria | 1052 |
| 1632 | Ga0500638_209792 | 3300053162 | Bacteria | 817 |
| 1633 | Ga0500636_0000550 | 3300053177 | Bacteria | 20404 |
| 1634 | Ga0500636_0000803 | 3300053177 | Bacteria | 16935 |
| 1635 | Ga0500636_0063170 | 3300053177 | Bacteria | 2158 |
| 1636 | Ga0500636_0159098 | 3300053177 | Bacteria | 1233 |
| 1637 | Ga0500637_0254581 | 3300053178 | Bacteria | 978 |
| 1638 | Ga0500649_157189 | 3300053722 | Bacteria | 806 |
| 1639 | Ga0500611_015384 | 3300053727 | Bacteria | 1354 |
| 1640 | Ga0500611_034709 | 3300053727 | Bacteria | 1070 |
| 1641 | Ga0500611_073330 | 3300053727 | Bacteria | 839 |
| 1642 | Ga0500625_011535 | 3300053729 | Bacteria | 4016 |
| 1643 | Ga0500645_018190 | 3300053730 | Bacteria | 2196 |
| 1644 | Ga0500645_019058 | 3300053730 | Bacteria | 2137 |
| 1645 | Ga0500645_025642 | 3300053730 | Bacteria | 1798 |
| 1646 | Ga0500609_033219 | 3300053731 | Bacteria | 710 |
| 1647 | Ga0500599_008514 | 3300053736 | Bacteria | 1333 |
| 1648 | Ga0500601_000062 | 3300053737 | Bacteria | 22260 |
| 1649 | Ga0500601_015101 | 3300053737 | Bacteria | 878 |
| 1650 | Ga0500661_010169 | 3300055283 | Bacteria | 1714 |
| 1651 | Ga0587071_163124 | 3300060344 | Bacteria | 562 |
| 1652 | Ga0501082_0006966 | 3300060353 | Bacteria | 9764 |
| 1653 | Ga0501082_0293473 | 3300060353 | Bacteria | 1416 |
| 1654 | Ga0501082_0347917 | 3300060353 | Bacteria | 1292 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046674 | Ga0495588_0124350 | Ga0495588_0124350_952_1335 | 125 |
| 2 | 3300005366 | Ga0070659_100760004 | Ga0070659_1007600041 | 145 |
| 3 | 3300025932 | Ga0207690_11016117 | Ga0207690_110161171 | 145 |
| 4 | iso_pu_bacteria | 2507262055 | 2507510897 | 145 |
| 5 | iso_pu_bacteria | 2508501009 | 2508544710 | 145 |
| 6 | iso_pu_bacteria | 2508501042 | 2508697062 | 145 |
| 7 | iso_pu_bacteria | 2511231028 | 2511394416 | 145 |
| 8 | iso_pu_bacteria | 2513237092 | 2513629152 | 145 |
| 9 | iso_pu_bacteria | 2513237095 | 2513649558 | 145 |
| 10 | iso_pu_bacteria | 2513237096 | 2513654912 | 145 |
| 11 | iso_pu_bacteria | 2513237104 | 2513719251 | 145 |
| 12 | iso_pu_bacteria | 2513237137 | 2513861290 | 145 |
| 13 | iso_pu_bacteria | 2513237139 | 2513874548 | 145 |
| 14 | iso_pu_bacteria | 2513237145 | 2513916065 | 145 |
| 15 | iso_pu_bacteria | 2513237161 | 2514015550 | 145 |
| 16 | iso_pu_bacteria | 2515154112 | 2515625559 | 145 |
| 17 | iso_pu_bacteria | 2517093001 | 2517100476 | 145 |
| 18 | iso_pu_bacteria | 2524023205 | 2524437337 | 145 |
| 19 | iso_pu_bacteria | 2524023228 | 2524534372 | 145 |
| 20 | iso_pu_bacteria | 2528768022 | 2528853223 | 145 |
| 21 | iso_pu_bacteria | 2602042107 | 2603861248 | 145 |
| 22 | iso_pu_bacteria | 2617270735 | 2617350654 | 145 |
| 23 | iso_pu_bacteria | 2643221547 | 2643755243 | 145 |
| 24 | iso_pu_bacteria | 2728368998 | 2728747709 | 145 |
| 25 | iso_pu_bacteria | 2744054633 | 2745076812 | 145 |
| 26 | iso_pu_bacteria | 2791355196 | 2793065180 | 145 |
| 27 | iso_pu_bacteria | 2791355197 | 2793072312 | 145 |
| 28 | iso_pu_bacteria | 2791355199 | 2793083120 | 145 |
| 29 | iso_pu_bacteria | 2802429603 | 2805916543 | 145 |
| 30 | iso_pu_bacteria | 2816332527 | 2818238028 | 145 |
| 31 | iso_pu_bacteria | 2824600985 | 2824606130 | 145 |
| 32 | iso_pu_bacteria | 2824609381 | 2824616042 | 145 |
| 33 | iso_pu_bacteria | 2824653114 | 2824657340 | 145 |
| 34 | iso_pu_bacteria | 2824661429 | 2824663091 | 145 |
| 35 | iso_pu_bacteria | 2824671348 | 2824676958 | 145 |
| 36 | iso_pu_bacteria | 2824679649 | 2824682047 | 145 |
| 37 | iso_pu_bacteria | 2824687955 | 2824693647 | 145 |
| 38 | iso_pu_bacteria | 2824696289 | 2824698718 | 145 |
| 39 | iso_pu_bacteria | 2824704595 | 2824706502 | 145 |
| 40 | iso_pu_bacteria | 2824753945 | 2824756950 | 145 |
| 41 | iso_pu_bacteria | 2824763712 | 2824769746 | 145 |
| 42 | iso_pu_bacteria | 2824773399 | 2824778483 | 145 |
| 43 | iso_pu_bacteria | 2838122688 | 2838127786 | 145 |
| 44 | iso_pu_bacteria | 2841941048 | 2841943079 | 145 |
| 45 | iso_pu_bacteria | 2841949485 | 2841956100 | 145 |
| 46 | iso_pu_bacteria | 2841957949 | 2841960328 | 145 |
| 47 | iso_pu_bacteria | 2841966195 | 2841968279 | 145 |
| 48 | iso_pu_bacteria | 2841974524 | 2841976507 | 145 |
| 49 | iso_pu_bacteria | 2841983080 | 2841987883 | 145 |
| 50 | iso_pu_bacteria | 2842038055 | 2842042818 | 145 |
| 51 | iso_pu_bacteria | 2842045827 | 2842050859 | 145 |
| 52 | iso_pu_bacteria | 2847930680 | 2847938460 | 145 |
| 53 | iso_pu_bacteria | 2847939898 | 2847944342 | 145 |
| 54 | iso_pu_bacteria | 2857509624 | 2857512077 | 145 |
| 55 | iso_pu_bacteria | 2857524615 | 2857530033 | 145 |
| 56 | iso_pu_bacteria | 2874590934 | 2874597622 | 145 |
| 57 | iso_pu_bacteria | 2874620515 | 2874623537 | 145 |
| 58 | iso_pu_bacteria | 2874628541 | 2874630526 | 145 |
| 59 | iso_pu_bacteria | 2874645413 | 2874649186 | 145 |
| 60 | iso_pu_bacteria | 2876761206 | 2876767788 | 145 |
| 61 | iso_pu_bacteria | 2876771140 | 2876774905 | 145 |
| 62 | iso_pu_bacteria | 2876818435 | 2876822343 | 145 |
| 63 | iso_pu_bacteria | 2879074833 | 2879077993 | 145 |
| 64 | iso_pu_bacteria | 2879083081 | 2879088699 | 145 |
| 65 | iso_pu_bacteria | 2879099564 | 2879103940 | 145 |
| 66 | iso_pu_bacteria | 2879110137 | 2879117936 | 145 |
| 67 | iso_pu_bacteria | 2879127579 | 2879132456 | 145 |
| 68 | iso_pu_bacteria | 2879142872 | 2879145244 | 145 |
| 69 | iso_pu_bacteria | 2881665667 | 2881667338 | 145 |
| 70 | iso_pu_bacteria | 2885374607 | 2885378077 | 145 |
| 71 | iso_pu_bacteria | 2885409591 | 2885416542 | 145 |
| 72 | iso_pu_bacteria | 2888378607 | 2888381655 | 145 |
| 73 | iso_pu_bacteria | 2888388044 | 2888388978 | 145 |
| 74 | iso_pu_bacteria | 2888419890 | 2888422045 | 145 |
| 75 | iso_pu_bacteria | 2889033259 | 2889033523 | 145 |
| 76 | iso_pu_bacteria | 2893066018 | 2893071044 | 145 |
| 77 | iso_pu_bacteria | 2903748898 | 2903758071 | 145 |
| 78 | iso_pu_bacteria | 2904666416 | 2904667659 | 145 |
| 79 | iso_pu_bacteria | 2904690495 | 2904697024 | 145 |
| 80 | iso_pu_bacteria | 2904699407 | 2904705665 | 145 |
| 81 | iso_pu_bacteria | 2904711408 | 2904719086 | 145 |
| 82 | iso_pu_bacteria | 2906610324 | 2906611366 | 145 |
| 83 | iso_pu_bacteria | 2906635258 | 2906641602 | 145 |
| 84 | iso_pu_bacteria | 2906660503 | 2906661306 | 145 |
| 85 | iso_pu_bacteria | 2908739725 | 2908744949 | 145 |
| 86 | iso_pu_bacteria | 2908756301 | 2908762707 | 145 |
| 87 | iso_pu_bacteria | 2919073203 | 2919077050 | 145 |
| 88 | iso_pu_bacteria | 2922368715 | 2922371325 | 145 |
| 89 | iso_pu_bacteria | 2922393267 | 2922393771 | 145 |
| 90 | iso_pu_bacteria | 2922425934 | 2922428009 | 145 |
| 91 | iso_pu_bacteria | 2929615660 | 2929619703 | 145 |
| 92 | iso_pu_bacteria | 2929624759 | 2929627826 | 145 |
| 93 | iso_pu_bacteria | 2932784394 | 2932786035 | 145 |
| 94 | iso_pu_bacteria | 2932794094 | 2932798197 | 145 |
| 95 | iso_pu_bacteria | 2932801729 | 2932803990 | 145 |
| 96 | iso_pu_bacteria | 2932809354 | 2932817017 | 145 |
| 97 | iso_pu_bacteria | 2932818245 | 2932822492 | 145 |
| 98 | iso_pu_bacteria | 2932828146 | 2932831079 | 145 |
| 99 | iso_pu_bacteria | 2933577622 | 2933581622 | 145 |
| 100 | iso_pu_bacteria | 2935608549 | 2935612885 | 145 |
| 101 | iso_pu_bacteria | 2935616580 | 2935624134 | 145 |
| 102 | iso_pu_bacteria | 2935630451 | 2935632074 | 145 |
| 103 | iso_pu_bacteria | 2935638405 | 2935640220 | 145 |
| 104 | iso_pu_bacteria | 2935648319 | 2935655010 | 145 |
| 105 | iso_pu_bacteria | 2935656913 | 2935663890 | 145 |
| 106 | iso_pu_bacteria | 2935665750 | 2935666942 | 145 |
| 107 | iso_pu_bacteria | 2935675223 | 2935680419 | 145 |
| 108 | iso_pu_bacteria | 2935684952 | 2935690073 | 145 |
| 109 | iso_pu_bacteria | 2935694250 | 2935699845 | 145 |
| 110 | iso_pu_bacteria | 2935703347 | 2935704697 | 145 |
| 111 | iso_pu_bacteria | 2935713505 | 2935722215 | 145 |
| 112 | iso_pu_bacteria | 2935722832 | 2935731524 | 145 |
| 113 | iso_pu_bacteria | 2935732158 | 2935735388 | 145 |
| 114 | iso_pu_bacteria | 2935741537 | 2935745341 | 145 |
| 115 | iso_pu_bacteria | 2935750917 | 2935755084 | 145 |
| 116 | iso_pu_bacteria | 2935760218 | 2935762402 | 145 |
| 117 | iso_pu_bacteria | 2935769743 | 2935775436 | 145 |
| 118 | iso_pu_bacteria | 2935777560 | 2935780338 | 145 |
| 119 | iso_pu_bacteria | 2935785616 | 2935790685 | 145 |
| 120 | iso_pu_bacteria | 2935793552 | 2935799132 | 145 |
| 121 | iso_pu_bacteria | 2935801545 | 2935803900 | 145 |
| 122 | iso_pu_bacteria | 2935810662 | 2935811818 | 145 |
| 123 | iso_pu_bacteria | 2935819856 | 2935824373 | 145 |
| 124 | iso_pu_bacteria | 2935827899 | 2935829703 | 145 |
| 125 | iso_pu_bacteria | 2935837841 | 2935842965 | 145 |
| 126 | iso_pu_bacteria | 2935847175 | 2935852482 | 145 |
| 127 | iso_pu_bacteria | 2935855204 | 2935862366 | 145 |
| 128 | iso_pu_bacteria | 2935864058 | 2935870501 | 145 |
| 129 | iso_pu_bacteria | 2935873716 | 2935881083 | 145 |
| 130 | iso_pu_bacteria | 2935883170 | 2935884204 | 145 |
| 131 | iso_pu_bacteria | 2935908558 | 2935912363 | 145 |
| 132 | iso_pu_bacteria | 2935916978 | 2935923963 | 145 |
| 133 | iso_pu_bacteria | 2935926038 | 2935929392 | 145 |
| 134 | iso_pu_bacteria | 2935934488 | 2935936023 | 145 |
| 135 | iso_pu_bacteria | 2935942939 | 2935949923 | 145 |
| 136 | iso_pu_bacteria | 2935951376 | 2935957311 | 145 |
| 137 | iso_pu_bacteria | 2935959822 | 2935962170 | 145 |
| 138 | iso_pu_bacteria | 2935967501 | 2935968342 | 145 |
| 139 | iso_pu_bacteria | 2935975950 | 2935976528 | 145 |
| 140 | iso_pu_bacteria | 2935984226 | 2935988026 | 145 |
| 141 | iso_pu_bacteria | 2935992306 | 2935993580 | 145 |
| 142 | iso_pu_bacteria | 2936002035 | 2936004476 | 145 |
| 143 | iso_pu_bacteria | 2936011229 | 2936018041 | 145 |
| 144 | iso_pu_bacteria | 2936019824 | 2936026549 | 145 |
| 145 | iso_pu_bacteria | 2936028420 | 2936035292 | 145 |
| 146 | iso_pu_bacteria | 2936037263 | 2936038401 | 145 |
| 147 | iso_pu_bacteria | 2936046547 | 2936053436 | 145 |
| 148 | iso_pu_bacteria | 2936055302 | 2936059417 | 145 |
| 149 | iso_pu_bacteria | 2940556831 | 2940561636 | 145 |
| 150 | iso_pu_bacteria | 2941507105 | 2941508022 | 145 |
| 151 | iso_pu_bacteria | 2941515067 | 2941515473 | 145 |
| 152 | iso_pu_bacteria | 2941523033 | 2941523952 | 145 |
| 153 | iso_pu_bacteria | 2941531003 | 2941533815 | 145 |
| 154 | iso_pu_bacteria | 2941538514 | 2941544189 | 145 |
| 155 | iso_pu_bacteria | 3005474847 | 3005477707 | 145 |
| 156 | iso_pu_bacteria | 3005594810 | 3005596676 | 145 |
| 157 | iso_pu_bacteria | 8006933436 | 8006933510 | 145 |
| 158 | iso_pu_bacteria | 8006973647 | 8006983183 | 145 |
| 159 | iso_pu_bacteria | 8006984368 | 8006989262 | 145 |
| 160 | iso_pu_bacteria | 8016511872 | 8016516302 | 145 |
| 161 | iso_pu_bacteria | 8016522445 | 8016523698 | 145 |
| 162 | iso_pu_bacteria | 8016530956 | 8016537221 | 145 |
| 163 | iso_pu_bacteria | 8016539877 | 8016541481 | 145 |
| 164 | iso_pu_bacteria | 8016548790 | 8016551772 | 145 |
| 165 | iso_pu_bacteria | 8016557553 | 8016560162 | 145 |
| 166 | iso_pu_bacteria | 8016566248 | 8016566873 | 145 |
| 167 | iso_pu_bacteria | 8016575299 | 8016579605 | 145 |
| 168 | iso_pu_bacteria | 8016595262 | 8016598079 | 145 |
| 169 | iso_pu_bacteria | 8016603502 | 8016604218 | 145 |
| 170 | iso_pu_bacteria | 8016613128 | 8016620800 | 145 |
| 171 | iso_pu_bacteria | 8016622563 | 8016629187 | 145 |
| 172 | iso_pu_bacteria | 8016630954 | 8016633712 | 145 |
| 173 | iso_pu_bacteria | 8017057580 | 8017060232 | 145 |
| 174 | iso_pu_bacteria | 8019530166 | 8019536910 | 145 |
| 175 | iso_pu_bacteria | 8019538911 | 8019542618 | 145 |
| 176 | iso_pu_bacteria | 8019547302 | 8019548117 | 145 |
| 177 | iso_pu_bacteria | 8019576017 | 8019579754 | 145 |
| 178 | iso_pu_bacteria | 8019586578 | 8019587464 | 145 |
| 179 | iso_pu_bacteria | 8019597564 | 8019603879 | 145 |
| 180 | iso_pu_bacteria | 8019608314 | 8019614660 | 145 |
| 181 | iso_pu_bacteria | 8019619141 | 8019625271 | 145 |
| 182 | iso_pu_bacteria | 8019629233 | 8019636910 | 145 |
| 183 | iso_pu_bacteria | 8019638758 | 8019642697 | 145 |
| 184 | iso_pu_bacteria | 8019648815 | 8019649889 | 145 |
| 185 | iso_pu_bacteria | 8019659431 | 8019664730 | 145 |
| 186 | iso_pu_bacteria | 8019668869 | 8019674316 | 145 |
| 187 | iso_pu_bacteria | 8019678201 | 8019681801 | 145 |
| 188 | iso_pu_bacteria | 8055742211 | 8055749041 | 145 |
| 189 | iso_pu_bacteria | 8056967851 | 8056969890 | 145 |
| 190 | 3300005353 | Ga0070669_101447885 | Ga0070669_1014478851 | 146 |
| 191 | 3300005355 | Ga0070671_101486568 | Ga0070671_1014865681 | 146 |
| 192 | 3300005364 | Ga0070673_100153511 | Ga0070673_1001535113 | 146 |
| 193 | 3300005543 | Ga0070672_100816723 | Ga0070672_1008167232 | 146 |
| 194 | 3300005577 | Ga0068857_100828220 | Ga0068857_1008282201 | 146 |
| 195 | 3300005985 | Ga0081539_10000008 | Ga0081539_100000081 | 146 |
| 196 | 3300006195 | Ga0075366_10270509 | Ga0075366_102705092 | 146 |
| 197 | 3300006844 | Ga0075428_100843747 | Ga0075428_1008437472 | 146 |
| 198 | 3300009094 | Ga0111539_10188422 | Ga0111539_101884223 | 146 |
| 199 | 3300009094 | Ga0111539_10659240 | Ga0111539_106592402 | 146 |
| 200 | 3300009098 | Ga0105245_10607399 | Ga0105245_106073992 | 146 |
| 201 | 3300011119 | Ga0105246_10579784 | Ga0105246_105797842 | 146 |
| 202 | 3300013296 | Ga0157374_11052100 | Ga0157374_110521001 | 146 |
| 203 | 3300013297 | Ga0157378_10249166 | Ga0157378_102491662 | 146 |
| 204 | 3300013306 | Ga0163162_10735665 | Ga0163162_107356652 | 146 |
| 205 | 3300014326 | Ga0157380_11033756 | Ga0157380_110337562 | 146 |
| 206 | 3300017792 | Ga0163161_11800366 | Ga0163161_118003661 | 146 |
| 207 | 3300025907 | Ga0207645_10473006 | Ga0207645_104730061 | 146 |
| 208 | 3300025923 | Ga0207681_10239480 | Ga0207681_102394802 | 146 |
| 209 | 3300025924 | Ga0207694_11004218 | Ga0207694_110042181 | 146 |
| 210 | 3300025926 | Ga0207659_10329702 | Ga0207659_103297021 | 146 |
| 211 | 3300025940 | Ga0207691_10156366 | Ga0207691_101563662 | 146 |
| 212 | 3300025960 | Ga0207651_10360164 | Ga0207651_103601642 | 146 |
| 213 | 3300025972 | Ga0207668_11206295 | Ga0207668_112062951 | 146 |
| 214 | 3300026089 | Ga0207648_10266420 | Ga0207648_102664201 | 146 |
| 215 | 3300026095 | Ga0207676_10883904 | Ga0207676_108839042 | 146 |
| 216 | 3300026116 | Ga0207674_11028151 | Ga0207674_110281512 | 146 |
| 217 | 3300027907 | Ga0207428_10353908 | Ga0207428_103539082 | 146 |
| 218 | 3300031247 | Ga0265340_10014105 | Ga0265340_100141053 | 146 |
| 219 | 3300031249 | Ga0265339_10067321 | Ga0265339_100673213 | 146 |
| 220 | 3300039437 | Ga0436365_0276774 | Ga0436365_0276774_63_503 | 146 |
| 221 | 3300048904 | Ga0496101_1189213 | Ga0496101_1189213_53_493 | 146 |
| 222 | 3300050493 | nmdc:mga0k408_73771_c1 | nmdc:mga0k408_73771_c1_239_688 | 146 |
| 223 | 3300050511 | nmdc:mga08y16_120205_c1 | nmdc:mga08y16_120205_c1_1927_2376 | 146 |
| 224 | 3300005336 | Ga0070680_101545674 | Ga0070680_1015456741 | 147 |
| 225 | 3300005618 | Ga0068864_101432327 | Ga0068864_1014323272 | 147 |
| 226 | 3300005842 | Ga0068858_101203786 | Ga0068858_1012037862 | 147 |
| 227 | 3300006871 | Ga0075434_100890683 | Ga0075434_1008906831 | 147 |
| 228 | 3300009148 | Ga0105243_10480224 | Ga0105243_104802242 | 147 |
| 229 | 3300013296 | Ga0157374_11262369 | Ga0157374_112623691 | 147 |
| 230 | 3300025911 | Ga0207654_10149230 | Ga0207654_101492302 | 147 |
| 231 | 3300028573 | Ga0265334_10074909 | Ga0265334_100749092 | 147 |
| 232 | 3300028577 | Ga0265318_10077310 | Ga0265318_100773102 | 147 |
| 233 | 3300028800 | Ga0265338_10949659 | Ga0265338_109496591 | 147 |
| 234 | 3300031235 | Ga0265330_10112575 | Ga0265330_101125752 | 147 |
| 235 | 3300031240 | Ga0265320_10052783 | Ga0265320_100527832 | 147 |
| 236 | 3300031247 | Ga0265340_10155304 | Ga0265340_101553042 | 147 |
| 237 | 3300031249 | Ga0265339_10208319 | Ga0265339_102083192 | 147 |
| 238 | 3300031250 | Ga0265331_10013745 | Ga0265331_100137453 | 147 |
| 239 | 3300031344 | Ga0265316_10114448 | Ga0265316_101144483 | 147 |
| 240 | 3300031595 | Ga0265313_10007286 | Ga0265313_100072864 | 147 |
| 241 | 3300031711 | Ga0265314_10069141 | Ga0265314_100691412 | 147 |
| 242 | 3300031712 | Ga0265342_10029554 | Ga0265342_100295542 | 147 |
| 243 | 3300049569 | Ga0501032_0001266 | Ga0501032_0001266_13806_14255 | 147 |
| 244 | 3300049574 | Ga0501038_0000133 | Ga0501038_0000133_5636_6085 | 147 |
| 245 | 3300049582 | Ga0501048_0000306 | Ga0501048_0000306_22705_23154 | 147 |
| 246 | 3300049583 | Ga0501067_0001472 | Ga0501067_0001472_3953_4402 | 147 |
| 247 | 3300049584 | Ga0501068_0017076 | Ga0501068_0017076_1630_2079 | 147 |
| 248 | 3300049585 | Ga0501069_0009809 | Ga0501069_0009809_3285_3734 | 147 |
| 249 | 3300060353 | Ga0501082_0006966 | Ga0501082_0006966_4929_5378 | 147 |
| 250 | 3300005293 | Ga0065715_10166218 | Ga0065715_101662182 | 148 |
| 251 | 3300005335 | Ga0070666_10008638 | Ga0070666_100086385 | 148 |
| 252 | 3300005347 | Ga0070668_100120988 | Ga0070668_1001209883 | 148 |
| 253 | 3300005356 | Ga0070674_100258298 | Ga0070674_1002582982 | 148 |
| 254 | 3300005365 | Ga0070688_100861205 | Ga0070688_1008612051 | 148 |
| 255 | 3300005365 | Ga0070688_100986016 | Ga0070688_1009860161 | 148 |
| 256 | 3300005367 | Ga0070667_100016970 | Ga0070667_1000169702 | 148 |
| 257 | 3300005543 | Ga0070672_100012165 | Ga0070672_1000121653 | 148 |
| 258 | 3300005548 | Ga0070665_100002836 | Ga0070665_10000283614 | 148 |
| 259 | 3300005548 | Ga0070665_102292314 | Ga0070665_1022923141 | 148 |
| 260 | 3300005617 | Ga0068859_100998106 | Ga0068859_1009981062 | 148 |
| 261 | 3300005718 | Ga0068866_10975709 | Ga0068866_109757091 | 148 |
| 262 | 3300006237 | Ga0097621_100056750 | Ga0097621_1000567502 | 148 |
| 263 | 3300006358 | Ga0068871_100438932 | Ga0068871_1004389322 | 148 |
| 264 | 3300006881 | Ga0068865_100096067 | Ga0068865_1000960674 | 148 |
| 265 | 3300006931 | Ga0097620_100998217 | Ga0097620_1009982172 | 148 |
| 266 | 3300009177 | Ga0105248_10308481 | Ga0105248_103084812 | 148 |
| 267 | 3300013296 | Ga0157374_10432369 | Ga0157374_104323692 | 148 |
| 268 | 3300013297 | Ga0157378_10257551 | Ga0157378_102575512 | 148 |
| 269 | 3300013306 | Ga0163162_11157027 | Ga0163162_111570272 | 148 |
| 270 | 3300013308 | Ga0157375_10101270 | Ga0157375_101012703 | 148 |
| 271 | 3300014969 | Ga0157376_10008762 | Ga0157376_100087624 | 148 |
| 272 | 3300025903 | Ga0207680_10085545 | Ga0207680_100855454 | 148 |
| 273 | 3300025937 | Ga0207669_10251934 | Ga0207669_102519342 | 148 |
| 274 | 3300025940 | Ga0207691_10093331 | Ga0207691_100933313 | 148 |
| 275 | 3300025941 | Ga0207711_10442707 | Ga0207711_104427072 | 148 |
| 276 | 3300025986 | Ga0207658_10030927 | Ga0207658_100309272 | 148 |
| 277 | 3300026121 | Ga0207683_10123996 | Ga0207683_101239963 | 148 |
| 278 | 3300026121 | Ga0207683_12084583 | Ga0207683_120845831 | 148 |
| 279 | 3300028379 | Ga0268266_10009595 | Ga0268266_100095953 | 148 |
| 280 | 3300028794 | Ga0307515_10000138 | Ga0307515_10000138135 | 148 |
| 281 | 3300030522 | Ga0307512_10014863 | Ga0307512_100148637 | 148 |
| 282 | 3300031235 | Ga0265330_10064203 | Ga0265330_100642032 | 148 |
| 283 | 3300039437 | Ga0436365_0088538 | Ga0436365_0088538_33_518 | 148 |
| 284 | 3300044658 | Ga0466972_0304179 | Ga0466972_0304179_76_603 | 148 |
| 285 | 3300046506 | Ga0495583_0012826 | Ga0495583_0012826_2273_2743 | 148 |
| 286 | 3300046683 | Ga0495658_0457918 | Ga0495658_0457918_253_723 | 148 |
| 287 | 3300047447 | Ga0495685_059079 | Ga0495685_059079_128_598 | 148 |
| 288 | 3300048904 | Ga0496101_0188809 | Ga0496101_0188809_1019_1489 | 148 |
| 289 | 3300048905 | Ga0496102_0855582 | Ga0496102_0855582_304_774 | 148 |
| 290 | 3300048906 | Ga0496103_0206929 | Ga0496103_0206929_422_892 | 148 |
| 291 | 3300048908 | Ga0496105_0335751 | Ga0496105_0335751_168_638 | 148 |
| 292 | 3300048910 | Ga0496107_0852801 | Ga0496107_0852801_38_508 | 148 |
| 293 | 3300048911 | Ga0496108_0410058 | Ga0496108_0410058_267_737 | 148 |
| 294 | 3300048912 | Ga0496109_0172858 | Ga0496109_0172858_1526_1996 | 148 |
| 295 | 3300048914 | Ga0496111_0393252 | Ga0496111_0393252_234_704 | 148 |
| 296 | 2209111006 | 2214814962 | 2213849004 | 149 |
| 297 | 3300001989 | JGI24739J22299_10053737 | JGI24739J22299_100537372 | 149 |
| 298 | 3300001990 | JGI24737J22298_10172787 | JGI24737J22298_101727871 | 149 |
| 299 | 3300002075 | JGI24738J21930_10096315 | JGI24738J21930_100963152 | 149 |
| 300 | 3300002244 | JGI24742J22300_10017201 | JGI24742J22300_100172012 | 149 |
| 301 | 3300002459 | JGI24751J29686_10040469 | JGI24751J29686_100404692 | 149 |
| 302 | 3300003215 | JGI25153J46596_10001613 | JGI25153J46596_100016134 | 149 |
| 303 | 3300003215 | JGI25153J46596_10006408 | JGI25153J46596_100064085 | 149 |
| 304 | 3300003354 | JGI25160J50197_1002315 | JGI25160J50197_10023156 | 149 |
| 305 | 3300003354 | JGI25160J50197_1017116 | JGI25160J50197_10171164 | 149 |
| 306 | 3300003762 | Ga0055542_1010193 | Ga0055542_10101932 | 149 |
| 307 | 3300003763 | Ga0055529_1011412 | Ga0055529_10114121 | 149 |
| 308 | 3300004799 | Ga0058863_11267463 | Ga0058863_112674631 | 149 |
| 309 | 3300005262 | Ga0065165_1000437 | Ga0065165_100043742 | 149 |
| 310 | 3300005262 | Ga0065165_1001951 | Ga0065165_100195114 | 149 |
| 311 | 3300005290 | Ga0065712_10184569 | Ga0065712_101845692 | 149 |
| 312 | 3300005327 | Ga0070658_10214222 | Ga0070658_102142221 | 149 |
| 313 | 3300005328 | Ga0070676_10125466 | Ga0070676_101254663 | 149 |
| 314 | 3300005328 | Ga0070676_10127094 | Ga0070676_101270942 | 149 |
| 315 | 3300005328 | Ga0070676_10187090 | Ga0070676_101870902 | 149 |
| 316 | 3300005328 | Ga0070676_10341808 | Ga0070676_103418081 | 149 |
| 317 | 3300005329 | Ga0070683_100162394 | Ga0070683_1001623943 | 149 |
| 318 | 3300005329 | Ga0070683_101478914 | Ga0070683_1014789141 | 149 |
| 319 | 3300005330 | Ga0070690_100193209 | Ga0070690_1001932091 | 149 |
| 320 | 3300005330 | Ga0070690_100239189 | Ga0070690_1002391892 | 149 |
| 321 | 3300005331 | Ga0070670_100271810 | Ga0070670_1002718102 | 149 |
| 322 | 3300005331 | Ga0070670_101093918 | Ga0070670_1010939181 | 149 |
| 323 | 3300005331 | Ga0070670_101177805 | Ga0070670_1011778051 | 149 |
| 324 | 3300005333 | Ga0070677_10029717 | Ga0070677_100297172 | 149 |
| 325 | 3300005333 | Ga0070677_10094607 | Ga0070677_100946071 | 149 |
| 326 | 3300005334 | Ga0068869_100267014 | Ga0068869_1002670142 | 149 |
| 327 | 3300005334 | Ga0068869_100269471 | Ga0068869_1002694712 | 149 |
| 328 | 3300005335 | Ga0070666_10075916 | Ga0070666_100759162 | 149 |
| 329 | 3300005335 | Ga0070666_10268351 | Ga0070666_102683511 | 149 |
| 330 | 3300005336 | Ga0070680_100018027 | Ga0070680_1000180274 | 149 |
| 331 | 3300005338 | Ga0068868_100024743 | Ga0068868_1000247432 | 149 |
| 332 | 3300005338 | Ga0068868_100140422 | Ga0068868_1001404222 | 149 |
| 333 | 3300005338 | Ga0068868_100148090 | Ga0068868_1001480903 | 149 |
| 334 | 3300005338 | Ga0068868_100174997 | Ga0068868_1001749971 | 149 |
| 335 | 3300005338 | Ga0068868_101017958 | Ga0068868_1010179582 | 149 |
| 336 | 3300005338 | Ga0068868_101117733 | Ga0068868_1011177331 | 149 |
| 337 | 3300005339 | Ga0070660_100364427 | Ga0070660_1003644271 | 149 |
| 338 | 3300005339 | Ga0070660_100372110 | Ga0070660_1003721101 | 149 |
| 339 | 3300005339 | Ga0070660_100903632 | Ga0070660_1009036321 | 149 |
| 340 | 3300005339 | Ga0070660_101134627 | Ga0070660_1011346271 | 149 |
| 341 | 3300005340 | Ga0070689_101261410 | Ga0070689_1012614101 | 149 |
| 342 | 3300005341 | Ga0070691_10096833 | Ga0070691_100968332 | 149 |
| 343 | 3300005343 | Ga0070687_100138119 | Ga0070687_1001381192 | 149 |
| 344 | 3300005343 | Ga0070687_100542160 | Ga0070687_1005421601 | 149 |
| 345 | 3300005343 | Ga0070687_100673168 | Ga0070687_1006731681 | 149 |
| 346 | 3300005344 | Ga0070661_100084660 | Ga0070661_1000846602 | 149 |
| 347 | 3300005347 | Ga0070668_100320806 | Ga0070668_1003208062 | 149 |
| 348 | 3300005353 | Ga0070669_100172181 | Ga0070669_1001721812 | 149 |
| 349 | 3300005353 | Ga0070669_100336845 | Ga0070669_1003368451 | 149 |
| 350 | 3300005353 | Ga0070669_100688319 | Ga0070669_1006883192 | 149 |
| 351 | 3300005353 | Ga0070669_100834424 | Ga0070669_1008344242 | 149 |
| 352 | 3300005354 | Ga0070675_100242240 | Ga0070675_1002422401 | 149 |
| 353 | 3300005354 | Ga0070675_100522162 | Ga0070675_1005221622 | 149 |
| 354 | 3300005354 | Ga0070675_100686590 | Ga0070675_1006865901 | 149 |
| 355 | 3300005354 | Ga0070675_101261938 | Ga0070675_1012619381 | 149 |
| 356 | 3300005355 | Ga0070671_100006274 | Ga0070671_1000062744 | 149 |
| 357 | 3300005355 | Ga0070671_100483066 | Ga0070671_1004830661 | 149 |
| 358 | 3300005355 | Ga0070671_100912787 | Ga0070671_1009127872 | 149 |
| 359 | 3300005356 | Ga0070674_100074733 | Ga0070674_1000747333 | 149 |
| 360 | 3300005356 | Ga0070674_100392083 | Ga0070674_1003920831 | 149 |
| 361 | 3300005364 | Ga0070673_100116311 | Ga0070673_1001163113 | 149 |
| 362 | 3300005364 | Ga0070673_100413045 | Ga0070673_1004130451 | 149 |
| 363 | 3300005364 | Ga0070673_100480292 | Ga0070673_1004802921 | 149 |
| 364 | 3300005365 | Ga0070688_100251830 | Ga0070688_1002518301 | 149 |
| 365 | 3300005365 | Ga0070688_100395623 | Ga0070688_1003956231 | 149 |
| 366 | 3300005366 | Ga0070659_100182395 | Ga0070659_1001823951 | 149 |
| 367 | 3300005366 | Ga0070659_100237636 | Ga0070659_1002376362 | 149 |
| 368 | 3300005366 | Ga0070659_100482612 | Ga0070659_1004826122 | 149 |
| 369 | 3300005366 | Ga0070659_100574413 | Ga0070659_1005744131 | 149 |
| 370 | 3300005366 | Ga0070659_101167680 | Ga0070659_1011676801 | 149 |
| 371 | 3300005367 | Ga0070667_100274656 | Ga0070667_1002746562 | 149 |
| 372 | 3300005367 | Ga0070667_100275142 | Ga0070667_1002751422 | 149 |
| 373 | 3300005367 | Ga0070667_100986553 | Ga0070667_1009865532 | 149 |
| 374 | 3300005367 | Ga0070667_101290568 | Ga0070667_1012905681 | 149 |
| 375 | 3300005406 | Ga0070703_10112008 | Ga0070703_101120081 | 149 |
| 376 | 3300005434 | Ga0070709_10426569 | Ga0070709_104265692 | 149 |
| 377 | 3300005434 | Ga0070709_10534843 | Ga0070709_105348432 | 149 |
| 378 | 3300005434 | Ga0070709_11375871 | Ga0070709_113758711 | 149 |
| 379 | 3300005434 | Ga0070709_11453862 | Ga0070709_114538621 | 149 |
| 380 | 3300005435 | Ga0070714_102210494 | Ga0070714_1022104941 | 149 |
| 381 | 3300005435 | Ga0070714_102483409 | Ga0070714_1024834091 | 149 |
| 382 | 3300005436 | Ga0070713_100932763 | Ga0070713_1009327631 | 149 |
| 383 | 3300005438 | Ga0070701_10666884 | Ga0070701_106668841 | 149 |
| 384 | 3300005439 | Ga0070711_100575500 | Ga0070711_1005755001 | 149 |
| 385 | 3300005439 | Ga0070711_100686924 | Ga0070711_1006869241 | 149 |
| 386 | 3300005439 | Ga0070711_100829331 | Ga0070711_1008293312 | 149 |
| 387 | 3300005439 | Ga0070711_101422535 | Ga0070711_1014225351 | 149 |
| 388 | 3300005440 | Ga0070705_100434794 | Ga0070705_1004347942 | 149 |
| 389 | 3300005441 | Ga0070700_100048865 | Ga0070700_1000488653 | 149 |
| 390 | 3300005441 | Ga0070700_100076673 | Ga0070700_1000766732 | 149 |
| 391 | 3300005441 | Ga0070700_100719204 | Ga0070700_1007192042 | 149 |
| 392 | 3300005455 | Ga0070663_100041743 | Ga0070663_1000417432 | 149 |
| 393 | 3300005455 | Ga0070663_100046047 | Ga0070663_1000460472 | 149 |
| 394 | 3300005455 | Ga0070663_100166126 | Ga0070663_1001661262 | 149 |
| 395 | 3300005455 | Ga0070663_100172906 | Ga0070663_1001729062 | 149 |
| 396 | 3300005455 | Ga0070663_100675713 | Ga0070663_1006757132 | 149 |
| 397 | 3300005455 | Ga0070663_100697163 | Ga0070663_1006971631 | 149 |
| 398 | 3300005456 | Ga0070678_100040131 | Ga0070678_1000401314 | 149 |
| 399 | 3300005456 | Ga0070678_100074215 | Ga0070678_1000742152 | 149 |
| 400 | 3300005456 | Ga0070678_100287658 | Ga0070678_1002876582 | 149 |
| 401 | 3300005456 | Ga0070678_100313726 | Ga0070678_1003137262 | 149 |
| 402 | 3300005456 | Ga0070678_100386189 | Ga0070678_1003861891 | 149 |
| 403 | 3300005456 | Ga0070678_100443219 | Ga0070678_1004432191 | 149 |
| 404 | 3300005456 | Ga0070678_101436922 | Ga0070678_1014369221 | 149 |
| 405 | 3300005457 | Ga0070662_100038911 | Ga0070662_1000389112 | 149 |
| 406 | 3300005457 | Ga0070662_100336141 | Ga0070662_1003361412 | 149 |
| 407 | 3300005458 | Ga0070681_10009008 | Ga0070681_100090086 | 149 |
| 408 | 3300005458 | Ga0070681_10020592 | Ga0070681_100205925 | 149 |
| 409 | 3300005458 | Ga0070681_10029069 | Ga0070681_100290693 | 149 |
| 410 | 3300005458 | Ga0070681_10577783 | Ga0070681_105777832 | 149 |
| 411 | 3300005459 | Ga0068867_100047151 | Ga0068867_1000471512 | 149 |
| 412 | 3300005459 | Ga0068867_101153755 | Ga0068867_1011537551 | 149 |
| 413 | 3300005466 | Ga0070685_10075464 | Ga0070685_100754642 | 149 |
| 414 | 3300005466 | Ga0070685_10740491 | Ga0070685_107404911 | 149 |
| 415 | 3300005471 | Ga0070698_100152883 | Ga0070698_1001528832 | 149 |
| 416 | 3300005518 | Ga0070699_100051453 | Ga0070699_1000514533 | 149 |
| 417 | 3300005530 | Ga0070679_100013970 | Ga0070679_1000139703 | 149 |
| 418 | 3300005530 | Ga0070679_100051260 | Ga0070679_1000512602 | 149 |
| 419 | 3300005530 | Ga0070679_100069459 | Ga0070679_1000694594 | 149 |
| 420 | 3300005530 | Ga0070679_100216670 | Ga0070679_1002166702 | 149 |
| 421 | 3300005530 | Ga0070679_100293284 | Ga0070679_1002932842 | 149 |
| 422 | 3300005530 | Ga0070679_100743704 | Ga0070679_1007437042 | 149 |
| 423 | 3300005530 | Ga0070679_100876830 | Ga0070679_1008768301 | 149 |
| 424 | 3300005535 | Ga0070684_100008399 | Ga0070684_1000083998 | 149 |
| 425 | 3300005535 | Ga0070684_100167686 | Ga0070684_1001676862 | 149 |
| 426 | 3300005535 | Ga0070684_101236178 | Ga0070684_1012361781 | 149 |
| 427 | 3300005539 | Ga0068853_100083711 | Ga0068853_1000837112 | 149 |
| 428 | 3300005539 | Ga0068853_100304238 | Ga0068853_1003042382 | 149 |
| 429 | 3300005539 | Ga0068853_100699513 | Ga0068853_1006995131 | 149 |
| 430 | 3300005539 | Ga0068853_101209706 | Ga0068853_1012097061 | 149 |
| 431 | 3300005539 | Ga0068853_101684408 | Ga0068853_1016844081 | 149 |
| 432 | 3300005543 | Ga0070672_100059526 | Ga0070672_1000595263 | 149 |
| 433 | 3300005543 | Ga0070672_100141674 | Ga0070672_1001416742 | 149 |
| 434 | 3300005543 | Ga0070672_101297178 | Ga0070672_1012971781 | 149 |
| 435 | 3300005544 | Ga0070686_100045395 | Ga0070686_1000453954 | 149 |
| 436 | 3300005544 | Ga0070686_100718183 | Ga0070686_1007181832 | 149 |
| 437 | 3300005546 | Ga0070696_100770705 | Ga0070696_1007707052 | 149 |
| 438 | 3300005547 | Ga0070693_100110410 | Ga0070693_1001104103 | 149 |
| 439 | 3300005547 | Ga0070693_100127685 | Ga0070693_1001276853 | 149 |
| 440 | 3300005548 | Ga0070665_100020991 | Ga0070665_1000209918 | 149 |
| 441 | 3300005548 | Ga0070665_100090862 | Ga0070665_1000908622 | 149 |
| 442 | 3300005548 | Ga0070665_100361634 | Ga0070665_1003616341 | 149 |
| 443 | 3300005548 | Ga0070665_100394107 | Ga0070665_1003941072 | 149 |
| 444 | 3300005548 | Ga0070665_100414850 | Ga0070665_1004148502 | 149 |
| 445 | 3300005548 | Ga0070665_100954742 | Ga0070665_1009547422 | 149 |
| 446 | 3300005548 | Ga0070665_101004452 | Ga0070665_1010044522 | 149 |
| 447 | 3300005549 | Ga0070704_101806829 | Ga0070704_1018068291 | 149 |
| 448 | 3300005563 | Ga0068855_100048966 | Ga0068855_1000489666 | 149 |
| 449 | 3300005563 | Ga0068855_100118628 | Ga0068855_1001186283 | 149 |
| 450 | 3300005563 | Ga0068855_100382227 | Ga0068855_1003822272 | 149 |
| 451 | 3300005563 | Ga0068855_100424140 | Ga0068855_1004241402 | 149 |
| 452 | 3300005563 | Ga0068855_100578959 | Ga0068855_1005789592 | 149 |
| 453 | 3300005563 | Ga0068855_100885109 | Ga0068855_1008851092 | 149 |
| 454 | 3300005563 | Ga0068855_100953314 | Ga0068855_1009533141 | 149 |
| 455 | 3300005563 | Ga0068855_101221266 | Ga0068855_1012212662 | 149 |
| 456 | 3300005563 | Ga0068855_101249644 | Ga0068855_1012496441 | 149 |
| 457 | 3300005564 | Ga0070664_100055443 | Ga0070664_1000554433 | 149 |
| 458 | 3300005564 | Ga0070664_100724271 | Ga0070664_1007242711 | 149 |
| 459 | 3300005564 | Ga0070664_101159151 | Ga0070664_1011591512 | 149 |
| 460 | 3300005564 | Ga0070664_101184430 | Ga0070664_1011844301 | 149 |
| 461 | 3300005564 | Ga0070664_101988826 | Ga0070664_1019888261 | 149 |
| 462 | 3300005577 | Ga0068857_100050231 | Ga0068857_1000502314 | 149 |
| 463 | 3300005577 | Ga0068857_100076130 | Ga0068857_1000761302 | 149 |
| 464 | 3300005577 | Ga0068857_100787166 | Ga0068857_1007871662 | 149 |
| 465 | 3300005577 | Ga0068857_101349550 | Ga0068857_1013495501 | 149 |
| 466 | 3300005578 | Ga0068854_100132186 | Ga0068854_1001321861 | 149 |
| 467 | 3300005578 | Ga0068854_100181384 | Ga0068854_1001813842 | 149 |
| 468 | 3300005578 | Ga0068854_100293190 | Ga0068854_1002931902 | 149 |
| 469 | 3300005614 | Ga0068856_100115016 | Ga0068856_1001150164 | 149 |
| 470 | 3300005614 | Ga0068856_100141100 | Ga0068856_1001411003 | 149 |
| 471 | 3300005614 | Ga0068856_100604436 | Ga0068856_1006044361 | 149 |
| 472 | 3300005614 | Ga0068856_100720495 | Ga0068856_1007204952 | 149 |
| 473 | 3300005614 | Ga0068856_101739441 | Ga0068856_1017394412 | 149 |
| 474 | 3300005615 | Ga0070702_100012071 | Ga0070702_1000120712 | 149 |
| 475 | 3300005615 | Ga0070702_100314450 | Ga0070702_1003144501 | 149 |
| 476 | 3300005616 | Ga0068852_100009742 | Ga0068852_1000097423 | 149 |
| 477 | 3300005616 | Ga0068852_100027366 | Ga0068852_1000273663 | 149 |
| 478 | 3300005616 | Ga0068852_100197310 | Ga0068852_1001973102 | 149 |
| 479 | 3300005616 | Ga0068852_100243561 | Ga0068852_1002435612 | 149 |
| 480 | 3300005616 | Ga0068852_100801266 | Ga0068852_1008012661 | 149 |
| 481 | 3300005617 | Ga0068859_100068797 | Ga0068859_1000687972 | 149 |
| 482 | 3300005617 | Ga0068859_100280933 | Ga0068859_1002809332 | 149 |
| 483 | 3300005617 | Ga0068859_100760486 | Ga0068859_1007604862 | 149 |
| 484 | 3300005617 | Ga0068859_100871492 | Ga0068859_1008714922 | 149 |
| 485 | 3300005617 | Ga0068859_101513048 | Ga0068859_1015130482 | 149 |
| 486 | 3300005618 | Ga0068864_100183815 | Ga0068864_1001838152 | 149 |
| 487 | 3300005618 | Ga0068864_100377581 | Ga0068864_1003775811 | 149 |
| 488 | 3300005618 | Ga0068864_100531768 | Ga0068864_1005317681 | 149 |
| 489 | 3300005718 | Ga0068866_10067829 | Ga0068866_100678291 | 149 |
| 490 | 3300005718 | Ga0068866_10076509 | Ga0068866_100765092 | 149 |
| 491 | 3300005718 | Ga0068866_10112938 | Ga0068866_101129382 | 149 |
| 492 | 3300005718 | Ga0068866_10941699 | Ga0068866_109416991 | 149 |
| 493 | 3300005719 | Ga0068861_100026582 | Ga0068861_1000265822 | 149 |
| 494 | 3300005719 | Ga0068861_100121826 | Ga0068861_1001218262 | 149 |
| 495 | 3300005719 | Ga0068861_100646204 | Ga0068861_1006462042 | 149 |
| 496 | 3300005719 | Ga0068861_100650641 | Ga0068861_1006506412 | 149 |
| 497 | 3300005840 | Ga0068870_10148608 | Ga0068870_101486082 | 149 |
| 498 | 3300005840 | Ga0068870_10237005 | Ga0068870_102370051 | 149 |
| 499 | 3300005840 | Ga0068870_10281989 | Ga0068870_102819892 | 149 |
| 500 | 3300005840 | Ga0068870_10326224 | Ga0068870_103262242 | 149 |
| 501 | 3300005840 | Ga0068870_11111921 | Ga0068870_111119211 | 149 |
| 502 | 3300005841 | Ga0068863_100178497 | Ga0068863_1001784973 | 149 |
| 503 | 3300005841 | Ga0068863_100883288 | Ga0068863_1008832882 | 149 |
| 504 | 3300005842 | Ga0068858_100207125 | Ga0068858_1002071252 | 149 |
| 505 | 3300005842 | Ga0068858_100523554 | Ga0068858_1005235542 | 149 |
| 506 | 3300005842 | Ga0068858_100655991 | Ga0068858_1006559912 | 149 |
| 507 | 3300005842 | Ga0068858_101090867 | Ga0068858_1010908672 | 149 |
| 508 | 3300005843 | Ga0068860_100184261 | Ga0068860_1001842613 | 149 |
| 509 | 3300005843 | Ga0068860_100254850 | Ga0068860_1002548502 | 149 |
| 510 | 3300005843 | Ga0068860_100721029 | Ga0068860_1007210292 | 149 |
| 511 | 3300005843 | Ga0068860_100811235 | Ga0068860_1008112352 | 149 |
| 512 | 3300005844 | Ga0068862_100054909 | Ga0068862_1000549094 | 149 |
| 513 | 3300005844 | Ga0068862_100401356 | Ga0068862_1004013562 | 149 |
| 514 | 3300005844 | Ga0068862_100429423 | Ga0068862_1004294232 | 149 |
| 515 | 3300005937 | Ga0081455_10005318 | Ga0081455_1000531812 | 149 |
| 516 | 3300005937 | Ga0081455_10050771 | Ga0081455_100507713 | 149 |
| 517 | 3300005937 | Ga0081455_10221734 | Ga0081455_102217342 | 149 |
| 518 | 3300005983 | Ga0081540_1010304 | Ga0081540_10103043 | 149 |
| 519 | 3300005983 | Ga0081540_1017033 | Ga0081540_10170331 | 149 |
| 520 | 3300005983 | Ga0081540_1336585 | Ga0081540_13365851 | 149 |
| 521 | 3300005985 | Ga0081539_10033177 | Ga0081539_100331772 | 149 |
| 522 | 3300005985 | Ga0081539_10158269 | Ga0081539_101582692 | 149 |
| 523 | 3300006038 | Ga0075365_10006261 | Ga0075365_100062616 | 149 |
| 524 | 3300006038 | Ga0075365_10093449 | Ga0075365_100934492 | 149 |
| 525 | 3300006038 | Ga0075365_10161152 | Ga0075365_101611522 | 149 |
| 526 | 3300006038 | Ga0075365_10391589 | Ga0075365_103915891 | 149 |
| 527 | 3300006038 | Ga0075365_10638562 | Ga0075365_106385621 | 149 |
| 528 | 3300006042 | Ga0075368_10125154 | Ga0075368_101251541 | 149 |
| 529 | 3300006042 | Ga0075368_10155787 | Ga0075368_101557872 | 149 |
| 530 | 3300006042 | Ga0075368_10418012 | Ga0075368_104180121 | 149 |
| 531 | 3300006048 | Ga0075363_100017307 | Ga0075363_1000173075 | 149 |
| 532 | 3300006048 | Ga0075363_100039953 | Ga0075363_1000399532 | 149 |
| 533 | 3300006048 | Ga0075363_100337333 | Ga0075363_1003373331 | 149 |
| 534 | 3300006051 | Ga0075364_10014626 | Ga0075364_100146265 | 149 |
| 535 | 3300006051 | Ga0075364_10036555 | Ga0075364_100365554 | 149 |
| 536 | 3300006051 | Ga0075364_10047544 | Ga0075364_100475443 | 149 |
| 537 | 3300006051 | Ga0075364_10141493 | Ga0075364_101414932 | 149 |
| 538 | 3300006051 | Ga0075364_10716470 | Ga0075364_107164702 | 149 |
| 539 | 3300006175 | Ga0070712_100537832 | Ga0070712_1005378321 | 149 |
| 540 | 3300006175 | Ga0070712_100759626 | Ga0070712_1007596261 | 149 |
| 541 | 3300006177 | Ga0075362_10042082 | Ga0075362_100420822 | 149 |
| 542 | 3300006177 | Ga0075362_10133856 | Ga0075362_101338562 | 149 |
| 543 | 3300006177 | Ga0075362_10202294 | Ga0075362_102022943 | 149 |
| 544 | 3300006177 | Ga0075362_10230203 | Ga0075362_102302031 | 149 |
| 545 | 3300006177 | Ga0075362_10551560 | Ga0075362_105515601 | 149 |
| 546 | 3300006178 | Ga0075367_10297684 | Ga0075367_102976841 | 149 |
| 547 | 3300006178 | Ga0075367_10305623 | Ga0075367_103056232 | 149 |
| 548 | 3300006178 | Ga0075367_10528756 | Ga0075367_105287562 | 149 |
| 549 | 3300006178 | Ga0075367_11029911 | Ga0075367_110299111 | 149 |
| 550 | 3300006186 | Ga0075369_10058083 | Ga0075369_100580832 | 149 |
| 551 | 3300006186 | Ga0075369_10070652 | Ga0075369_100706522 | 149 |
| 552 | 3300006195 | Ga0075366_10001094 | Ga0075366_100010949 | 149 |
| 553 | 3300006195 | Ga0075366_10215725 | Ga0075366_102157252 | 149 |
| 554 | 3300006195 | Ga0075366_10298268 | Ga0075366_102982681 | 149 |
| 555 | 3300006195 | Ga0075366_10466057 | Ga0075366_104660572 | 149 |
| 556 | 3300006237 | Ga0097621_100035743 | Ga0097621_1000357435 | 149 |
| 557 | 3300006237 | Ga0097621_100055409 | Ga0097621_1000554094 | 149 |
| 558 | 3300006237 | Ga0097621_100232958 | Ga0097621_1002329583 | 149 |
| 559 | 3300006237 | Ga0097621_100261967 | Ga0097621_1002619672 | 149 |
| 560 | 3300006237 | Ga0097621_101122735 | Ga0097621_1011227351 | 149 |
| 561 | 3300006237 | Ga0097621_101189075 | Ga0097621_1011890752 | 149 |
| 562 | 3300006353 | Ga0075370_10121882 | Ga0075370_101218822 | 149 |
| 563 | 3300006353 | Ga0075370_10307095 | Ga0075370_103070952 | 149 |
| 564 | 3300006353 | Ga0075370_10310308 | Ga0075370_103103082 | 149 |
| 565 | 3300006353 | Ga0075370_10354444 | Ga0075370_103544442 | 149 |
| 566 | 3300006353 | Ga0075370_10428933 | Ga0075370_104289332 | 149 |
| 567 | 3300006358 | Ga0068871_100090290 | Ga0068871_1000902903 | 149 |
| 568 | 3300006358 | Ga0068871_100315688 | Ga0068871_1003156882 | 149 |
| 569 | 3300006358 | Ga0068871_100369057 | Ga0068871_1003690572 | 149 |
| 570 | 3300006358 | Ga0068871_100868243 | Ga0068871_1008682432 | 149 |
| 571 | 3300006844 | Ga0075428_102153653 | Ga0075428_1021536531 | 149 |
| 572 | 3300006847 | Ga0075431_100991661 | Ga0075431_1009916611 | 149 |
| 573 | 3300006871 | Ga0075434_100304337 | Ga0075434_1003043373 | 149 |
| 574 | 3300006880 | Ga0075429_100660807 | Ga0075429_1006608072 | 149 |
| 575 | 3300006881 | Ga0068865_100029057 | Ga0068865_1000290572 | 149 |
| 576 | 3300006881 | Ga0068865_100166160 | Ga0068865_1001661601 | 149 |
| 577 | 3300006881 | Ga0068865_100889627 | Ga0068865_1008896271 | 149 |
| 578 | 3300006881 | Ga0068865_101396759 | Ga0068865_1013967591 | 149 |
| 579 | 3300006914 | Ga0075436_100119212 | Ga0075436_1001192122 | 149 |
| 580 | 3300006931 | Ga0097620_100068794 | Ga0097620_1000687942 | 149 |
| 581 | 3300006931 | Ga0097620_100280945 | Ga0097620_1002809452 | 149 |
| 582 | 3300006931 | Ga0097620_100760482 | Ga0097620_1007604822 | 149 |
| 583 | 3300006931 | Ga0097620_100871523 | Ga0097620_1008715232 | 149 |
| 584 | 3300006931 | Ga0097620_101512944 | Ga0097620_1015129442 | 149 |
| 585 | 3300006941 | Ga0099825_1018382 | Ga0099825_10183825 | 149 |
| 586 | 3300006942 | Ga0099824_1026579 | Ga0099824_10265792 | 149 |
| 587 | 3300006944 | Ga0099823_1033130 | Ga0099823_10331305 | 149 |
| 588 | 3300007076 | Ga0075435_100114100 | Ga0075435_1001141001 | 149 |
| 589 | 3300007076 | Ga0075435_100155415 | Ga0075435_1001554152 | 149 |
| 590 | 3300007788 | Ga0099795_10065487 | Ga0099795_100654872 | 149 |
| 591 | 3300009092 | Ga0105250_10045585 | Ga0105250_100455852 | 149 |
| 592 | 3300009093 | Ga0105240_10013828 | Ga0105240_100138284 | 149 |
| 593 | 3300009093 | Ga0105240_10027519 | Ga0105240_100275197 | 149 |
| 594 | 3300009093 | Ga0105240_10044366 | Ga0105240_100443666 | 149 |
| 595 | 3300009093 | Ga0105240_10138125 | Ga0105240_101381254 | 149 |
| 596 | 3300009093 | Ga0105240_10262166 | Ga0105240_102621661 | 149 |
| 597 | 3300009093 | Ga0105240_10440058 | Ga0105240_104400582 | 149 |
| 598 | 3300009093 | Ga0105240_12380091 | Ga0105240_123800911 | 149 |
| 599 | 3300009094 | Ga0111539_11053311 | Ga0111539_110533111 | 149 |
| 600 | 3300009098 | Ga0105245_10009595 | Ga0105245_100095952 | 149 |
| 601 | 3300009098 | Ga0105245_10050761 | Ga0105245_100507612 | 149 |
| 602 | 3300009098 | Ga0105245_10078640 | Ga0105245_100786403 | 149 |
| 603 | 3300009098 | Ga0105245_10522359 | Ga0105245_105223592 | 149 |
| 604 | 3300009098 | Ga0105245_10542236 | Ga0105245_105422362 | 149 |
| 605 | 3300009101 | Ga0105247_10085968 | Ga0105247_100859682 | 149 |
| 606 | 3300009101 | Ga0105247_10181627 | Ga0105247_101816272 | 149 |
| 607 | 3300009101 | Ga0105247_10181866 | Ga0105247_101818662 | 149 |
| 608 | 3300009101 | Ga0105247_10192544 | Ga0105247_101925442 | 149 |
| 609 | 3300009101 | Ga0105247_10202702 | Ga0105247_102027022 | 149 |
| 610 | 3300009101 | Ga0105247_10240311 | Ga0105247_102403112 | 149 |
| 611 | 3300009101 | Ga0105247_10282214 | Ga0105247_102822141 | 149 |
| 612 | 3300009101 | Ga0105247_10382440 | Ga0105247_103824402 | 149 |
| 613 | 3300009101 | Ga0105247_10602714 | Ga0105247_106027141 | 149 |
| 614 | 3300009147 | Ga0114129_10945285 | Ga0114129_109452851 | 149 |
| 615 | 3300009147 | Ga0114129_11426653 | Ga0114129_114266532 | 149 |
| 616 | 3300009148 | Ga0105243_10115754 | Ga0105243_101157543 | 149 |
| 617 | 3300009148 | Ga0105243_10545240 | Ga0105243_105452402 | 149 |
| 618 | 3300009148 | Ga0105243_11234157 | Ga0105243_112341572 | 149 |
| 619 | 3300009148 | Ga0105243_11286594 | Ga0105243_112865941 | 149 |
| 620 | 3300009148 | Ga0105243_12080973 | Ga0105243_120809731 | 149 |
| 621 | 3300009174 | Ga0105241_10018533 | Ga0105241_100185332 | 149 |
| 622 | 3300009174 | Ga0105241_10030488 | Ga0105241_100304883 | 149 |
| 623 | 3300009174 | Ga0105241_10044097 | Ga0105241_100440972 | 149 |
| 624 | 3300009174 | Ga0105241_10077496 | Ga0105241_100774961 | 149 |
| 625 | 3300009174 | Ga0105241_11839943 | Ga0105241_118399431 | 149 |
| 626 | 3300009174 | Ga0105241_11869337 | Ga0105241_118693371 | 149 |
| 627 | 3300009176 | Ga0105242_10031555 | Ga0105242_100315554 | 149 |
| 628 | 3300009176 | Ga0105242_10232529 | Ga0105242_102325292 | 149 |
| 629 | 3300009176 | Ga0105242_10236710 | Ga0105242_102367102 | 149 |
| 630 | 3300009176 | Ga0105242_10343904 | Ga0105242_103439042 | 149 |
| 631 | 3300009176 | Ga0105242_10522963 | Ga0105242_105229631 | 149 |
| 632 | 3300009177 | Ga0105248_10031653 | Ga0105248_100316536 | 149 |
| 633 | 3300009177 | Ga0105248_10260831 | Ga0105248_102608312 | 149 |
| 634 | 3300009177 | Ga0105248_10385201 | Ga0105248_103852012 | 149 |
| 635 | 3300009177 | Ga0105248_10683491 | Ga0105248_106834912 | 149 |
| 636 | 3300009177 | Ga0105248_10755529 | Ga0105248_107555291 | 149 |
| 637 | 3300009177 | Ga0105248_10805331 | Ga0105248_108053312 | 149 |
| 638 | 3300009177 | Ga0105248_10833276 | Ga0105248_108332762 | 149 |
| 639 | 3300009177 | Ga0105248_11274679 | Ga0105248_112746792 | 149 |
| 640 | 3300009545 | Ga0105237_10003348 | Ga0105237_100033488 | 149 |
| 641 | 3300009545 | Ga0105237_10091843 | Ga0105237_100918433 | 149 |
| 642 | 3300009545 | Ga0105237_10097904 | Ga0105237_100979041 | 149 |
| 643 | 3300009545 | Ga0105237_10202631 | Ga0105237_102026312 | 149 |
| 644 | 3300009545 | Ga0105237_10359153 | Ga0105237_103591532 | 149 |
| 645 | 3300009545 | Ga0105237_10487553 | Ga0105237_104875532 | 149 |
| 646 | 3300009545 | Ga0105237_10774716 | Ga0105237_107747161 | 149 |
| 647 | 3300009545 | Ga0105237_10898197 | Ga0105237_108981971 | 149 |
| 648 | 3300009545 | Ga0105237_10906613 | Ga0105237_109066131 | 149 |
| 649 | 3300009545 | Ga0105237_11226549 | Ga0105237_112265491 | 149 |
| 650 | 3300009551 | Ga0105238_10079817 | Ga0105238_100798172 | 149 |
| 651 | 3300009551 | Ga0105238_10484653 | Ga0105238_104846532 | 149 |
| 652 | 3300009551 | Ga0105238_10561912 | Ga0105238_105619121 | 149 |
| 653 | 3300009551 | Ga0105238_10831399 | Ga0105238_108313992 | 149 |
| 654 | 3300009553 | Ga0105249_10302860 | Ga0105249_103028602 | 149 |
| 655 | 3300009553 | Ga0105249_10440733 | Ga0105249_104407331 | 149 |
| 656 | 3300009553 | Ga0105249_10898227 | Ga0105249_108982272 | 149 |
| 657 | 3300009553 | Ga0105249_11771734 | Ga0105249_117717341 | 149 |
| 658 | 3300010375 | Ga0105239_10018332 | Ga0105239_100183322 | 149 |
| 659 | 3300010375 | Ga0105239_10104301 | Ga0105239_101043012 | 149 |
| 660 | 3300010375 | Ga0105239_10131922 | Ga0105239_101319221 | 149 |
| 661 | 3300010375 | Ga0105239_10149301 | Ga0105239_101493013 | 149 |
| 662 | 3300010375 | Ga0105239_10295644 | Ga0105239_102956443 | 149 |
| 663 | 3300010375 | Ga0105239_10511702 | Ga0105239_105117022 | 149 |
| 664 | 3300010375 | Ga0105239_10530521 | Ga0105239_105305212 | 149 |
| 665 | 3300010375 | Ga0105239_10532014 | Ga0105239_105320142 | 149 |
| 666 | 3300010375 | Ga0105239_10840982 | Ga0105239_108409821 | 149 |
| 667 | 3300010375 | Ga0105239_10952383 | Ga0105239_109523831 | 149 |
| 668 | 3300010375 | Ga0105239_10973716 | Ga0105239_109737162 | 149 |
| 669 | 3300010375 | Ga0105239_11279412 | Ga0105239_112794122 | 149 |
| 670 | 3300010375 | Ga0105239_11965021 | Ga0105239_119650211 | 149 |
| 671 | 3300011119 | Ga0105246_10038063 | Ga0105246_100380634 | 149 |
| 672 | 3300011119 | Ga0105246_10088764 | Ga0105246_100887643 | 149 |
| 673 | 3300011119 | Ga0105246_10115570 | Ga0105246_101155702 | 149 |
| 674 | 3300011119 | Ga0105246_10136061 | Ga0105246_101360612 | 149 |
| 675 | 3300011119 | Ga0105246_10761716 | Ga0105246_107617162 | 149 |
| 676 | 3300011119 | Ga0105246_10818123 | Ga0105246_108181231 | 149 |
| 677 | 3300011119 | Ga0105246_12280998 | Ga0105246_122809981 | 149 |
| 678 | 3300012498 | Ga0157345_1006877 | Ga0157345_10068771 | 149 |
| 679 | 3300012503 | Ga0157313_1011018 | Ga0157313_10110182 | 149 |
| 680 | 3300013100 | Ga0157373_10458265 | Ga0157373_104582651 | 149 |
| 681 | 3300013100 | Ga0157373_10515056 | Ga0157373_105150561 | 149 |
| 682 | 3300013102 | Ga0157371_10201583 | Ga0157371_102015832 | 149 |
| 683 | 3300013102 | Ga0157371_10390220 | Ga0157371_103902202 | 149 |
| 684 | 3300013104 | Ga0157370_10200281 | Ga0157370_102002812 | 149 |
| 685 | 3300013104 | Ga0157370_10700278 | Ga0157370_107002781 | 149 |
| 686 | 3300013104 | Ga0157370_10718813 | Ga0157370_107188131 | 149 |
| 687 | 3300013105 | Ga0157369_10006967 | Ga0157369_100069677 | 149 |
| 688 | 3300013105 | Ga0157369_10029245 | Ga0157369_100292457 | 149 |
| 689 | 3300013105 | Ga0157369_10231572 | Ga0157369_102315722 | 149 |
| 690 | 3300013105 | Ga0157369_10252747 | Ga0157369_102527472 | 149 |
| 691 | 3300013296 | Ga0157374_10024124 | Ga0157374_100241246 | 149 |
| 692 | 3300013296 | Ga0157374_10068209 | Ga0157374_100682094 | 149 |
| 693 | 3300013296 | Ga0157374_10296880 | Ga0157374_102968802 | 149 |
| 694 | 3300013296 | Ga0157374_11095515 | Ga0157374_110955152 | 149 |
| 695 | 3300013296 | Ga0157374_11594968 | Ga0157374_115949681 | 149 |
| 696 | 3300013296 | Ga0157374_11623872 | Ga0157374_116238721 | 149 |
| 697 | 3300013297 | Ga0157378_10154622 | Ga0157378_101546222 | 149 |
| 698 | 3300013297 | Ga0157378_10232677 | Ga0157378_102326772 | 149 |
| 699 | 3300013297 | Ga0157378_10255428 | Ga0157378_102554282 | 149 |
| 700 | 3300013306 | Ga0163162_10059973 | Ga0163162_100599731 | 149 |
| 701 | 3300013306 | Ga0163162_10428584 | Ga0163162_104285842 | 149 |
| 702 | 3300013306 | Ga0163162_10608268 | Ga0163162_106082682 | 149 |
| 703 | 3300013306 | Ga0163162_10644818 | Ga0163162_106448181 | 149 |
| 704 | 3300013306 | Ga0163162_10731650 | Ga0163162_107316501 | 149 |
| 705 | 3300013306 | Ga0163162_10849319 | Ga0163162_108493192 | 149 |
| 706 | 3300013306 | Ga0163162_11144359 | Ga0163162_111443592 | 149 |
| 707 | 3300013307 | Ga0157372_10038207 | Ga0157372_100382077 | 149 |
| 708 | 3300013307 | Ga0157372_10410606 | Ga0157372_104106061 | 149 |
| 709 | 3300013307 | Ga0157372_10549398 | Ga0157372_105493982 | 149 |
| 710 | 3300013307 | Ga0157372_10756343 | Ga0157372_107563432 | 149 |
| 711 | 3300013307 | Ga0157372_10877840 | Ga0157372_108778402 | 149 |
| 712 | 3300013308 | Ga0157375_10010993 | Ga0157375_1001099310 | 149 |
| 713 | 3300013308 | Ga0157375_10598315 | Ga0157375_105983152 | 149 |
| 714 | 3300013308 | Ga0157375_10672554 | Ga0157375_106725542 | 149 |
| 715 | 3300013308 | Ga0157375_10745630 | Ga0157375_107456301 | 149 |
| 716 | 3300013308 | Ga0157375_11334070 | Ga0157375_113340702 | 149 |
| 717 | 3300014325 | Ga0163163_10006916 | Ga0163163_100069168 | 149 |
| 718 | 3300014325 | Ga0163163_10062028 | Ga0163163_100620284 | 149 |
| 719 | 3300014325 | Ga0163163_10341962 | Ga0163163_103419622 | 149 |
| 720 | 3300014325 | Ga0163163_10536097 | Ga0163163_105360972 | 149 |
| 721 | 3300014325 | Ga0163163_10652628 | Ga0163163_106526281 | 149 |
| 722 | 3300014325 | Ga0163163_11007505 | Ga0163163_110075051 | 149 |
| 723 | 3300014325 | Ga0163163_11908193 | Ga0163163_119081931 | 149 |
| 724 | 3300014325 | Ga0163163_12815287 | Ga0163163_128152871 | 149 |
| 725 | 3300014326 | Ga0157380_10100918 | Ga0157380_101009183 | 149 |
| 726 | 3300014326 | Ga0157380_11561973 | Ga0157380_115619731 | 149 |
| 727 | 3300014497 | Ga0182008_10663247 | Ga0182008_106632471 | 149 |
| 728 | 3300014745 | Ga0157377_10026554 | Ga0157377_100265544 | 149 |
| 729 | 3300014745 | Ga0157377_10338862 | Ga0157377_103388622 | 149 |
| 730 | 3300014968 | Ga0157379_10296259 | Ga0157379_102962592 | 149 |
| 731 | 3300014968 | Ga0157379_10340773 | Ga0157379_103407731 | 149 |
| 732 | 3300014968 | Ga0157379_10388144 | Ga0157379_103881442 | 149 |
| 733 | 3300014968 | Ga0157379_10714271 | Ga0157379_107142713 | 149 |
| 734 | 3300014969 | Ga0157376_10012225 | Ga0157376_100122257 | 149 |
| 735 | 3300014969 | Ga0157376_10049941 | Ga0157376_100499411 | 149 |
| 736 | 3300014969 | Ga0157376_10269468 | Ga0157376_102694683 | 149 |
| 737 | 3300014969 | Ga0157376_11093359 | Ga0157376_110933592 | 149 |
| 738 | 3300014969 | Ga0157376_11780286 | Ga0157376_117802861 | 149 |
| 739 | 3300015262 | Ga0182007_10252909 | Ga0182007_102529091 | 149 |
| 740 | 3300017792 | Ga0163161_10155939 | Ga0163161_101559392 | 149 |
| 741 | 3300017792 | Ga0163161_10160410 | Ga0163161_101604101 | 149 |
| 742 | 3300017792 | Ga0163161_10194624 | Ga0163161_101946242 | 149 |
| 743 | 3300017792 | Ga0163161_10756901 | Ga0163161_107569012 | 149 |
| 744 | 3300017792 | Ga0163161_10788628 | Ga0163161_107886281 | 149 |
| 745 | 3300020069 | Ga0197907_10464309 | Ga0197907_104643091 | 149 |
| 746 | 3300020069 | Ga0197907_10526031 | Ga0197907_105260311 | 149 |
| 747 | 3300020069 | Ga0197907_10831135 | Ga0197907_108311351 | 149 |
| 748 | 3300020070 | Ga0206356_10656885 | Ga0206356_106568852 | 149 |
| 749 | 3300020070 | Ga0206356_11377276 | Ga0206356_113772761 | 149 |
| 750 | 3300020070 | Ga0206356_11842844 | Ga0206356_118428442 | 149 |
| 751 | 3300020077 | Ga0206351_10675134 | Ga0206351_106751341 | 149 |
| 752 | 3300020078 | Ga0206352_10265531 | Ga0206352_102655311 | 149 |
| 753 | 3300020078 | Ga0206352_10786040 | Ga0206352_107860401 | 149 |
| 754 | 3300020080 | Ga0206350_10535223 | Ga0206350_105352231 | 149 |
| 755 | 3300020082 | Ga0206353_10765933 | Ga0206353_107659331 | 149 |
| 756 | 3300020082 | Ga0206353_10960214 | Ga0206353_109602141 | 149 |
| 757 | 3300021377 | Ga0213874_10029949 | Ga0213874_100299491 | 149 |
| 758 | 3300021384 | Ga0213876_10013409 | Ga0213876_100134092 | 149 |
| 759 | 3300021384 | Ga0213876_10025379 | Ga0213876_100253794 | 149 |
| 760 | 3300022467 | Ga0224712_10641122 | Ga0224712_106411221 | 149 |
| 761 | 3300025230 | Ga0209563_110550 | Ga0209563_1105501 | 149 |
| 762 | 3300025253 | Ga0209677_102452 | Ga0209677_1024522 | 149 |
| 763 | 3300025254 | Ga0209148_1002608 | Ga0209148_10026082 | 149 |
| 764 | 3300025261 | Ga0209233_1001880 | Ga0209233_10018806 | 149 |
| 765 | 3300025261 | Ga0209233_1010217 | Ga0209233_10102173 | 149 |
| 766 | 3300025272 | Ga0209455_1000714 | Ga0209455_10007145 | 149 |
| 767 | 3300025273 | Ga0209673_1027816 | Ga0209673_10278162 | 149 |
| 768 | 3300025295 | Ga0209564_1004469 | Ga0209564_10044695 | 149 |
| 769 | 3300025295 | Ga0209564_1013773 | Ga0209564_10137734 | 149 |
| 770 | 3300025295 | Ga0209564_1013929 | Ga0209564_10139291 | 149 |
| 771 | 3300025297 | Ga0209758_1000141 | Ga0209758_100014142 | 149 |
| 772 | 3300025297 | Ga0209758_1002921 | Ga0209758_100292110 | 149 |
| 773 | 3300025297 | Ga0209758_1003483 | Ga0209758_10034833 | 149 |
| 774 | 3300025297 | Ga0209758_1004079 | Ga0209758_100407912 | 149 |
| 775 | 3300025297 | Ga0209758_1020105 | Ga0209758_10201052 | 149 |
| 776 | 3300025297 | Ga0209758_1082898 | Ga0209758_10828981 | 149 |
| 777 | 3300025297 | Ga0209758_1129680 | Ga0209758_11296801 | 149 |
| 778 | 3300025299 | Ga0209256_1002956 | Ga0209256_10029568 | 149 |
| 779 | 3300025302 | Ga0207426_1000437 | Ga0207426_100043715 | 149 |
| 780 | 3300025302 | Ga0207426_1001139 | Ga0207426_100113911 | 149 |
| 781 | 3300025302 | Ga0207426_1008512 | Ga0207426_10085124 | 149 |
| 782 | 3300025302 | Ga0207426_1014295 | Ga0207426_10142952 | 149 |
| 783 | 3300025302 | Ga0207426_1027953 | Ga0207426_10279532 | 149 |
| 784 | 3300025303 | Ga0209051_1022867 | Ga0209051_10228673 | 149 |
| 785 | 3300025304 | Ga0209257_1006467 | Ga0209257_10064679 | 149 |
| 786 | 3300025304 | Ga0209257_1041881 | Ga0209257_10418812 | 149 |
| 787 | 3300025315 | Ga0207697_10090616 | Ga0207697_100906161 | 149 |
| 788 | 3300025315 | Ga0207697_10161404 | Ga0207697_101614041 | 149 |
| 789 | 3300025315 | Ga0207697_10349939 | Ga0207697_103499391 | 149 |
| 790 | 3300025711 | Ga0207696_1163742 | Ga0207696_11637421 | 149 |
| 791 | 3300025893 | Ga0207682_10003043 | Ga0207682_100030433 | 149 |
| 792 | 3300025898 | Ga0207692_10612950 | Ga0207692_106129501 | 149 |
| 793 | 3300025899 | Ga0207642_10012062 | Ga0207642_100120624 | 149 |
| 794 | 3300025899 | Ga0207642_10209809 | Ga0207642_102098092 | 149 |
| 795 | 3300025900 | Ga0207710_10213592 | Ga0207710_102135921 | 149 |
| 796 | 3300025900 | Ga0207710_10265723 | Ga0207710_102657231 | 149 |
| 797 | 3300025900 | Ga0207710_10309245 | Ga0207710_103092452 | 149 |
| 798 | 3300025900 | Ga0207710_10314634 | Ga0207710_103146341 | 149 |
| 799 | 3300025901 | Ga0207688_10020261 | Ga0207688_100202614 | 149 |
| 800 | 3300025901 | Ga0207688_10021578 | Ga0207688_100215782 | 149 |
| 801 | 3300025901 | Ga0207688_10025537 | Ga0207688_100255373 | 149 |
| 802 | 3300025901 | Ga0207688_10211763 | Ga0207688_102117632 | 149 |
| 803 | 3300025903 | Ga0207680_10265851 | Ga0207680_102658513 | 149 |
| 804 | 3300025903 | Ga0207680_10850649 | Ga0207680_108506491 | 149 |
| 805 | 3300025904 | Ga0207647_10044022 | Ga0207647_100440224 | 149 |
| 806 | 3300025904 | Ga0207647_10097140 | Ga0207647_100971403 | 149 |
| 807 | 3300025904 | Ga0207647_10218637 | Ga0207647_102186372 | 149 |
| 808 | 3300025907 | Ga0207645_10019706 | Ga0207645_100197061 | 149 |
| 809 | 3300025907 | Ga0207645_10057779 | Ga0207645_100577793 | 149 |
| 810 | 3300025907 | Ga0207645_10091167 | Ga0207645_100911672 | 149 |
| 811 | 3300025907 | Ga0207645_10172579 | Ga0207645_101725791 | 149 |
| 812 | 3300025907 | Ga0207645_10269356 | Ga0207645_102693563 | 149 |
| 813 | 3300025907 | Ga0207645_10290778 | Ga0207645_102907781 | 149 |
| 814 | 3300025908 | Ga0207643_10626496 | Ga0207643_106264961 | 149 |
| 815 | 3300025909 | Ga0207705_10259019 | Ga0207705_102590191 | 149 |
| 816 | 3300025909 | Ga0207705_10373921 | Ga0207705_103739211 | 149 |
| 817 | 3300025911 | Ga0207654_10039611 | Ga0207654_100396111 | 149 |
| 818 | 3300025911 | Ga0207654_10045872 | Ga0207654_100458723 | 149 |
| 819 | 3300025912 | Ga0207707_10000754 | Ga0207707_100007542 | 149 |
| 820 | 3300025912 | Ga0207707_10191557 | Ga0207707_101915573 | 149 |
| 821 | 3300025912 | Ga0207707_10219014 | Ga0207707_102190141 | 149 |
| 822 | 3300025912 | Ga0207707_10530243 | Ga0207707_105302432 | 149 |
| 823 | 3300025913 | Ga0207695_10000062 | Ga0207695_10000062154 | 149 |
| 824 | 3300025913 | Ga0207695_10050638 | Ga0207695_100506382 | 149 |
| 825 | 3300025914 | Ga0207671_10001897 | Ga0207671_1000189715 | 149 |
| 826 | 3300025914 | Ga0207671_10051511 | Ga0207671_100515112 | 149 |
| 827 | 3300025914 | Ga0207671_10060968 | Ga0207671_100609682 | 149 |
| 828 | 3300025915 | Ga0207693_10159079 | Ga0207693_101590791 | 149 |
| 829 | 3300025915 | Ga0207693_10591358 | Ga0207693_105913582 | 149 |
| 830 | 3300025915 | Ga0207693_11166919 | Ga0207693_111669191 | 149 |
| 831 | 3300025916 | Ga0207663_10705132 | Ga0207663_107051322 | 149 |
| 832 | 3300025916 | Ga0207663_10922191 | Ga0207663_109221911 | 149 |
| 833 | 3300025917 | Ga0207660_10043144 | Ga0207660_100431442 | 149 |
| 834 | 3300025917 | Ga0207660_10048371 | Ga0207660_100483711 | 149 |
| 835 | 3300025917 | Ga0207660_10163794 | Ga0207660_101637941 | 149 |
| 836 | 3300025918 | Ga0207662_10135318 | Ga0207662_101353182 | 149 |
| 837 | 3300025918 | Ga0207662_10627391 | Ga0207662_106273911 | 149 |
| 838 | 3300025918 | Ga0207662_10734437 | Ga0207662_107344371 | 149 |
| 839 | 3300025919 | Ga0207657_10003905 | Ga0207657_100039057 | 149 |
| 840 | 3300025919 | Ga0207657_10258482 | Ga0207657_102584822 | 149 |
| 841 | 3300025919 | Ga0207657_10357412 | Ga0207657_103574122 | 149 |
| 842 | 3300025919 | Ga0207657_11210963 | Ga0207657_112109631 | 149 |
| 843 | 3300025920 | Ga0207649_10072579 | Ga0207649_100725793 | 149 |
| 844 | 3300025920 | Ga0207649_10121305 | Ga0207649_101213051 | 149 |
| 845 | 3300025921 | Ga0207652_10005840 | Ga0207652_100058404 | 149 |
| 846 | 3300025921 | Ga0207652_10029294 | Ga0207652_100292944 | 149 |
| 847 | 3300025921 | Ga0207652_10193719 | Ga0207652_101937192 | 149 |
| 848 | 3300025921 | Ga0207652_10333981 | Ga0207652_103339812 | 149 |
| 849 | 3300025921 | Ga0207652_10558527 | Ga0207652_105585271 | 149 |
| 850 | 3300025921 | Ga0207652_11396455 | Ga0207652_113964551 | 149 |
| 851 | 3300025922 | Ga0207646_11222457 | Ga0207646_112224571 | 149 |
| 852 | 3300025923 | Ga0207681_10391042 | Ga0207681_103910422 | 149 |
| 853 | 3300025923 | Ga0207681_10570152 | Ga0207681_105701522 | 149 |
| 854 | 3300025923 | Ga0207681_10920387 | Ga0207681_109203871 | 149 |
| 855 | 3300025924 | Ga0207694_10273712 | Ga0207694_102737123 | 149 |
| 856 | 3300025924 | Ga0207694_10350128 | Ga0207694_103501282 | 149 |
| 857 | 3300025924 | Ga0207694_11438027 | Ga0207694_114380271 | 149 |
| 858 | 3300025925 | Ga0207650_10195427 | Ga0207650_101954272 | 149 |
| 859 | 3300025925 | Ga0207650_10701976 | Ga0207650_107019761 | 149 |
| 860 | 3300025925 | Ga0207650_10744973 | Ga0207650_107449731 | 149 |
| 861 | 3300025926 | Ga0207659_10070799 | Ga0207659_100707992 | 149 |
| 862 | 3300025926 | Ga0207659_10350653 | Ga0207659_103506532 | 149 |
| 863 | 3300025926 | Ga0207659_10611148 | Ga0207659_106111482 | 149 |
| 864 | 3300025926 | Ga0207659_10616588 | Ga0207659_106165882 | 149 |
| 865 | 3300025926 | Ga0207659_10941915 | Ga0207659_109419151 | 149 |
| 866 | 3300025927 | Ga0207687_10010386 | Ga0207687_100103865 | 149 |
| 867 | 3300025927 | Ga0207687_10021894 | Ga0207687_100218942 | 149 |
| 868 | 3300025927 | Ga0207687_10151887 | Ga0207687_101518873 | 149 |
| 869 | 3300025927 | Ga0207687_10322087 | Ga0207687_103220872 | 149 |
| 870 | 3300025927 | Ga0207687_10330403 | Ga0207687_103304032 | 149 |
| 871 | 3300025927 | Ga0207687_11412429 | Ga0207687_114124292 | 149 |
| 872 | 3300025928 | Ga0207700_10447055 | Ga0207700_104470552 | 149 |
| 873 | 3300025929 | Ga0207664_10582856 | Ga0207664_105828561 | 149 |
| 874 | 3300025929 | Ga0207664_11406083 | Ga0207664_114060831 | 149 |
| 875 | 3300025931 | Ga0207644_10051283 | Ga0207644_100512834 | 149 |
| 876 | 3300025931 | Ga0207644_10089423 | Ga0207644_100894232 | 149 |
| 877 | 3300025931 | Ga0207644_10292458 | Ga0207644_102924582 | 149 |
| 878 | 3300025931 | Ga0207644_10373385 | Ga0207644_103733852 | 149 |
| 879 | 3300025931 | Ga0207644_10409760 | Ga0207644_104097601 | 149 |
| 880 | 3300025931 | Ga0207644_10607914 | Ga0207644_106079142 | 149 |
| 881 | 3300025931 | Ga0207644_11153061 | Ga0207644_111530611 | 149 |
| 882 | 3300025932 | Ga0207690_10225060 | Ga0207690_102250602 | 149 |
| 883 | 3300025932 | Ga0207690_10464249 | Ga0207690_104642492 | 149 |
| 884 | 3300025932 | Ga0207690_10648931 | Ga0207690_106489312 | 149 |
| 885 | 3300025932 | Ga0207690_10984603 | Ga0207690_109846031 | 149 |
| 886 | 3300025932 | Ga0207690_11113027 | Ga0207690_111130271 | 149 |
| 887 | 3300025933 | Ga0207706_10034566 | Ga0207706_100345665 | 149 |
| 888 | 3300025933 | Ga0207706_10177295 | Ga0207706_101772952 | 149 |
| 889 | 3300025933 | Ga0207706_10255486 | Ga0207706_102554862 | 149 |
| 890 | 3300025933 | Ga0207706_11191986 | Ga0207706_111919861 | 149 |
| 891 | 3300025934 | Ga0207686_10070784 | Ga0207686_100707843 | 149 |
| 892 | 3300025934 | Ga0207686_10339537 | Ga0207686_103395372 | 149 |
| 893 | 3300025934 | Ga0207686_10379580 | Ga0207686_103795803 | 149 |
| 894 | 3300025935 | Ga0207709_10075840 | Ga0207709_100758402 | 149 |
| 895 | 3300025935 | Ga0207709_10456047 | Ga0207709_104560472 | 149 |
| 896 | 3300025935 | Ga0207709_10552107 | Ga0207709_105521072 | 149 |
| 897 | 3300025935 | Ga0207709_10815073 | Ga0207709_108150732 | 149 |
| 898 | 3300025935 | Ga0207709_10877478 | Ga0207709_108774782 | 149 |
| 899 | 3300025936 | Ga0207670_10796620 | Ga0207670_107966202 | 149 |
| 900 | 3300025937 | Ga0207669_10006478 | Ga0207669_100064785 | 149 |
| 901 | 3300025937 | Ga0207669_10028974 | Ga0207669_100289742 | 149 |
| 902 | 3300025937 | Ga0207669_10110785 | Ga0207669_101107853 | 149 |
| 903 | 3300025938 | Ga0207704_10390159 | Ga0207704_103901592 | 149 |
| 904 | 3300025938 | Ga0207704_10943309 | Ga0207704_109433091 | 149 |
| 905 | 3300025939 | Ga0207665_10203125 | Ga0207665_102031252 | 149 |
| 906 | 3300025940 | Ga0207691_10005845 | Ga0207691_100058455 | 149 |
| 907 | 3300025940 | Ga0207691_10390768 | Ga0207691_103907682 | 149 |
| 908 | 3300025940 | Ga0207691_10634759 | Ga0207691_106347592 | 149 |
| 909 | 3300025940 | Ga0207691_10756413 | Ga0207691_107564131 | 149 |
| 910 | 3300025940 | Ga0207691_11593870 | Ga0207691_115938701 | 149 |
| 911 | 3300025941 | Ga0207711_10050250 | Ga0207711_100502504 | 149 |
| 912 | 3300025941 | Ga0207711_10184988 | Ga0207711_101849882 | 149 |
| 913 | 3300025941 | Ga0207711_10441642 | Ga0207711_104416422 | 149 |
| 914 | 3300025941 | Ga0207711_10614434 | Ga0207711_106144342 | 149 |
| 915 | 3300025942 | Ga0207689_10048255 | Ga0207689_100482552 | 149 |
| 916 | 3300025942 | Ga0207689_10281584 | Ga0207689_102815842 | 149 |
| 917 | 3300025942 | Ga0207689_10426439 | Ga0207689_104264391 | 149 |
| 918 | 3300025944 | Ga0207661_10003055 | Ga0207661_1000305512 | 149 |
| 919 | 3300025944 | Ga0207661_11351331 | Ga0207661_113513311 | 149 |
| 920 | 3300025945 | Ga0207679_10140634 | Ga0207679_101406343 | 149 |
| 921 | 3300025945 | Ga0207679_10324455 | Ga0207679_103244553 | 149 |
| 922 | 3300025945 | Ga0207679_10525044 | Ga0207679_105250442 | 149 |
| 923 | 3300025949 | Ga0207667_10037813 | Ga0207667_100378134 | 149 |
| 924 | 3300025949 | Ga0207667_10082010 | Ga0207667_100820103 | 149 |
| 925 | 3300025949 | Ga0207667_10439076 | Ga0207667_104390762 | 149 |
| 926 | 3300025960 | Ga0207651_10320090 | Ga0207651_103200902 | 149 |
| 927 | 3300025960 | Ga0207651_10488967 | Ga0207651_104889672 | 149 |
| 928 | 3300025961 | Ga0207712_10271398 | Ga0207712_102713983 | 149 |
| 929 | 3300025961 | Ga0207712_10656339 | Ga0207712_106563391 | 149 |
| 930 | 3300025961 | Ga0207712_10675421 | Ga0207712_106754212 | 149 |
| 931 | 3300025961 | Ga0207712_11087175 | Ga0207712_110871752 | 149 |
| 932 | 3300025972 | Ga0207668_10035749 | Ga0207668_100357492 | 149 |
| 933 | 3300025972 | Ga0207668_10279303 | Ga0207668_102793032 | 149 |
| 934 | 3300025972 | Ga0207668_10313641 | Ga0207668_103136412 | 149 |
| 935 | 3300025972 | Ga0207668_10627425 | Ga0207668_106274251 | 149 |
| 936 | 3300025972 | Ga0207668_10807630 | Ga0207668_108076301 | 149 |
| 937 | 3300025981 | Ga0207640_10090881 | Ga0207640_100908812 | 149 |
| 938 | 3300025981 | Ga0207640_10337633 | Ga0207640_103376331 | 149 |
| 939 | 3300025981 | Ga0207640_10510928 | Ga0207640_105109281 | 149 |
| 940 | 3300025981 | Ga0207640_10903981 | Ga0207640_109039811 | 149 |
| 941 | 3300025986 | Ga0207658_10134571 | Ga0207658_101345712 | 149 |
| 942 | 3300025986 | Ga0207658_10196013 | Ga0207658_101960133 | 149 |
| 943 | 3300025986 | Ga0207658_10232830 | Ga0207658_102328302 | 149 |
| 944 | 3300025986 | Ga0207658_10699199 | Ga0207658_106991992 | 149 |
| 945 | 3300026023 | Ga0207677_10010248 | Ga0207677_100102486 | 149 |
| 946 | 3300026023 | Ga0207677_10272560 | Ga0207677_102725603 | 149 |
| 947 | 3300026023 | Ga0207677_10322327 | Ga0207677_103223272 | 149 |
| 948 | 3300026023 | Ga0207677_11636900 | Ga0207677_116369001 | 149 |
| 949 | 3300026035 | Ga0207703_10012005 | Ga0207703_100120054 | 149 |
| 950 | 3300026035 | Ga0207703_10045747 | Ga0207703_100457474 | 149 |
| 951 | 3300026035 | Ga0207703_10444883 | Ga0207703_104448832 | 149 |
| 952 | 3300026035 | Ga0207703_10633035 | Ga0207703_106330352 | 149 |
| 953 | 3300026035 | Ga0207703_10780517 | Ga0207703_107805172 | 149 |
| 954 | 3300026041 | Ga0207639_10059133 | Ga0207639_100591333 | 149 |
| 955 | 3300026041 | Ga0207639_10149925 | Ga0207639_101499252 | 149 |
| 956 | 3300026041 | Ga0207639_10306699 | Ga0207639_103066991 | 149 |
| 957 | 3300026041 | Ga0207639_10981045 | Ga0207639_109810451 | 149 |
| 958 | 3300026041 | Ga0207639_11449589 | Ga0207639_114495891 | 149 |
| 959 | 3300026067 | Ga0207678_10005024 | Ga0207678_100050244 | 149 |
| 960 | 3300026067 | Ga0207678_10081977 | Ga0207678_100819772 | 149 |
| 961 | 3300026067 | Ga0207678_10162810 | Ga0207678_101628102 | 149 |
| 962 | 3300026067 | Ga0207678_10190588 | Ga0207678_101905882 | 149 |
| 963 | 3300026067 | Ga0207678_10220596 | Ga0207678_102205962 | 149 |
| 964 | 3300026067 | Ga0207678_10234728 | Ga0207678_102347282 | 149 |
| 965 | 3300026067 | Ga0207678_10245528 | Ga0207678_102455282 | 149 |
| 966 | 3300026067 | Ga0207678_10366915 | Ga0207678_103669151 | 149 |
| 967 | 3300026067 | Ga0207678_10372302 | Ga0207678_103723021 | 149 |
| 968 | 3300026067 | Ga0207678_10721338 | Ga0207678_107213381 | 149 |
| 969 | 3300026075 | Ga0207708_10115299 | Ga0207708_101152992 | 149 |
| 970 | 3300026075 | Ga0207708_10170152 | Ga0207708_101701522 | 149 |
| 971 | 3300026078 | Ga0207702_10427084 | Ga0207702_104270842 | 149 |
| 972 | 3300026078 | Ga0207702_10805980 | Ga0207702_108059801 | 149 |
| 973 | 3300026088 | Ga0207641_10202741 | Ga0207641_102027412 | 149 |
| 974 | 3300026088 | Ga0207641_11031056 | Ga0207641_110310562 | 149 |
| 975 | 3300026089 | Ga0207648_10589050 | Ga0207648_105890502 | 149 |
| 976 | 3300026095 | Ga0207676_10070319 | Ga0207676_100703193 | 149 |
| 977 | 3300026095 | Ga0207676_10108982 | Ga0207676_101089822 | 149 |
| 978 | 3300026095 | Ga0207676_10990238 | Ga0207676_109902381 | 149 |
| 979 | 3300026116 | Ga0207674_10066105 | Ga0207674_100661052 | 149 |
| 980 | 3300026116 | Ga0207674_10070326 | Ga0207674_100703261 | 149 |
| 981 | 3300026116 | Ga0207674_10329357 | Ga0207674_103293571 | 149 |
| 982 | 3300026116 | Ga0207674_10419592 | Ga0207674_104195922 | 149 |
| 983 | 3300026116 | Ga0207674_10712038 | Ga0207674_107120381 | 149 |
| 984 | 3300026116 | Ga0207674_10847657 | Ga0207674_108476572 | 149 |
| 985 | 3300026118 | Ga0207675_100028089 | Ga0207675_1000280894 | 149 |
| 986 | 3300026118 | Ga0207675_100034859 | Ga0207675_1000348595 | 149 |
| 987 | 3300026118 | Ga0207675_100091356 | Ga0207675_1000913562 | 149 |
| 988 | 3300026118 | Ga0207675_100827403 | Ga0207675_1008274031 | 149 |
| 989 | 3300026121 | Ga0207683_10003145 | Ga0207683_100031455 | 149 |
| 990 | 3300026121 | Ga0207683_10016895 | Ga0207683_100168952 | 149 |
| 991 | 3300026121 | Ga0207683_10065573 | Ga0207683_100655734 | 149 |
| 992 | 3300026121 | Ga0207683_10100910 | Ga0207683_101009101 | 149 |
| 993 | 3300026121 | Ga0207683_10236280 | Ga0207683_102362801 | 149 |
| 994 | 3300026121 | Ga0207683_10316422 | Ga0207683_103164222 | 149 |
| 995 | 3300026121 | Ga0207683_10316838 | Ga0207683_103168382 | 149 |
| 996 | 3300026121 | Ga0207683_10539136 | Ga0207683_105391362 | 149 |
| 997 | 3300026142 | Ga0207698_10054121 | Ga0207698_100541213 | 149 |
| 998 | 3300026142 | Ga0207698_10237666 | Ga0207698_102376662 | 149 |
| 999 | 3300026142 | Ga0207698_10595012 | Ga0207698_105950122 | 149 |
| 1000 | 3300026142 | Ga0207698_11205121 | Ga0207698_112051212 | 149 |
| 1001 | 3300027296 | Ga0209389_1000004 | Ga0209389_1000004106 | 149 |
| 1002 | 3300027296 | Ga0209389_1000023 | Ga0209389_1000023104 | 149 |
| 1003 | 3300027357 | Ga0209589_1000010 | Ga0209589_100001055 | 149 |
| 1004 | 3300027361 | Ga0209489_100011 | Ga0209489_100011181 | 149 |
| 1005 | 3300027361 | Ga0209489_100777 | Ga0209489_10077748 | 149 |
| 1006 | 3300027363 | Ga0209700_100013 | Ga0209700_100013192 | 149 |
| 1007 | 3300027866 | Ga0209813_10439730 | Ga0209813_104397301 | 149 |
| 1008 | 3300028379 | Ga0268266_10012387 | Ga0268266_100123875 | 149 |
| 1009 | 3300028379 | Ga0268266_10027174 | Ga0268266_100271744 | 149 |
| 1010 | 3300028379 | Ga0268266_10029034 | Ga0268266_100290346 | 149 |
| 1011 | 3300028379 | Ga0268266_10060413 | Ga0268266_100604131 | 149 |
| 1012 | 3300028379 | Ga0268266_10101020 | Ga0268266_101010203 | 149 |
| 1013 | 3300028379 | Ga0268266_10244955 | Ga0268266_102449552 | 149 |
| 1014 | 3300028379 | Ga0268266_10445290 | Ga0268266_104452902 | 149 |
| 1015 | 3300028379 | Ga0268266_10900505 | Ga0268266_109005052 | 149 |
| 1016 | 3300028380 | Ga0268265_10175616 | Ga0268265_101756162 | 149 |
| 1017 | 3300028380 | Ga0268265_11453198 | Ga0268265_114531981 | 149 |
| 1018 | 3300028381 | Ga0268264_10070546 | Ga0268264_100705462 | 149 |
| 1019 | 3300028381 | Ga0268264_10096546 | Ga0268264_100965463 | 149 |
| 1020 | 3300028381 | Ga0268264_10288185 | Ga0268264_102881852 | 149 |
| 1021 | 3300028381 | Ga0268264_10340486 | Ga0268264_103404862 | 149 |
| 1022 | 3300028381 | Ga0268264_10937683 | Ga0268264_109376832 | 149 |
| 1023 | 3300028573 | Ga0265334_10219126 | Ga0265334_102191261 | 149 |
| 1024 | 3300028577 | Ga0265318_10114355 | Ga0265318_101143551 | 149 |
| 1025 | 3300028786 | Ga0307517_10315997 | Ga0307517_103159971 | 149 |
| 1026 | 3300028786 | Ga0307517_10337442 | Ga0307517_103374421 | 149 |
| 1027 | 3300028786 | Ga0307517_10425343 | Ga0307517_104253432 | 149 |
| 1028 | 3300028794 | Ga0307515_10264895 | Ga0307515_102648952 | 149 |
| 1029 | 3300030521 | Ga0307511_10279278 | Ga0307511_102792781 | 149 |
| 1030 | 3300031235 | Ga0265330_10018939 | Ga0265330_100189392 | 149 |
| 1031 | 3300031238 | Ga0265332_10025346 | Ga0265332_100253462 | 149 |
| 1032 | 3300031240 | Ga0265320_10141408 | Ga0265320_101414082 | 149 |
| 1033 | 3300031247 | Ga0265340_10045752 | Ga0265340_100457522 | 149 |
| 1034 | 3300031251 | Ga0265327_10041483 | Ga0265327_100414833 | 149 |
| 1035 | 3300031456 | Ga0307513_10107304 | Ga0307513_101073044 | 149 |
| 1036 | 3300031456 | Ga0307513_10108360 | Ga0307513_101083602 | 149 |
| 1037 | 3300031456 | Ga0307513_10841998 | Ga0307513_108419982 | 149 |
| 1038 | 3300031456 | Ga0307513_10999689 | Ga0307513_109996891 | 149 |
| 1039 | 3300031507 | Ga0307509_10466932 | Ga0307509_104669322 | 149 |
| 1040 | 3300031548 | Ga0307408_100474506 | Ga0307408_1004745061 | 149 |
| 1041 | 3300031548 | Ga0307408_100834826 | Ga0307408_1008348262 | 149 |
| 1042 | 3300031616 | Ga0307508_10218752 | Ga0307508_102187521 | 149 |
| 1043 | 3300031616 | Ga0307508_10463055 | Ga0307508_104630552 | 149 |
| 1044 | 3300031616 | Ga0307508_10779389 | Ga0307508_107793891 | 149 |
| 1045 | 3300031711 | Ga0265314_10002834 | Ga0265314_1000283417 | 149 |
| 1046 | 3300031711 | Ga0265314_10085887 | Ga0265314_100858873 | 149 |
| 1047 | 3300031712 | Ga0265342_10388722 | Ga0265342_103887222 | 149 |
| 1048 | 3300031730 | Ga0307516_10090518 | Ga0307516_100905182 | 149 |
| 1049 | 3300031824 | Ga0307413_10056827 | Ga0307413_100568272 | 149 |
| 1050 | 3300031824 | Ga0307413_10336378 | Ga0307413_103363782 | 149 |
| 1051 | 3300031852 | Ga0307410_10366741 | Ga0307410_103667412 | 149 |
| 1052 | 3300031852 | Ga0307410_10453456 | Ga0307410_104534561 | 149 |
| 1053 | 3300031903 | Ga0307407_10130185 | Ga0307407_101301851 | 149 |
| 1054 | 3300031903 | Ga0307407_11064949 | Ga0307407_110649491 | 149 |
| 1055 | 3300031911 | Ga0307412_11102560 | Ga0307412_111025601 | 149 |
| 1056 | 3300031995 | Ga0307409_100936430 | Ga0307409_1009364302 | 149 |
| 1057 | 3300032002 | Ga0307416_100377265 | Ga0307416_1003772652 | 149 |
| 1058 | 3300032002 | Ga0307416_101033131 | Ga0307416_1010331312 | 149 |
| 1059 | 3300032005 | Ga0307411_10122442 | Ga0307411_101224422 | 149 |
| 1060 | 3300032005 | Ga0307411_10404440 | Ga0307411_104044402 | 149 |
| 1061 | 3300033179 | Ga0307507_10400362 | Ga0307507_104003622 | 149 |
| 1062 | 3300033180 | Ga0307510_10027691 | Ga0307510_100276917 | 149 |
| 1063 | 3300033180 | Ga0307510_10050413 | Ga0307510_100504134 | 149 |
| 1064 | 3300033180 | Ga0307510_10071369 | Ga0307510_100713694 | 149 |
| 1065 | 3300033180 | Ga0307510_10166074 | Ga0307510_101660742 | 149 |
| 1066 | 3300033180 | Ga0307510_10552723 | Ga0307510_105527231 | 149 |
| 1067 | 3300033442 | Ga0315911_1000010 | Ga0315911_1000010271 | 149 |
| 1068 | 3300034817 | Ga0373948_0149087 | Ga0373948_0149087_110_559 | 149 |
| 1069 | 3300034817 | Ga0373948_0210465 | Ga0373948_0210465_23_472 | 149 |
| 1070 | 3300035083 | Ga0373926_0135979 | Ga0373926_0135979_44_493 | 149 |
| 1071 | 3300035086 | Ga0373934_0018297 | Ga0373934_0018297_1480_1932 | 149 |
| 1072 | 3300035089 | Ga0373944_0014723 | Ga0373944_0014723_38_487 | 149 |
| 1073 | 3300035111 | Ga0373923_0000955 | Ga0373923_0000955_1162_1614 | 149 |
| 1074 | 3300035111 | Ga0373923_0021274 | Ga0373923_0021274_23_472 | 149 |
| 1075 | 3300035113 | Ga0373936_0069611 | Ga0373936_0069611_653_1102 | 149 |
| 1076 | 3300035116 | Ga0373945_0106673 | Ga0373945_0106673_447_896 | 149 |
| 1077 | 3300035116 | Ga0373945_0369810 | Ga0373945_0369810_50_499 | 149 |
| 1078 | 3300035117 | Ga0373953_0000357 | Ga0373953_0000357_2951_3403 | 149 |
| 1079 | 3300035118 | Ga0373954_0000156 | Ga0373954_0000156_13909_14361 | 149 |
| 1080 | 3300035118 | Ga0373954_0019571 | Ga0373954_0019571_624_1073 | 149 |
| 1081 | 3300035119 | Ga0373956_0000252 | Ga0373956_0000252_5025_5477 | 149 |
| 1082 | 3300035120 | Ga0373957_0000344 | Ga0373957_0000344_5864_6316 | 149 |
| 1083 | 3300035170 | Ga0373943_0019168 | Ga0373943_0019168_325_774 | 149 |
| 1084 | 3300035171 | Ga0373946_0009713 | Ga0373946_0009713_1395_1844 | 149 |
| 1085 | 3300035171 | Ga0373946_0318842 | Ga0373946_0318842_142_591 | 149 |
| 1086 | 3300035172 | Ga0373955_0000229 | Ga0373955_0000229_15440_15892 | 149 |
| 1087 | 3300035172 | Ga0373955_0110994 | Ga0373955_0110994_251_700 | 149 |
| 1088 | 3300035410 | Ga0373924_0000488 | Ga0373924_0000488_6142_6594 | 149 |
| 1089 | 3300035410 | Ga0373924_0013574 | Ga0373924_0013574_2190_2639 | 149 |
| 1090 | 3300035691 | Ga0373931_0003537 | Ga0373931_0003537_5568_6017 | 149 |
| 1091 | 3300035691 | Ga0373931_1050708 | Ga0373931_1050708_49_498 | 149 |
| 1092 | 3300035692 | Ga0373935_0727666 | Ga0373935_0727666_196_645 | 149 |
| 1093 | 3300035692 | Ga0373935_0833672 | Ga0373935_0833672_216_665 | 149 |
| 1094 | 3300035695 | Ga0373927_0340136 | Ga0373927_0340136_520_969 | 149 |
| 1095 | 3300035695 | Ga0373927_0431051 | Ga0373927_0431051_100_549 | 149 |
| 1096 | 3300035724 | Ga0373933_0000628 | Ga0373933_0000628_14199_14651 | 149 |
| 1097 | 3300035724 | Ga0373933_0563627 | Ga0373933_0563627_165_614 | 149 |
| 1098 | 3300035725 | Ga0373947_0014655 | Ga0373947_0014655_1212_1661 | 149 |
| 1099 | 3300036401 | Ga0373937_0001337 | Ga0373937_0001337_2104_2556 | 149 |
| 1100 | 3300036401 | Ga0373937_0234160 | Ga0373937_0234160_879_1328 | 149 |
| 1101 | 3300036401 | Ga0373937_0266048 | Ga0373937_0266048_831_1280 | 149 |
| 1102 | 3300037068 | Ga0373925_0040808 | Ga0373925_0040808_1798_2247 | 149 |
| 1103 | 3300037068 | Ga0373925_0137551 | Ga0373925_0137551_149_598 | 149 |
| 1104 | 3300037068 | Ga0373925_0907524 | Ga0373925_0907524_127_576 | 149 |
| 1105 | 3300037068 | Ga0373925_0938093 | Ga0373925_0938093_72_521 | 149 |
| 1106 | 3300037312 | Ga0395899_0109507 | Ga0395899_0109507_1162_1611 | 149 |
| 1107 | 3300037312 | Ga0395899_0315229 | Ga0395899_0315229_464_913 | 149 |
| 1108 | 3300037418 | Ga0395900_0033149 | Ga0395900_0033149_2437_2886 | 149 |
| 1109 | 3300037418 | Ga0395900_0360038 | Ga0395900_0360038_774_1223 | 149 |
| 1110 | 3300037466 | Ga0395898_0003786 | Ga0395898_0003786_304_753 | 149 |
| 1111 | 3300037466 | Ga0395898_0015935 | Ga0395898_0015935_6273_6722 | 149 |
| 1112 | 3300037466 | Ga0395898_0134436 | Ga0395898_0134436_273_722 | 149 |
| 1113 | 3300037471 | Ga0395905_0048221 | Ga0395905_0048221_1376_1825 | 149 |
| 1114 | 3300037471 | Ga0395905_0363338 | Ga0395905_0363338_359_808 | 149 |
| 1115 | 3300038443 | Ga0395901_0059357 | Ga0395901_0059357_1033_1482 | 149 |
| 1116 | 3300038443 | Ga0395901_0233871 | Ga0395901_0233871_1022_1471 | 149 |
| 1117 | 3300038443 | Ga0395901_0553309 | Ga0395901_0553309_117_566 | 149 |
| 1118 | 3300039437 | Ga0436365_0350765 | Ga0436365_0350765_290_739 | 149 |
| 1119 | 3300039437 | Ga0436365_0488039 | Ga0436365_0488039_58_507 | 149 |
| 1120 | 3300039437 | Ga0436365_0714504 | Ga0436365_0714504_191_640 | 149 |
| 1121 | 3300039437 | Ga0436365_1475101 | Ga0436365_1475101_608_1057 | 149 |
| 1122 | 3300039437 | Ga0436365_1782951 | Ga0436365_1782951_804_1253 | 149 |
| 1123 | 3300039438 | Ga0436360_0553077 | Ga0436360_0553077_669_1121 | 149 |
| 1124 | 3300039450 | Ga0436363_0227726 | Ga0436363_0227726_138_587 | 149 |
| 1125 | 3300041413 | Ga0439465_0148926 | Ga0439465_0148926_158_607 | 149 |
| 1126 | 3300041451 | Ga0451791_0856061 | Ga0451791_0856061_95_544 | 149 |
| 1127 | 3300041456 | Ga0451795_0835100 | Ga0451795_0835100_43_492 | 149 |
| 1128 | 3300041458 | Ga0451798_0527849 | Ga0451798_0527849_75_524 | 149 |
| 1129 | 3300041459 | Ga0451800_1247451 | Ga0451800_1247451_145_594 | 149 |
| 1130 | 3300041486 | Ga0451807_0027761 | Ga0451807_0027761_105_554 | 149 |
| 1131 | 3300041491 | Ga0451833_0052533 | Ga0451833_0052533_71_520 | 149 |
| 1132 | 3300041491 | Ga0451833_1385877 | Ga0451833_1385877_414_863 | 149 |
| 1133 | 3300041492 | Ga0451835_0439563 | Ga0451835_0439563_133_582 | 149 |
| 1134 | 3300041503 | Ga0451847_0468734 | Ga0451847_0468734_328_777 | 149 |
| 1135 | 3300041505 | Ga0451849_0164067 | Ga0451849_0164067_37_486 | 149 |
| 1136 | 3300041511 | Ga0451855_1457165 | Ga0451855_1457165_25_474 | 149 |
| 1137 | 3300041512 | Ga0451853_3206365 | Ga0451853_3206365_221_670 | 149 |
| 1138 | 3300041997 | Ga0439431_0121816 | Ga0439431_0121816_187_636 | 149 |
| 1139 | 3300042005 | Ga0439448_0287128 | Ga0439448_0287128_35_484 | 149 |
| 1140 | 3300042012 | Ga0439455_0133576 | Ga0439455_0133576_66_515 | 149 |
| 1141 | 3300042157 | Ga0439458_0058281 | Ga0439458_0058281_286_735 | 149 |
| 1142 | 3300042439 | Ga0439464_0143287 | Ga0439464_0143287_256_720 | 149 |
| 1143 | 3300044656 | Ga0466969_0049764 | Ga0466969_0049764_384_833 | 149 |
| 1144 | 3300044658 | Ga0466972_0000998 | Ga0466972_0000998_12192_12641 | 149 |
| 1145 | 3300044683 | Ga0466965_0071991 | Ga0466965_0071991_402_851 | 149 |
| 1146 | 3300044684 | Ga0466966_0000551 | Ga0466966_0000551_19757_20206 | 149 |
| 1147 | 3300044693 | Ga0466961_0000020 | Ga0466961_0000020_53320_53769 | 149 |
| 1148 | 3300044693 | Ga0466961_0201182 | Ga0466961_0201182_617_1066 | 149 |
| 1149 | 3300044694 | Ga0466963_0127317 | Ga0466963_0127317_825_1274 | 149 |
| 1150 | 3300044706 | Ga0466964_0022484 | Ga0466964_0022484_1927_2376 | 149 |
| 1151 | 3300044706 | Ga0466964_0045822 | Ga0466964_0045822_850_1299 | 149 |
| 1152 | 3300044735 | Ga0466968_0018330 | Ga0466968_0018330_512_961 | 149 |
| 1153 | 3300044901 | Ga0466960_0018738 | Ga0466960_0018738_404_853 | 149 |
| 1154 | 3300044901 | Ga0466960_0035273 | Ga0466960_0035273_744_1193 | 149 |
| 1155 | 3300044901 | Ga0466960_0157633 | Ga0466960_0157633_327_776 | 149 |
| 1156 | 3300044901 | Ga0466960_0222530 | Ga0466960_0222530_412_861 | 149 |
| 1157 | 3300045049 | Ga0466959_0135055 | Ga0466959_0135055_1216_1665 | 149 |
| 1158 | 3300045836 | Ga0466958_0047710 | Ga0466958_0047710_1695_2144 | 149 |
| 1159 | 3300045976 | Ga0466967_0049530 | Ga0466967_0049530_3182_3631 | 149 |
| 1160 | 3300045976 | Ga0466967_0384955 | Ga0466967_0384955_886_1335 | 149 |
| 1161 | 3300045976 | Ga0466967_0863173 | Ga0466967_0863173_234_683 | 149 |
| 1162 | 3300046452 | Ga0495617_027271 | Ga0495617_027271_430_879 | 149 |
| 1163 | 3300046454 | Ga0495592_0003818 | Ga0495592_0003818_5348_5800 | 149 |
| 1164 | 3300046454 | Ga0495592_0026973 | Ga0495592_0026973_312_761 | 149 |
| 1165 | 3300046454 | Ga0495592_0078412 | Ga0495592_0078412_209_658 | 149 |
| 1166 | 3300046454 | Ga0495592_0777290 | Ga0495592_0777290_44_493 | 149 |
| 1167 | 3300046455 | Ga0495603_0007836 | Ga0495603_0007836_1322_1771 | 149 |
| 1168 | 3300046455 | Ga0495603_0088424 | Ga0495603_0088424_346_795 | 149 |
| 1169 | 3300046455 | Ga0495603_0353566 | Ga0495603_0353566_152_601 | 149 |
| 1170 | 3300046455 | Ga0495603_0539916 | Ga0495603_0539916_44_493 | 149 |
| 1171 | 3300046457 | Ga0495590_0098438 | Ga0495590_0098438_204_653 | 149 |
| 1172 | 3300046457 | Ga0495590_0108269 | Ga0495590_0108269_343_792 | 149 |
| 1173 | 3300046459 | Ga0495629_0001098 | Ga0495629_0001098_14273_14725 | 149 |
| 1174 | 3300046459 | Ga0495629_0002258 | Ga0495629_0002258_11764_12213 | 149 |
| 1175 | 3300046459 | Ga0495629_0526638 | Ga0495629_0526638_185_634 | 149 |
| 1176 | 3300046459 | Ga0495629_0952121 | Ga0495629_0952121_17_466 | 149 |
| 1177 | 3300046460 | Ga0495638_0004483 | Ga0495638_0004483_4647_5096 | 149 |
| 1178 | 3300046460 | Ga0495638_0037446 | Ga0495638_0037446_297_746 | 149 |
| 1179 | 3300046460 | Ga0495638_0110489 | Ga0495638_0110489_820_1281 | 149 |
| 1180 | 3300046460 | Ga0495638_0220113 | Ga0495638_0220113_487_948 | 149 |
| 1181 | 3300046460 | Ga0495638_0221466 | Ga0495638_0221466_246_695 | 149 |
| 1182 | 3300046460 | Ga0495638_0322130 | Ga0495638_0322130_290_748 | 149 |
| 1183 | 3300046460 | Ga0495638_0448805 | Ga0495638_0448805_188_637 | 149 |
| 1184 | 3300046461 | Ga0495641_0289181 | Ga0495641_0289181_239_688 | 149 |
| 1185 | 3300046461 | Ga0495641_0577651 | Ga0495641_0577651_41_490 | 149 |
| 1186 | 3300046462 | Ga0495651_0002766 | Ga0495651_0002766_10143_10595 | 149 |
| 1187 | 3300046462 | Ga0495651_0026823 | Ga0495651_0026823_1264_1713 | 149 |
| 1188 | 3300046462 | Ga0495651_0144905 | Ga0495651_0144905_814_1263 | 149 |
| 1189 | 3300046463 | Ga0495653_0000562 | Ga0495653_0000562_6746_7198 | 149 |
| 1190 | 3300046463 | Ga0495653_0710019 | Ga0495653_0710019_76_525 | 149 |
| 1191 | 3300046463 | Ga0495653_0758354 | Ga0495653_0758354_41_490 | 149 |
| 1192 | 3300046471 | Ga0495650_0078899 | Ga0495650_0078899_590_1039 | 149 |
| 1193 | 3300046471 | Ga0495650_0163114 | Ga0495650_0163114_259_708 | 149 |
| 1194 | 3300046471 | Ga0495650_0329557 | Ga0495650_0329557_19_468 | 149 |
| 1195 | 3300046472 | Ga0495580_0059649 | Ga0495580_0059649_2190_2639 | 149 |
| 1196 | 3300046473 | Ga0495582_0031742 | Ga0495582_0031742_1742_2191 | 149 |
| 1197 | 3300046473 | Ga0495582_0124821 | Ga0495582_0124821_565_1014 | 149 |
| 1198 | 3300046473 | Ga0495582_0606980 | Ga0495582_0606980_21_470 | 149 |
| 1199 | 3300046474 | Ga0495605_0107267 | Ga0495605_0107267_464_913 | 149 |
| 1200 | 3300046474 | Ga0495605_0124937 | Ga0495605_0124937_431_901 | 149 |
| 1201 | 3300046474 | Ga0495605_0296553 | Ga0495605_0296553_189_638 | 149 |
| 1202 | 3300046475 | Ga0495639_0005522 | Ga0495639_0005522_2069_2518 | 149 |
| 1203 | 3300046475 | Ga0495639_0287282 | Ga0495639_0287282_72_521 | 149 |
| 1204 | 3300046476 | Ga0495662_0351016 | Ga0495662_0351016_26_475 | 149 |
| 1205 | 3300046477 | Ga0495664_0045364 | Ga0495664_0045364_1047_1496 | 149 |
| 1206 | 3300046477 | Ga0495664_0064925 | Ga0495664_0064925_325_774 | 149 |
| 1207 | 3300046477 | Ga0495664_0346055 | Ga0495664_0346055_267_716 | 149 |
| 1208 | 3300046477 | Ga0495664_0473968 | Ga0495664_0473968_40_489 | 149 |
| 1209 | 3300046491 | Ga0495584_0095822 | Ga0495584_0095822_319_768 | 149 |
| 1210 | 3300046491 | Ga0495584_0108738 | Ga0495584_0108738_416_865 | 149 |
| 1211 | 3300046491 | Ga0495584_0600267 | Ga0495584_0600267_95_544 | 149 |
| 1212 | 3300046492 | Ga0495585_0012463 | Ga0495585_0012463_4394_4843 | 149 |
| 1213 | 3300046492 | Ga0495585_0030579 | Ga0495585_0030579_1988_2437 | 149 |
| 1214 | 3300046492 | Ga0495585_0100946 | Ga0495585_0100946_522_971 | 149 |
| 1215 | 3300046499 | Ga0495594_0150020 | Ga0495594_0150020_807_1256 | 149 |
| 1216 | 3300046499 | Ga0495594_0288174 | Ga0495594_0288174_392_925 | 149 |
| 1217 | 3300046501 | Ga0495607_0157633 | Ga0495607_0157633_227_676 | 149 |
| 1218 | 3300046501 | Ga0495607_0169951 | Ga0495607_0169951_173_622 | 149 |
| 1219 | 3300046501 | Ga0495607_0340206 | Ga0495607_0340206_196_645 | 149 |
| 1220 | 3300046506 | Ga0495583_0095646 | Ga0495583_0095646_318_767 | 149 |
| 1221 | 3300046506 | Ga0495583_0117913 | Ga0495583_0117913_153_614 | 149 |
| 1222 | 3300046506 | Ga0495583_0249626 | Ga0495583_0249626_174_623 | 149 |
| 1223 | 3300046506 | Ga0495583_0259105 | Ga0495583_0259105_213_662 | 149 |
| 1224 | 3300046507 | Ga0495606_0023943 | Ga0495606_0023943_2269_2718 | 149 |
| 1225 | 3300046507 | Ga0495606_0047831 | Ga0495606_0047831_300_749 | 149 |
| 1226 | 3300046507 | Ga0495606_0100654 | Ga0495606_0100654_710_1159 | 149 |
| 1227 | 3300046507 | Ga0495606_0166745 | Ga0495606_0166745_85_534 | 149 |
| 1228 | 3300046507 | Ga0495606_0357107 | Ga0495606_0357107_102_563 | 149 |
| 1229 | 3300046511 | Ga0495608_0005591 | Ga0495608_0005591_3014_3466 | 149 |
| 1230 | 3300046511 | Ga0495608_0098774 | Ga0495608_0098774_875_1324 | 149 |
| 1231 | 3300046511 | Ga0495608_0132774 | Ga0495608_0132774_681_1130 | 149 |
| 1232 | 3300046511 | Ga0495608_0162907 | Ga0495608_0162907_366_815 | 149 |
| 1233 | 3300046512 | Ga0495610_0035063 | Ga0495610_0035063_223_672 | 149 |
| 1234 | 3300046512 | Ga0495610_0067501 | Ga0495610_0067501_831_1280 | 149 |
| 1235 | 3300046512 | Ga0495610_0219535 | Ga0495610_0219535_266_727 | 149 |
| 1236 | 3300046513 | Ga0495616_0219405 | Ga0495616_0219405_266_727 | 149 |
| 1237 | 3300046513 | Ga0495616_0254434 | Ga0495616_0254434_215_664 | 149 |
| 1238 | 3300046513 | Ga0495616_0416327 | Ga0495616_0416327_83_532 | 149 |
| 1239 | 3300046513 | Ga0495616_0423651 | Ga0495616_0423651_30_479 | 149 |
| 1240 | 3300046514 | Ga0495618_0008913 | Ga0495618_0008913_4621_5073 | 149 |
| 1241 | 3300046514 | Ga0495618_0024236 | Ga0495618_0024236_2613_3062 | 149 |
| 1242 | 3300046514 | Ga0495618_0647008 | Ga0495618_0647008_158_607 | 149 |
| 1243 | 3300046515 | Ga0495620_0085144 | Ga0495620_0085144_809_1258 | 149 |
| 1244 | 3300046515 | Ga0495620_0143201 | Ga0495620_0143201_322_771 | 149 |
| 1245 | 3300046515 | Ga0495620_0234790 | Ga0495620_0234790_30_479 | 149 |
| 1246 | 3300046516 | Ga0495628_0011937 | Ga0495628_0011937_3444_3896 | 149 |
| 1247 | 3300046516 | Ga0495628_0063195 | Ga0495628_0063195_1688_2137 | 149 |
| 1248 | 3300046516 | Ga0495628_0202189 | Ga0495628_0202189_129_578 | 149 |
| 1249 | 3300046517 | Ga0495630_0007480 | Ga0495630_0007480_4549_4998 | 149 |
| 1250 | 3300046517 | Ga0495630_0272757 | Ga0495630_0272757_390_839 | 149 |
| 1251 | 3300046518 | Ga0495631_0287003 | Ga0495631_0287003_62_523 | 149 |
| 1252 | 3300046519 | Ga0495632_0044408 | Ga0495632_0044408_598_1047 | 149 |
| 1253 | 3300046519 | Ga0495632_0112610 | Ga0495632_0112610_387_836 | 149 |
| 1254 | 3300046519 | Ga0495632_0268345 | Ga0495632_0268345_145_594 | 149 |
| 1255 | 3300046519 | Ga0495632_0402733 | Ga0495632_0402733_26_475 | 149 |
| 1256 | 3300046522 | Ga0495643_0183760 | Ga0495643_0183760_360_809 | 149 |
| 1257 | 3300046522 | Ga0495643_0196523 | Ga0495643_0196523_69_518 | 149 |
| 1258 | 3300046523 | Ga0495644_0090747 | Ga0495644_0090747_274_723 | 149 |
| 1259 | 3300046523 | Ga0495644_0150411 | Ga0495644_0150411_221_670 | 149 |
| 1260 | 3300046523 | Ga0495644_0325423 | Ga0495644_0325423_106_555 | 149 |
| 1261 | 3300046524 | Ga0495648_0001038 | Ga0495648_0001038_13348_13797 | 149 |
| 1262 | 3300046524 | Ga0495648_0051219 | Ga0495648_0051219_952_1401 | 149 |
| 1263 | 3300046524 | Ga0495648_0057693 | Ga0495648_0057693_1589_2038 | 149 |
| 1264 | 3300046524 | Ga0495648_0151294 | Ga0495648_0151294_238_687 | 149 |
| 1265 | 3300046524 | Ga0495648_0241622 | Ga0495648_0241622_169_618 | 149 |
| 1266 | 3300046524 | Ga0495648_0325792 | Ga0495648_0325792_62_511 | 149 |
| 1267 | 3300046526 | Ga0495666_0100113 | Ga0495666_0100113_877_1326 | 149 |
| 1268 | 3300046529 | Ga0495652_0008672 | Ga0495652_0008672_1916_2365 | 149 |
| 1269 | 3300046529 | Ga0495652_0026299 | Ga0495652_0026299_4608_5057 | 149 |
| 1270 | 3300046529 | Ga0495652_0032344 | Ga0495652_0032344_1110_1562 | 149 |
| 1271 | 3300046529 | Ga0495652_0147759 | Ga0495652_0147759_1378_1827 | 149 |
| 1272 | 3300046530 | Ga0495654_0127169 | Ga0495654_0127169_419_880 | 149 |
| 1273 | 3300046530 | Ga0495654_0132792 | Ga0495654_0132792_243_692 | 149 |
| 1274 | 3300046530 | Ga0495654_0341496 | Ga0495654_0341496_61_510 | 149 |
| 1275 | 3300046531 | Ga0495665_0097042 | Ga0495665_0097042_136_585 | 149 |
| 1276 | 3300046531 | Ga0495665_0100779 | Ga0495665_0100779_403_852 | 149 |
| 1277 | 3300046533 | Ga0495640_0013143 | Ga0495640_0013143_4595_5047 | 149 |
| 1278 | 3300046533 | Ga0495640_0026031 | Ga0495640_0026031_2821_3270 | 149 |
| 1279 | 3300046533 | Ga0495640_0029945 | Ga0495640_0029945_3187_3636 | 149 |
| 1280 | 3300046535 | Ga0495586_0428462 | Ga0495586_0428462_204_653 | 149 |
| 1281 | 3300046535 | Ga0495586_0880338 | Ga0495586_0880338_49_498 | 149 |
| 1282 | 3300046536 | Ga0495587_0003932 | Ga0495587_0003932_6399_6851 | 149 |
| 1283 | 3300046536 | Ga0495587_0725404 | Ga0495587_0725404_34_483 | 149 |
| 1284 | 3300046537 | Ga0495598_0020638 | Ga0495598_0020638_550_1074 | 149 |
| 1285 | 3300046537 | Ga0495598_0051329 | Ga0495598_0051329_159_608 | 149 |
| 1286 | 3300046537 | Ga0495598_0088094 | Ga0495598_0088094_65_514 | 149 |
| 1287 | 3300046538 | Ga0495609_0096278 | Ga0495609_0096278_586_1035 | 149 |
| 1288 | 3300046538 | Ga0495609_0213858 | Ga0495609_0213858_84_533 | 149 |
| 1289 | 3300046538 | Ga0495609_0273470 | Ga0495609_0273470_52_501 | 149 |
| 1290 | 3300046538 | Ga0495609_0304751 | Ga0495609_0304751_23_472 | 149 |
| 1291 | 3300046539 | Ga0495621_0013157 | Ga0495621_0013157_85_534 | 149 |
| 1292 | 3300046539 | Ga0495621_0033997 | Ga0495621_0033997_627_1076 | 149 |
| 1293 | 3300046539 | Ga0495621_0527581 | Ga0495621_0527581_12_461 | 149 |
| 1294 | 3300046542 | Ga0495597_0013096 | Ga0495597_0013096_3175_3624 | 149 |
| 1295 | 3300046542 | Ga0495597_0194201 | Ga0495597_0194201_40_489 | 149 |
| 1296 | 3300046543 | Ga0495645_0086399 | Ga0495645_0086399_1237_1689 | 149 |
| 1297 | 3300046543 | Ga0495645_0130007 | Ga0495645_0130007_1022_1471 | 149 |
| 1298 | 3300046543 | Ga0495645_0241215 | Ga0495645_0241215_551_1000 | 149 |
| 1299 | 3300046557 | Ga0495622_0001657 | Ga0495622_0001657_2038_2487 | 149 |
| 1300 | 3300046557 | Ga0495622_0035703 | Ga0495622_0035703_1482_1931 | 149 |
| 1301 | 3300046557 | Ga0495622_0078296 | Ga0495622_0078296_561_1022 | 149 |
| 1302 | 3300046557 | Ga0495622_0329488 | Ga0495622_0329488_124_573 | 149 |
| 1303 | 3300046557 | Ga0495622_0422520 | Ga0495622_0422520_47_496 | 149 |
| 1304 | 3300046558 | Ga0495633_0163362 | Ga0495633_0163362_410_859 | 149 |
| 1305 | 3300046558 | Ga0495633_0349937 | Ga0495633_0349937_141_590 | 149 |
| 1306 | 3300046559 | Ga0495667_0001588 | Ga0495667_0001588_7520_7972 | 149 |
| 1307 | 3300046559 | Ga0495667_0029808 | Ga0495667_0029808_2711_3160 | 149 |
| 1308 | 3300046559 | Ga0495667_0034368 | Ga0495667_0034368_2784_3233 | 149 |
| 1309 | 3300046559 | Ga0495667_0398470 | Ga0495667_0398470_165_614 | 149 |
| 1310 | 3300046615 | Ga0495656_0011088 | Ga0495656_0011088_442_891 | 149 |
| 1311 | 3300046615 | Ga0495656_0069986 | Ga0495656_0069986_941_1465 | 149 |
| 1312 | 3300046615 | Ga0495656_0120824 | Ga0495656_0120824_132_581 | 149 |
| 1313 | 3300046615 | Ga0495656_0149617 | Ga0495656_0149617_216_665 | 149 |
| 1314 | 3300046615 | Ga0495656_0278044 | Ga0495656_0278044_331_780 | 149 |
| 1315 | 3300046616 | Ga0495668_0090246 | Ga0495668_0090246_486_944 | 149 |
| 1316 | 3300046616 | Ga0495668_0111608 | Ga0495668_0111608_799_1248 | 149 |
| 1317 | 3300046616 | Ga0495668_0276874 | Ga0495668_0276874_125_574 | 149 |
| 1318 | 3300046616 | Ga0495668_0441184 | Ga0495668_0441184_166_615 | 149 |
| 1319 | 3300046616 | Ga0495668_0509948 | Ga0495668_0509948_142_591 | 149 |
| 1320 | 3300046642 | Ga0495634_0002373 | Ga0495634_0002373_1128_1580 | 149 |
| 1321 | 3300046642 | Ga0495634_0006397 | Ga0495634_0006397_5739_6188 | 149 |
| 1322 | 3300046642 | Ga0495634_0883147 | Ga0495634_0883147_19_468 | 149 |
| 1323 | 3300046648 | Ga0495611_0087276 | Ga0495611_0087276_531_980 | 149 |
| 1324 | 3300046648 | Ga0495611_0163188 | Ga0495611_0163188_242_691 | 149 |
| 1325 | 3300046648 | Ga0495611_0170791 | Ga0495611_0170791_350_799 | 149 |
| 1326 | 3300046648 | Ga0495611_0200653 | Ga0495611_0200653_401_862 | 149 |
| 1327 | 3300046648 | Ga0495611_0335740 | Ga0495611_0335740_138_587 | 149 |
| 1328 | 3300046648 | Ga0495611_0350887 | Ga0495611_0350887_190_639 | 149 |
| 1329 | 3300046660 | Ga0495625_0035691 | Ga0495625_0035691_379_828 | 149 |
| 1330 | 3300046660 | Ga0495625_0086733 | Ga0495625_0086733_146_595 | 149 |
| 1331 | 3300046660 | Ga0495625_0149756 | Ga0495625_0149756_151_612 | 149 |
| 1332 | 3300046660 | Ga0495625_0231837 | Ga0495625_0231837_387_836 | 149 |
| 1333 | 3300046660 | Ga0495625_0363792 | Ga0495625_0363792_394_843 | 149 |
| 1334 | 3300046660 | Ga0495625_0415194 | Ga0495625_0415194_194_643 | 149 |
| 1335 | 3300046663 | Ga0495635_0000346 | Ga0495635_0000346_4898_5350 | 149 |
| 1336 | 3300046663 | Ga0495635_0001380 | Ga0495635_0001380_10171_10620 | 149 |
| 1337 | 3300046663 | Ga0495635_0119709 | Ga0495635_0119709_184_633 | 149 |
| 1338 | 3300046663 | Ga0495635_0269841 | Ga0495635_0269841_390_839 | 149 |
| 1339 | 3300046664 | Ga0495659_0024844 | Ga0495659_0024844_564_1013 | 149 |
| 1340 | 3300046664 | Ga0495659_0092874 | Ga0495659_0092874_564_1013 | 149 |
| 1341 | 3300046665 | Ga0495661_0189773 | Ga0495661_0189773_127_576 | 149 |
| 1342 | 3300046665 | Ga0495661_0211192 | Ga0495661_0211192_487_948 | 149 |
| 1343 | 3300046665 | Ga0495661_0287916 | Ga0495661_0287916_53_502 | 149 |
| 1344 | 3300046665 | Ga0495661_0294470 | Ga0495661_0294470_13_462 | 149 |
| 1345 | 3300046665 | Ga0495661_0386476 | Ga0495661_0386476_176_625 | 149 |
| 1346 | 3300046674 | Ga0495588_0007097 | Ga0495588_0007097_2446_2895 | 149 |
| 1347 | 3300046674 | Ga0495588_0199828 | Ga0495588_0199828_542_991 | 149 |
| 1348 | 3300046674 | Ga0495588_0559621 | Ga0495588_0559621_27_560 | 149 |
| 1349 | 3300046674 | Ga0495588_0658749 | Ga0495588_0658749_47_508 | 149 |
| 1350 | 3300046675 | Ga0495657_0010298 | Ga0495657_0010298_3014_3466 | 149 |
| 1351 | 3300046675 | Ga0495657_0011353 | Ga0495657_0011353_1595_2044 | 149 |
| 1352 | 3300046675 | Ga0495657_0034813 | Ga0495657_0034813_27_476 | 149 |
| 1353 | 3300046675 | Ga0495657_0337918 | Ga0495657_0337918_182_631 | 149 |
| 1354 | 3300046678 | Ga0495599_0000522 | Ga0495599_0000522_6409_6861 | 149 |
| 1355 | 3300046678 | Ga0495599_0046395 | Ga0495599_0046395_785_1234 | 149 |
| 1356 | 3300046678 | Ga0495599_0092868 | Ga0495599_0092868_1096_1545 | 149 |
| 1357 | 3300046678 | Ga0495599_0139647 | Ga0495599_0139647_87_536 | 149 |
| 1358 | 3300046679 | Ga0495623_0005412 | Ga0495623_0005412_2088_2540 | 149 |
| 1359 | 3300046679 | Ga0495623_0091055 | Ga0495623_0091055_765_1214 | 149 |
| 1360 | 3300046680 | Ga0495646_0000537 | Ga0495646_0000537_7478_7930 | 149 |
| 1361 | 3300046681 | Ga0495647_0051142 | Ga0495647_0051142_155_604 | 149 |
| 1362 | 3300046683 | Ga0495658_0017128 | Ga0495658_0017128_3106_3555 | 149 |
| 1363 | 3300046684 | Ga0495669_0003415 | Ga0495669_0003415_2410_2859 | 149 |
| 1364 | 3300046684 | Ga0495669_0048084 | Ga0495669_0048084_576_1025 | 149 |
| 1365 | 3300046684 | Ga0495669_0263510 | Ga0495669_0263510_83_532 | 149 |
| 1366 | 3300046684 | Ga0495669_0453859 | Ga0495669_0453859_71_520 | 149 |
| 1367 | 3300046689 | Ga0495613_0027437 | Ga0495613_0027437_1101_1550 | 149 |
| 1368 | 3300046689 | Ga0495613_0047407 | Ga0495613_0047407_2423_2875 | 149 |
| 1369 | 3300046689 | Ga0495613_0256867 | Ga0495613_0256867_146_595 | 149 |
| 1370 | 3300046690 | Ga0495624_0004020 | Ga0495624_0004020_244_693 | 149 |
| 1371 | 3300046690 | Ga0495624_0108267 | Ga0495624_0108267_259_708 | 149 |
| 1372 | 3300046690 | Ga0495624_0198871 | Ga0495624_0198871_753_1202 | 149 |
| 1373 | 3300046690 | Ga0495624_0234435 | Ga0495624_0234435_152_601 | 149 |
| 1374 | 3300046690 | Ga0495624_0393044 | Ga0495624_0393044_246_695 | 149 |
| 1375 | 3300046691 | Ga0495670_0000757 | Ga0495670_0000757_7910_8371 | 149 |
| 1376 | 3300046691 | Ga0495670_0026769 | Ga0495670_0026769_2233_2682 | 149 |
| 1377 | 3300046692 | Ga0495671_0117840 | Ga0495671_0117840_323_772 | 149 |
| 1378 | 3300046692 | Ga0495671_0127622 | Ga0495671_0127622_731_1180 | 149 |
| 1379 | 3300046692 | Ga0495671_0222292 | Ga0495671_0222292_364_813 | 149 |
| 1380 | 3300046692 | Ga0495671_0249479 | Ga0495671_0249479_211_744 | 149 |
| 1381 | 3300046692 | Ga0495671_0440731 | Ga0495671_0440731_140_589 | 149 |
| 1382 | 3300046694 | Ga0495649_0022922 | Ga0495649_0022922_1658_2107 | 149 |
| 1383 | 3300046694 | Ga0495649_0213505 | Ga0495649_0213505_216_665 | 149 |
| 1384 | 3300046694 | Ga0495649_0375921 | Ga0495649_0375921_146_595 | 149 |
| 1385 | 3300046694 | Ga0495649_0390316 | Ga0495649_0390316_49_498 | 149 |
| 1386 | 3300046694 | Ga0495649_0521523 | Ga0495649_0521523_64_513 | 149 |
| 1387 | 3300046794 | Ga0495589_0101402 | Ga0495589_0101402_650_1099 | 149 |
| 1388 | 3300046794 | Ga0495589_0235451 | Ga0495589_0235451_173_622 | 149 |
| 1389 | 3300046794 | Ga0495589_0333251 | Ga0495589_0333251_123_572 | 149 |
| 1390 | 3300046809 | Ga0495600_0000398 | Ga0495600_0000398_933_1385 | 149 |
| 1391 | 3300046809 | Ga0495600_0008503 | Ga0495600_0008503_5513_5962 | 149 |
| 1392 | 3300046809 | Ga0495600_0024296 | Ga0495600_0024296_2993_3442 | 149 |
| 1393 | 3300046809 | Ga0495600_0147695 | Ga0495600_0147695_110_559 | 149 |
| 1394 | 3300046809 | Ga0495600_0219559 | Ga0495600_0219559_106_555 | 149 |
| 1395 | 3300046809 | Ga0495600_0320235 | Ga0495600_0320235_213_662 | 149 |
| 1396 | 3300046809 | Ga0495600_0417361 | Ga0495600_0417361_335_784 | 149 |
| 1397 | 3300047315 | Ga0495581_0051626 | Ga0495581_0051626_44_493 | 149 |
| 1398 | 3300047315 | Ga0495581_0187432 | Ga0495581_0187432_380_829 | 149 |
| 1399 | 3300047317 | Ga0495604_0004007 | Ga0495604_0004007_7688_8140 | 149 |
| 1400 | 3300047317 | Ga0495604_0005171 | Ga0495604_0005171_6912_7361 | 149 |
| 1401 | 3300047317 | Ga0495604_0007540 | Ga0495604_0007540_6914_7363 | 149 |
| 1402 | 3300047317 | Ga0495604_0034557 | Ga0495604_0034557_1970_2419 | 149 |
| 1403 | 3300047317 | Ga0495604_0443734 | Ga0495604_0443734_242_691 | 149 |
| 1404 | 3300047318 | Ga0495636_0011599 | Ga0495636_0011599_77_526 | 149 |
| 1405 | 3300047318 | Ga0495636_0467951 | Ga0495636_0467951_75_524 | 149 |
| 1406 | 3300047319 | Ga0495674_0004134 | Ga0495674_0004134_7081_7533 | 149 |
| 1407 | 3300047319 | Ga0495674_0006731 | Ga0495674_0006731_6571_7020 | 149 |
| 1408 | 3300047319 | Ga0495674_0076952 | Ga0495674_0076952_238_687 | 149 |
| 1409 | 3300047320 | Ga0495672_0165212 | Ga0495672_0165212_584_1033 | 149 |
| 1410 | 3300047320 | Ga0495672_0333381 | Ga0495672_0333381_219_668 | 149 |
| 1411 | 3300047321 | Ga0495676_0025537 | Ga0495676_0025537_4273_4722 | 149 |
| 1412 | 3300047321 | Ga0495676_0034955 | Ga0495676_0034955_2097_2546 | 149 |
| 1413 | 3300047321 | Ga0495676_0117815 | Ga0495676_0117815_604_1053 | 149 |
| 1414 | 3300047322 | Ga0495680_0002197 | Ga0495680_0002197_9839_10291 | 149 |
| 1415 | 3300047322 | Ga0495680_0006139 | Ga0495680_0006139_6939_7388 | 149 |
| 1416 | 3300047322 | Ga0495680_0770156 | Ga0495680_0770156_155_604 | 149 |
| 1417 | 3300047323 | Ga0495683_0167698 | Ga0495683_0167698_315_764 | 149 |
| 1418 | 3300047443 | Ga0495687_075687 | Ga0495687_075687_61_510 | 149 |
| 1419 | 3300047444 | Ga0495675_0001020 | Ga0495675_0001020_9018_9470 | 149 |
| 1420 | 3300047444 | Ga0495675_0087204 | Ga0495675_0087204_1087_1536 | 149 |
| 1421 | 3300047445 | Ga0495677_0128474 | Ga0495677_0128474_262_711 | 149 |
| 1422 | 3300047469 | Ga0495673_0083555 | Ga0495673_0083555_624_1073 | 149 |
| 1423 | 3300047469 | Ga0495673_0092356 | Ga0495673_0092356_497_946 | 149 |
| 1424 | 3300047469 | Ga0495673_0140598 | Ga0495673_0140598_29_478 | 149 |
| 1425 | 3300047469 | Ga0495673_0173904 | Ga0495673_0173904_56_505 | 149 |
| 1426 | 3300047469 | Ga0495673_0217501 | Ga0495673_0217501_245_694 | 149 |
| 1427 | 3300047470 | Ga0495681_0318410 | Ga0495681_0318410_63_524 | 149 |
| 1428 | 3300047471 | Ga0495684_0001669 | Ga0495684_0001669_9839_10291 | 149 |
| 1429 | 3300047471 | Ga0495684_0004704 | Ga0495684_0004704_5558_6007 | 149 |
| 1430 | 3300047471 | Ga0495684_0024356 | Ga0495684_0024356_3297_3746 | 149 |
| 1431 | 3300047472 | Ga0495686_0055110 | Ga0495686_0055110_58_519 | 149 |
| 1432 | 3300047472 | Ga0495686_0310311 | Ga0495686_0310311_304_753 | 149 |
| 1433 | 3300047673 | Ga0495593_0000190 | Ga0495593_0000190_6647_7099 | 149 |
| 1434 | 3300047673 | Ga0495593_0021782 | Ga0495593_0021782_430_879 | 149 |
| 1435 | 3300047673 | Ga0495593_0022440 | Ga0495593_0022440_3032_3481 | 149 |
| 1436 | 3300048088 | Ga0495602_0001719 | Ga0495602_0001719_9169_9618 | 149 |
| 1437 | 3300048088 | Ga0495602_0004841 | Ga0495602_0004841_10698_11150 | 149 |
| 1438 | 3300048088 | Ga0495602_0044617 | Ga0495602_0044617_696_1145 | 149 |
| 1439 | 3300048090 | Ga0495615_0003530 | Ga0495615_0003530_1161_1685 | 149 |
| 1440 | 3300048091 | Ga0495626_0212925 | Ga0495626_0212925_173_622 | 149 |
| 1441 | 3300048903 | Ga0496100_0065196 | Ga0496100_0065196_1903_2352 | 149 |
| 1442 | 3300048903 | Ga0496100_0362376 | Ga0496100_0362376_223_672 | 149 |
| 1443 | 3300048903 | Ga0496100_0932015 | Ga0496100_0932015_142_591 | 149 |
| 1444 | 3300048904 | Ga0496101_0018829 | Ga0496101_0018829_1179_1628 | 149 |
| 1445 | 3300048904 | Ga0496101_0205581 | Ga0496101_0205581_996_1445 | 149 |
| 1446 | 3300048904 | Ga0496101_0212782 | Ga0496101_0212782_607_1056 | 149 |
| 1447 | 3300048904 | Ga0496101_0334223 | Ga0496101_0334223_625_1074 | 149 |
| 1448 | 3300048904 | Ga0496101_0340419 | Ga0496101_0340419_265_714 | 149 |
| 1449 | 3300048904 | Ga0496101_0427283 | Ga0496101_0427283_471_920 | 149 |
| 1450 | 3300048904 | Ga0496101_0610706 | Ga0496101_0610706_374_823 | 149 |
| 1451 | 3300048904 | Ga0496101_1266611 | Ga0496101_1266611_101_550 | 149 |
| 1452 | 3300048905 | Ga0496102_0010809 | Ga0496102_0010809_1162_1611 | 149 |
| 1453 | 3300048905 | Ga0496102_0059740 | Ga0496102_0059740_2293_2742 | 149 |
| 1454 | 3300048905 | Ga0496102_0090008 | Ga0496102_0090008_927_1376 | 149 |
| 1455 | 3300048905 | Ga0496102_0108748 | Ga0496102_0108748_16_465 | 149 |
| 1456 | 3300048905 | Ga0496102_0347586 | Ga0496102_0347586_497_946 | 149 |
| 1457 | 3300048905 | Ga0496102_0458804 | Ga0496102_0458804_402_851 | 149 |
| 1458 | 3300048905 | Ga0496102_0641467 | Ga0496102_0641467_381_830 | 149 |
| 1459 | 3300048905 | Ga0496102_0701273 | Ga0496102_0701273_197_646 | 149 |
| 1460 | 3300048905 | Ga0496102_1361471 | Ga0496102_1361471_166_615 | 149 |
| 1461 | 3300048906 | Ga0496103_0006115 | Ga0496103_0006115_2615_3064 | 149 |
| 1462 | 3300048906 | Ga0496103_0083756 | Ga0496103_0083756_1452_1901 | 149 |
| 1463 | 3300048906 | Ga0496103_0157727 | Ga0496103_0157727_650_1099 | 149 |
| 1464 | 3300048906 | Ga0496103_0258809 | Ga0496103_0258809_486_935 | 149 |
| 1465 | 3300048906 | Ga0496103_0658467 | Ga0496103_0658467_16_465 | 149 |
| 1466 | 3300048906 | Ga0496103_0935536 | Ga0496103_0935536_60_509 | 149 |
| 1467 | 3300048907 | Ga0496104_0002128 | Ga0496104_0002128_8380_8829 | 149 |
| 1468 | 3300048907 | Ga0496104_0006775 | Ga0496104_0006775_3082_3531 | 149 |
| 1469 | 3300048907 | Ga0496104_0049600 | Ga0496104_0049600_3031_3480 | 149 |
| 1470 | 3300048907 | Ga0496104_0101083 | Ga0496104_0101083_327_776 | 149 |
| 1471 | 3300048907 | Ga0496104_0263757 | Ga0496104_0263757_520_975 | 149 |
| 1472 | 3300048907 | Ga0496104_0757248 | Ga0496104_0757248_129_578 | 149 |
| 1473 | 3300048907 | Ga0496104_0786942 | Ga0496104_0786942_225_674 | 149 |
| 1474 | 3300048908 | Ga0496105_0005208 | Ga0496105_0005208_128_577 | 149 |
| 1475 | 3300048908 | Ga0496105_0009083 | Ga0496105_0009083_3019_3468 | 149 |
| 1476 | 3300048908 | Ga0496105_0029203 | Ga0496105_0029203_926_1375 | 149 |
| 1477 | 3300048908 | Ga0496105_0111707 | Ga0496105_0111707_1614_2063 | 149 |
| 1478 | 3300048908 | Ga0496105_0171132 | Ga0496105_0171132_1051_1500 | 149 |
| 1479 | 3300048908 | Ga0496105_0205500 | Ga0496105_0205500_829_1278 | 149 |
| 1480 | 3300048908 | Ga0496105_0247020 | Ga0496105_0247020_90_539 | 149 |
| 1481 | 3300048908 | Ga0496105_0572776 | Ga0496105_0572776_282_731 | 149 |
| 1482 | 3300048909 | Ga0496106_0004764 | Ga0496106_0004764_8442_8897 | 149 |
| 1483 | 3300048909 | Ga0496106_0058382 | Ga0496106_0058382_135_584 | 149 |
| 1484 | 3300048909 | Ga0496106_0121811 | Ga0496106_0121811_832_1281 | 149 |
| 1485 | 3300048909 | Ga0496106_0133749 | Ga0496106_0133749_964_1413 | 149 |
| 1486 | 3300048909 | Ga0496106_0342849 | Ga0496106_0342849_129_578 | 149 |
| 1487 | 3300048909 | Ga0496106_0376869 | Ga0496106_0376869_656_1117 | 149 |
| 1488 | 3300048909 | Ga0496106_0911546 | Ga0496106_0911546_220_669 | 149 |
| 1489 | 3300048910 | Ga0496107_0001840 | Ga0496107_0001840_5555_6004 | 149 |
| 1490 | 3300048910 | Ga0496107_0008370 | Ga0496107_0008370_2758_3207 | 149 |
| 1491 | 3300048910 | Ga0496107_0026974 | Ga0496107_0026974_1701_2150 | 149 |
| 1492 | 3300048910 | Ga0496107_0129249 | Ga0496107_0129249_153_608 | 149 |
| 1493 | 3300048910 | Ga0496107_0320513 | Ga0496107_0320513_69_518 | 149 |
| 1494 | 3300048910 | Ga0496107_0602014 | Ga0496107_0602014_134_583 | 149 |
| 1495 | 3300048911 | Ga0496108_0001980 | Ga0496108_0001980_1466_1921 | 149 |
| 1496 | 3300048911 | Ga0496108_0024345 | Ga0496108_0024345_2189_2638 | 149 |
| 1497 | 3300048911 | Ga0496108_0054851 | Ga0496108_0054851_1882_2331 | 149 |
| 1498 | 3300048911 | Ga0496108_0062831 | Ga0496108_0062831_2565_3014 | 149 |
| 1499 | 3300048911 | Ga0496108_0325002 | Ga0496108_0325002_432_881 | 149 |
| 1500 | 3300048912 | Ga0496109_0015085 | Ga0496109_0015085_1292_1747 | 149 |
| 1501 | 3300048912 | Ga0496109_0029396 | Ga0496109_0029396_3965_4414 | 149 |
| 1502 | 3300048912 | Ga0496109_0031537 | Ga0496109_0031537_1557_2006 | 149 |
| 1503 | 3300048912 | Ga0496109_0317776 | Ga0496109_0317776_341_790 | 149 |
| 1504 | 3300048912 | Ga0496109_0593596 | Ga0496109_0593596_136_585 | 149 |
| 1505 | 3300048913 | Ga0496110_0006296 | Ga0496110_0006296_6915_7364 | 149 |
| 1506 | 3300048913 | Ga0496110_0020595 | Ga0496110_0020595_676_1125 | 149 |
| 1507 | 3300048913 | Ga0496110_0031676 | Ga0496110_0031676_107_556 | 149 |
| 1508 | 3300048913 | Ga0496110_0227924 | Ga0496110_0227924_677_1126 | 149 |
| 1509 | 3300048913 | Ga0496110_0312467 | Ga0496110_0312467_384_833 | 149 |
| 1510 | 3300048913 | Ga0496110_0318973 | Ga0496110_0318973_176_625 | 149 |
| 1511 | 3300048913 | Ga0496110_0349333 | Ga0496110_0349333_489_938 | 149 |
| 1512 | 3300048913 | Ga0496110_0796989 | Ga0496110_0796989_299_748 | 149 |
| 1513 | 3300048914 | Ga0496111_0240487 | Ga0496111_0240487_40_489 | 149 |
| 1514 | 3300048914 | Ga0496111_0281550 | Ga0496111_0281550_591_1040 | 149 |
| 1515 | 3300048914 | Ga0496111_0285343 | Ga0496111_0285343_653_1102 | 149 |
| 1516 | 3300048914 | Ga0496111_0289130 | Ga0496111_0289130_442_891 | 149 |
| 1517 | 3300048914 | Ga0496111_0305041 | Ga0496111_0305041_712_1161 | 149 |
| 1518 | 3300048914 | Ga0496111_0402074 | Ga0496111_0402074_244_693 | 149 |
| 1519 | 3300048915 | Ga0496112_0004485 | Ga0496112_0004485_526_981 | 149 |
| 1520 | 3300048915 | Ga0496112_0019812 | Ga0496112_0019812_5720_6169 | 149 |
| 1521 | 3300048915 | Ga0496112_0057366 | Ga0496112_0057366_1299_1748 | 149 |
| 1522 | 3300048915 | Ga0496112_0079729 | Ga0496112_0079729_197_646 | 149 |
| 1523 | 3300048915 | Ga0496112_0188187 | Ga0496112_0188187_242_691 | 149 |
| 1524 | 3300048915 | Ga0496112_0253295 | Ga0496112_0253295_194_643 | 149 |
| 1525 | 3300048915 | Ga0496112_0305707 | Ga0496112_0305707_257_706 | 149 |
| 1526 | 3300048915 | Ga0496112_0659880 | Ga0496112_0659880_410_859 | 149 |
| 1527 | 3300048916 | Ga0496113_0175413 | Ga0496113_0175413_264_713 | 149 |
| 1528 | 3300048916 | Ga0496113_0232226 | Ga0496113_0232226_245_694 | 149 |
| 1529 | 3300048916 | Ga0496113_0268418 | Ga0496113_0268418_499_948 | 149 |
| 1530 | 3300048916 | Ga0496113_0355584 | Ga0496113_0355584_415_864 | 149 |
| 1531 | 3300048916 | Ga0496113_0372887 | Ga0496113_0372887_181_630 | 149 |
| 1532 | 3300048916 | Ga0496113_0427384 | Ga0496113_0427384_79_528 | 149 |
| 1533 | 3300048917 | Ga0496114_0008932 | Ga0496114_0008932_218_667 | 149 |
| 1534 | 3300048917 | Ga0496114_0060493 | Ga0496114_0060493_2669_3118 | 149 |
| 1535 | 3300048917 | Ga0496114_0071900 | Ga0496114_0071900_1503_1952 | 149 |
| 1536 | 3300048917 | Ga0496114_0093078 | Ga0496114_0093078_1982_2431 | 149 |
| 1537 | 3300048917 | Ga0496114_0517443 | Ga0496114_0517443_495_944 | 149 |
| 1538 | 3300048917 | Ga0496114_0520904 | Ga0496114_0520904_102_551 | 149 |
| 1539 | 3300048917 | Ga0496114_0887600 | Ga0496114_0887600_143_592 | 149 |
| 1540 | 3300048918 | Ga0496115_0001528 | Ga0496115_0001528_9308_9757 | 149 |
| 1541 | 3300048918 | Ga0496115_0014005 | Ga0496115_0014005_5566_6015 | 149 |
| 1542 | 3300048918 | Ga0496115_0067015 | Ga0496115_0067015_466_915 | 149 |
| 1543 | 3300048918 | Ga0496115_0107934 | Ga0496115_0107934_1162_1611 | 149 |
| 1544 | 3300048918 | Ga0496115_0149426 | Ga0496115_0149426_280_732 | 149 |
| 1545 | 3300048918 | Ga0496115_0149762 | Ga0496115_0149762_1110_1559 | 149 |
| 1546 | 3300048918 | Ga0496115_0435765 | Ga0496115_0435765_430_885 | 149 |
| 1547 | 3300048918 | Ga0496115_0503641 | Ga0496115_0503641_139_588 | 149 |
| 1548 | 3300048918 | Ga0496115_0842098 | Ga0496115_0842098_95_544 | 149 |
| 1549 | 3300048918 | Ga0496115_1311962 | Ga0496115_1311962_25_474 | 149 |
| 1550 | 3300048919 | Ga0496116_0002360 | Ga0496116_0002360_17636_18097 | 149 |
| 1551 | 3300048919 | Ga0496116_0055335 | Ga0496116_0055335_619_1068 | 149 |
| 1552 | 3300048920 | Ga0496117_0024592 | Ga0496117_0024592_2619_3080 | 149 |
| 1553 | 3300048920 | Ga0496117_0055499 | Ga0496117_0055499_490_951 | 149 |
| 1554 | 3300048920 | Ga0496117_0069138 | Ga0496117_0069138_1540_1989 | 149 |
| 1555 | 3300048920 | Ga0496117_0098446 | Ga0496117_0098446_759_1208 | 149 |
| 1556 | 3300048920 | Ga0496117_0147648 | Ga0496117_0147648_782_1231 | 149 |
| 1557 | 3300048920 | Ga0496117_0247274 | Ga0496117_0247274_310_759 | 149 |
| 1558 | 3300048920 | Ga0496117_0319027 | Ga0496117_0319027_162_611 | 149 |
| 1559 | 3300048920 | Ga0496117_0353543 | Ga0496117_0353543_119_568 | 149 |
| 1560 | 3300048921 | Ga0496118_0037036 | Ga0496118_0037036_636_1085 | 149 |
| 1561 | 3300048921 | Ga0496118_0108199 | Ga0496118_0108199_626_1075 | 149 |
| 1562 | 3300048921 | Ga0496118_0190023 | Ga0496118_0190023_753_1214 | 149 |
| 1563 | 3300048921 | Ga0496118_0254707 | Ga0496118_0254707_103_552 | 149 |
| 1564 | 3300048921 | Ga0496118_0431380 | Ga0496118_0431380_137_586 | 149 |
| 1565 | 3300048921 | Ga0496118_0505845 | Ga0496118_0505845_39_500 | 149 |
| 1566 | 3300048921 | Ga0496118_0559530 | Ga0496118_0559530_65_514 | 149 |
| 1567 | 3300048922 | Ga0496119_0044767 | Ga0496119_0044767_797_1246 | 149 |
| 1568 | 3300048922 | Ga0496119_0083600 | Ga0496119_0083600_578_1027 | 149 |
| 1569 | 3300048922 | Ga0496119_0177088 | Ga0496119_0177088_213_662 | 149 |
| 1570 | 3300048922 | Ga0496119_0293595 | Ga0496119_0293595_150_599 | 149 |
| 1571 | 3300048922 | Ga0496119_0566901 | Ga0496119_0566901_25_486 | 149 |
| 1572 | 3300048923 | Ga0496120_0021422 | Ga0496120_0021422_3019_3468 | 149 |
| 1573 | 3300048923 | Ga0496120_0026469 | Ga0496120_0026469_1895_2344 | 149 |
| 1574 | 3300048924 | Ga0496121_0004217 | Ga0496121_0004217_18646_19107 | 149 |
| 1575 | 3300048924 | Ga0496121_0024578 | Ga0496121_0024578_2979_3428 | 149 |
| 1576 | 3300048924 | Ga0496121_0026133 | Ga0496121_0026133_224_673 | 149 |
| 1577 | 3300048924 | Ga0496121_0042542 | Ga0496121_0042542_2206_2655 | 149 |
| 1578 | 3300048924 | Ga0496121_0059217 | Ga0496121_0059217_1669_2118 | 149 |
| 1579 | 3300048924 | Ga0496121_0146344 | Ga0496121_0146344_736_1185 | 149 |
| 1580 | 3300048924 | Ga0496121_0308783 | Ga0496121_0308783_43_492 | 149 |
| 1581 | 3300048924 | Ga0496121_0335526 | Ga0496121_0335526_25_474 | 149 |
| 1582 | 3300048924 | Ga0496121_0383863 | Ga0496121_0383863_63_512 | 149 |
| 1583 | 3300048924 | Ga0496121_0393818 | Ga0496121_0393818_255_704 | 149 |
| 1584 | 3300048924 | Ga0496121_0409651 | Ga0496121_0409651_152_625 | 149 |
| 1585 | 3300048924 | Ga0496121_0445241 | Ga0496121_0445241_27_476 | 149 |
| 1586 | 3300048924 | Ga0496121_0619446 | Ga0496121_0619446_203_652 | 149 |
| 1587 | 3300048924 | Ga0496121_0691491 | Ga0496121_0691491_112_561 | 149 |
| 1588 | 3300048926 | Ga0496123_0041651 | Ga0496123_0041651_2451_2912 | 149 |
| 1589 | 3300048926 | Ga0496123_0129019 | Ga0496123_0129019_469_918 | 149 |
| 1590 | 3300048927 | Ga0496124_0107574 | Ga0496124_0107574_610_1059 | 149 |
| 1591 | 3300048927 | Ga0496124_0131041 | Ga0496124_0131041_1376_1825 | 149 |
| 1592 | 3300048927 | Ga0496124_0282785 | Ga0496124_0282785_709_1158 | 149 |
| 1593 | 3300048927 | Ga0496124_0300355 | Ga0496124_0300355_28_477 | 149 |
| 1594 | 3300048927 | Ga0496124_0656285 | Ga0496124_0656285_118_567 | 149 |
| 1595 | 3300048927 | Ga0496124_0714667 | Ga0496124_0714667_88_537 | 149 |
| 1596 | 3300048928 | Ga0496125_0022040 | Ga0496125_0022040_4012_4473 | 149 |
| 1597 | 3300048928 | Ga0496125_0022335 | Ga0496125_0022335_2784_3245 | 149 |
| 1598 | 3300048928 | Ga0496125_0060254 | Ga0496125_0060254_2082_2543 | 149 |
| 1599 | 3300048928 | Ga0496125_0062839 | Ga0496125_0062839_130_579 | 149 |
| 1600 | 3300048928 | Ga0496125_0091796 | Ga0496125_0091796_1152_1601 | 149 |
| 1601 | 3300048928 | Ga0496125_0283924 | Ga0496125_0283924_355_804 | 149 |
| 1602 | 3300048928 | Ga0496125_0618190 | Ga0496125_0618190_68_517 | 149 |
| 1603 | 3300048929 | Ga0496126_0014622 | Ga0496126_0014622_2947_3396 | 149 |
| 1604 | 3300048929 | Ga0496126_0025409 | Ga0496126_0025409_2049_2498 | 149 |
| 1605 | 3300048929 | Ga0496126_0037954 | Ga0496126_0037954_3133_3582 | 149 |
| 1606 | 3300048929 | Ga0496126_0054823 | Ga0496126_0054823_1116_1565 | 149 |
| 1607 | 3300048929 | Ga0496126_0061444 | Ga0496126_0061444_244_693 | 149 |
| 1608 | 3300048929 | Ga0496126_0130622 | Ga0496126_0130622_42_491 | 149 |
| 1609 | 3300048929 | Ga0496126_0140303 | Ga0496126_0140303_1267_1716 | 149 |
| 1610 | 3300048929 | Ga0496126_0252266 | Ga0496126_0252266_279_728 | 149 |
| 1611 | 3300048929 | Ga0496126_0260491 | Ga0496126_0260491_178_627 | 149 |
| 1612 | 3300048929 | Ga0496126_0316920 | Ga0496126_0316920_493_966 | 149 |
| 1613 | 3300048929 | Ga0496126_0422499 | Ga0496126_0422499_503_964 | 149 |
| 1614 | 3300048929 | Ga0496126_1009061 | Ga0496126_1009061_49_498 | 149 |
| 1615 | 3300048929 | Ga0496126_1060356 | Ga0496126_1060356_94_543 | 149 |
| 1616 | 3300049460 | Ga0495682_0112000 | Ga0495682_0112000_380_829 | 149 |
| 1617 | 3300049460 | Ga0495682_0150374 | Ga0495682_0150374_52_501 | 149 |
| 1618 | 3300049460 | Ga0495682_0225797 | Ga0495682_0225797_33_482 | 149 |
| 1619 | 3300049569 | Ga0501032_0000076 | Ga0501032_0000076_46304_46768 | 149 |
| 1620 | 3300049570 | Ga0501033_0000093 | Ga0501033_0000093_38476_38940 | 149 |
| 1621 | 3300049571 | Ga0501034_0001640 | Ga0501034_0001640_14723_15187 | 149 |
| 1622 | 3300049571 | Ga0501034_0235039 | Ga0501034_0235039_553_1002 | 149 |
| 1623 | 3300049571 | Ga0501034_1162371 | Ga0501034_1162371_44_493 | 149 |
| 1624 | 3300049572 | Ga0501036_0000035 | Ga0501036_0000035_41297_41761 | 149 |
| 1625 | 3300049573 | Ga0501037_0000026 | Ga0501037_0000026_37081_37545 | 149 |
| 1626 | 3300049574 | Ga0501038_0000037 | Ga0501038_0000037_46277_46741 | 149 |
| 1627 | 3300049575 | Ga0501039_0000263 | Ga0501039_0000263_8933_9397 | 149 |
| 1628 | 3300049579 | Ga0501043_0000115 | Ga0501043_0000115_28918_29382 | 149 |
| 1629 | 3300049580 | Ga0501046_0000210 | Ga0501046_0000210_28890_29354 | 149 |
| 1630 | 3300049581 | Ga0501047_0000094 | Ga0501047_0000094_23596_24060 | 149 |
| 1631 | 3300049581 | Ga0501047_0045478 | Ga0501047_0045478_2307_2759 | 149 |
| 1632 | 3300049582 | Ga0501048_0012411 | Ga0501048_0012411_492_956 | 149 |
| 1633 | 3300049582 | Ga0501048_0125237 | Ga0501048_0125237_339_791 | 149 |
| 1634 | 3300049583 | Ga0501067_0026617 | Ga0501067_0026617_1271_1735 | 149 |
| 1635 | 3300049583 | Ga0501067_0140788 | Ga0501067_0140788_627_1076 | 149 |
| 1636 | 3300049584 | Ga0501068_0001034 | Ga0501068_0001034_13531_13995 | 149 |
| 1637 | 3300049585 | Ga0501069_0004848 | Ga0501069_0004848_5702_6166 | 149 |
| 1638 | 3300049585 | Ga0501069_0155153 | Ga0501069_0155153_721_1170 | 149 |
| 1639 | 3300049586 | Ga0501070_0000134 | Ga0501070_0000134_23692_24156 | 149 |
| 1640 | 3300049586 | Ga0501070_0053140 | Ga0501070_0053140_901_1353 | 149 |
| 1641 | 3300049588 | Ga0501072_0059293 | Ga0501072_0059293_1710_2174 | 149 |
| 1642 | 3300049589 | Ga0501073_0007576 | Ga0501073_0007576_2563_3027 | 149 |
| 1643 | 3300049589 | Ga0501073_0207705 | Ga0501073_0207705_61_513 | 149 |
| 1644 | 3300049589 | Ga0501073_0275856 | Ga0501073_0275856_450_899 | 149 |
| 1645 | 3300049589 | Ga0501073_1063235 | Ga0501073_1063235_32_481 | 149 |
| 1646 | 3300049590 | Ga0501074_0005960 | Ga0501074_0005960_6286_6750 | 149 |
| 1647 | 3300049590 | Ga0501074_0166763 | Ga0501074_0166763_197_649 | 149 |
| 1648 | 3300049742 | Ga0501080_0000076 | Ga0501080_0000076_23357_23821 | 149 |
| 1649 | 3300049742 | Ga0501080_0040484 | Ga0501080_0040484_2694_3146 | 149 |
| 1650 | 3300049742 | Ga0501080_0162213 | Ga0501080_0162213_89_538 | 149 |
| 1651 | 3300049744 | Ga0501083_0085514 | Ga0501083_0085514_374_823 | 149 |
| 1652 | 3300049744 | Ga0501083_0978690 | Ga0501083_0978690_48_509 | 149 |
| 1653 | 3300049822 | Ga0501035_0000533 | Ga0501035_0000533_28918_29382 | 149 |
| 1654 | 3300049823 | Ga0501044_0000507 | Ga0501044_0000507_23358_23822 | 149 |
| 1655 | 3300049823 | Ga0501044_0555403 | Ga0501044_0555403_56_505 | 149 |
| 1656 | 3300050489 | nmdc:mga03683_183258_c1 | nmdc:mga03683_183258_c1_336_797 | 149 |
| 1657 | 3300050489 | nmdc:mga03683_353232_c1 | nmdc:mga03683_353232_c1_202_651 | 149 |
| 1658 | 3300050489 | nmdc:mga03683_385757_c1 | nmdc:mga03683_385757_c1_164_613 | 149 |
| 1659 | 3300050490 | nmdc:mga03n38_222446_c1 | nmdc:mga03n38_222446_c1_251_880 | 149 |
| 1660 | 3300050491 | nmdc:mga00v17_157454_c1 | nmdc:mga00v17_157454_c1_500_961 | 149 |
| 1661 | 3300050491 | nmdc:mga00v17_23984_c1 | nmdc:mga00v17_23984_c1_2215_2664 | 149 |
| 1662 | 3300050491 | nmdc:mga00v17_332290_c1 | nmdc:mga00v17_332290_c1_39_488 | 149 |
| 1663 | 3300050491 | nmdc:mga00v17_337861_c1 | nmdc:mga00v17_337861_c1_363_824 | 149 |
| 1664 | 3300050491 | nmdc:mga00v17_928073_c1 | nmdc:mga00v17_928073_c1_66_515 | 149 |
| 1665 | 3300050492 | nmdc:mga0yw44_118957_c1 | nmdc:mga0yw44_118957_c1_1047_1496 | 149 |
| 1666 | 3300050492 | nmdc:mga0yw44_18253_c1 | nmdc:mga0yw44_18253_c1_328_777 | 149 |
| 1667 | 3300050492 | nmdc:mga0yw44_490286_c1 | nmdc:mga0yw44_490286_c1_362_811 | 149 |
| 1668 | 3300050492 | nmdc:mga0yw44_61539_c1 | nmdc:mga0yw44_61539_c1_808_1257 | 149 |
| 1669 | 3300050492 | nmdc:mga0yw44_69378_c1 | nmdc:mga0yw44_69378_c1_449_910 | 149 |
| 1670 | 3300050493 | nmdc:mga0k408_218381_c1 | nmdc:mga0k408_218381_c1_372_821 | 149 |
| 1671 | 3300050493 | nmdc:mga0k408_284606_c1 | nmdc:mga0k408_284606_c1_467_916 | 149 |
| 1672 | 3300050493 | nmdc:mga0k408_29471_c1 | nmdc:mga0k408_29471_c1_686_1135 | 149 |
| 1673 | 3300050493 | nmdc:mga0k408_663762_c1 | nmdc:mga0k408_663762_c1_61_510 | 149 |
| 1674 | 3300050494 | nmdc:mga06z11_172523_c1 | nmdc:mga06z11_172523_c1_726_1175 | 149 |
| 1675 | 3300050494 | nmdc:mga06z11_180910_c1 | nmdc:mga06z11_180910_c1_176_625 | 149 |
| 1676 | 3300050494 | nmdc:mga06z11_424049_c1 | nmdc:mga06z11_424049_c1_99_548 | 149 |
| 1677 | 3300050494 | nmdc:mga06z11_471066_c1 | nmdc:mga06z11_471066_c1_268_717 | 149 |
| 1678 | 3300050495 | nmdc:mga04h51_221672_c1 | nmdc:mga04h51_221672_c1_268_717 | 149 |
| 1679 | 3300050495 | nmdc:mga04h51_223004_c1 | nmdc:mga04h51_223004_c1_100_549 | 149 |
| 1680 | 3300050496 | nmdc:mga07m45_184829_c1 | nmdc:mga07m45_184829_c1_632_1093 | 149 |
| 1681 | 3300050496 | nmdc:mga07m45_204325_c1 | nmdc:mga07m45_204325_c1_423_872 | 149 |
| 1682 | 3300050496 | nmdc:mga07m45_218851_c1 | nmdc:mga07m45_218851_c1_553_1002 | 149 |
| 1683 | 3300050496 | nmdc:mga07m45_322869_c1 | nmdc:mga07m45_322869_c1_44_505 | 149 |
| 1684 | 3300050496 | nmdc:mga07m45_35536_c1 | nmdc:mga07m45_35536_c1_2273_2722 | 149 |
| 1685 | 3300050496 | nmdc:mga07m45_377597_c1 | nmdc:mga07m45_377597_c1_112_561 | 149 |
| 1686 | 3300050496 | nmdc:mga07m45_531301_c1 | nmdc:mga07m45_531301_c1_202_651 | 149 |
| 1687 | 3300050496 | nmdc:mga07m45_65834_c1 | nmdc:mga07m45_65834_c1_1499_1948 | 149 |
| 1688 | 3300050496 | nmdc:mga07m45_702870_c1 | nmdc:mga07m45_702870_c1_40_489 | 149 |
| 1689 | 3300050496 | nmdc:mga07m45_85017_c1 | nmdc:mga07m45_85017_c1_442_891 | 149 |
| 1690 | 3300050507 | nmdc:mga05p37_318829_c1 | nmdc:mga05p37_318829_c1_594_1043 | 149 |
| 1691 | 3300050507 | nmdc:mga05p37_974915_c1 | nmdc:mga05p37_974915_c1_367_816 | 149 |
| 1692 | 3300050508 | nmdc:mga09592_733831_c1 | nmdc:mga09592_733831_c1_255_704 | 149 |
| 1693 | 3300050511 | nmdc:mga08y16_1963255_c1 | nmdc:mga08y16_1963255_c1_17_466 | 149 |
| 1694 | 3300050511 | nmdc:mga08y16_862629_c1 | nmdc:mga08y16_862629_c1_120_569 | 149 |
| 1695 | 3300050512 | nmdc:mga0n895_14081_c1 | nmdc:mga0n895_14081_c1_515_964 | 149 |
| 1696 | 3300050514 | nmdc:mga08x19_920167_c1 | nmdc:mga08x19_920167_c1_139_588 | 149 |
| 1697 | 3300050516 | nmdc:mga0sz30_21570_c1 | nmdc:mga0sz30_21570_c1_1030_1479 | 149 |
| 1698 | 3300050516 | nmdc:mga0sz30_539945_c1 | nmdc:mga0sz30_539945_c1_30_479 | 149 |
| 1699 | 3300050516 | nmdc:mga0sz30_83531_c1 | nmdc:mga0sz30_83531_c1_60_509 | 149 |
| 1700 | 3300053077 | Ga0495601_0013705 | Ga0495601_0013705_186_638 | 149 |
| 1701 | 3300053077 | Ga0495601_0050280 | Ga0495601_0050280_2163_2612 | 149 |
| 1702 | 3300053077 | Ga0495601_0120675 | Ga0495601_0120675_740_1189 | 149 |
| 1703 | 3300053077 | Ga0495601_0285131 | Ga0495601_0285131_52_501 | 149 |
| 1704 | 3300053077 | Ga0495601_0477811 | Ga0495601_0477811_282_731 | 149 |
| 1705 | 3300053078 | Ga0495612_0023553 | Ga0495612_0023553_968_1417 | 149 |
| 1706 | 3300053078 | Ga0495612_0058623 | Ga0495612_0058623_324_773 | 149 |
| 1707 | 3300053079 | Ga0500610_0072351 | Ga0500610_0072351_518_967 | 149 |
| 1708 | 3300053080 | Ga0500635_0092661 | Ga0500635_0092661_615_1064 | 149 |
| 1709 | 3300053083 | Ga0495655_0052088 | Ga0495655_0052088_58_507 | 149 |
| 1710 | 3300053083 | Ga0495655_0058818 | Ga0495655_0058818_396_845 | 149 |
| 1711 | 3300053083 | Ga0495655_0136904 | Ga0495655_0136904_218_667 | 149 |
| 1712 | 3300053083 | Ga0495655_0181156 | Ga0495655_0181156_203_652 | 149 |
| 1713 | 3300053084 | Ga0495595_0000170 | Ga0495595_0000170_7499_7951 | 149 |
| 1714 | 3300053084 | Ga0495595_0167853 | Ga0495595_0167853_397_846 | 149 |
| 1715 | 3300053084 | Ga0495595_0242386 | Ga0495595_0242386_119_568 | 149 |
| 1716 | 3300053085 | Ga0495619_0000803 | Ga0495619_0000803_9018_9470 | 149 |
| 1717 | 3300053085 | Ga0495619_0006966 | Ga0495619_0006966_4709_5158 | 149 |
| 1718 | 3300053085 | Ga0495619_0192320 | Ga0495619_0192320_725_1174 | 149 |
| 1719 | 3300053085 | Ga0495619_0680058 | Ga0495619_0680058_195_647 | 149 |
| 1720 | 3300053085 | Ga0495619_0802659 | Ga0495619_0802659_147_596 | 149 |
| 1721 | 3300053086 | Ga0500578_0202710 | Ga0500578_0202710_460_909 | 149 |
| 1722 | 3300053086 | Ga0500578_0211384 | Ga0500578_0211384_508_957 | 149 |
| 1723 | 3300053086 | Ga0500578_0233959 | Ga0500578_0233959_250_699 | 149 |
| 1724 | 3300053086 | Ga0500578_0272475 | Ga0500578_0272475_106_555 | 149 |
| 1725 | 3300053086 | Ga0500578_0286372 | Ga0500578_0286372_55_504 | 149 |
| 1726 | 3300053086 | Ga0500578_0453092 | Ga0500578_0453092_202_651 | 149 |
| 1727 | 3300053086 | Ga0500578_0606971 | Ga0500578_0606971_101_562 | 149 |
| 1728 | 3300053087 | Ga0500643_000018 | Ga0500643_000018_271288_271737 | 149 |
| 1729 | 3300053087 | Ga0500643_054343 | Ga0500643_054343_629_1090 | 149 |
| 1730 | 3300053088 | Ga0500644_0071203 | Ga0500644_0071203_791_1240 | 149 |
| 1731 | 3300053088 | Ga0500644_0412800 | Ga0500644_0412800_124_573 | 149 |
| 1732 | 3300053089 | Ga0500581_038250 | Ga0500581_038250_40_501 | 149 |
| 1733 | 3300053090 | Ga0500646_0096244 | Ga0500646_0096244_215_673 | 149 |
| 1734 | 3300053091 | Ga0500647_0045892 | Ga0500647_0045892_288_740 | 149 |
| 1735 | 3300053091 | Ga0500647_0062219 | Ga0500647_0062219_256_705 | 149 |
| 1736 | 3300053093 | Ga0500651_0055493 | Ga0500651_0055493_509_958 | 149 |
| 1737 | 3300053093 | Ga0500651_0091172 | Ga0500651_0091172_597_1058 | 149 |
| 1738 | 3300053093 | Ga0500651_0126865 | Ga0500651_0126865_716_1165 | 149 |
| 1739 | 3300053093 | Ga0500651_0180309 | Ga0500651_0180309_756_1205 | 149 |
| 1740 | 3300053093 | Ga0500651_0293463 | Ga0500651_0293463_228_689 | 149 |
| 1741 | 3300053093 | Ga0500651_0590600 | Ga0500651_0590600_134_583 | 149 |
| 1742 | 3300053094 | Ga0500566_0000066 | Ga0500566_0000066_44355_44816 | 149 |
| 1743 | 3300053094 | Ga0500566_0264962 | Ga0500566_0264962_321_770 | 149 |
| 1744 | 3300053095 | Ga0500640_063827 | Ga0500640_063827_460_909 | 149 |
| 1745 | 3300053096 | Ga0500641_0085253 | Ga0500641_0085253_618_1067 | 149 |
| 1746 | 3300053096 | Ga0500641_0097248 | Ga0500641_0097248_439_900 | 149 |
| 1747 | 3300053098 | Ga0500650_0000287 | Ga0500650_0000287_9925_10386 | 149 |
| 1748 | 3300053098 | Ga0500650_0283182 | Ga0500650_0283182_44_493 | 149 |
| 1749 | 3300053103 | Ga0500555_003373 | Ga0500555_003373_3058_3507 | 149 |
| 1750 | 3300053103 | Ga0500555_128064 | Ga0500555_128064_60_521 | 149 |
| 1751 | 3300053104 | Ga0500556_0000058 | Ga0500556_0000058_111856_112317 | 149 |
| 1752 | 3300053105 | Ga0500557_000008 | Ga0500557_000008_93457_93906 | 149 |
| 1753 | 3300053108 | Ga0500562_001778 | Ga0500562_001778_1813_2274 | 149 |
| 1754 | 3300053108 | Ga0500562_012928 | Ga0500562_012928_767_1216 | 149 |
| 1755 | 3300053108 | Ga0500562_016626 | Ga0500562_016626_1171_1620 | 149 |
| 1756 | 3300053108 | Ga0500562_072939 | Ga0500562_072939_382_840 | 149 |
| 1757 | 3300053109 | Ga0500569_005296 | Ga0500569_005296_1529_1978 | 149 |
| 1758 | 3300053109 | Ga0500569_023221 | Ga0500569_023221_255_704 | 149 |
| 1759 | 3300053109 | Ga0500569_181696 | Ga0500569_181696_186_647 | 149 |
| 1760 | 3300053116 | Ga0500592_010653 | Ga0500592_010653_819_1280 | 149 |
| 1761 | 3300053116 | Ga0500592_025793 | Ga0500592_025793_394_843 | 149 |
| 1762 | 3300053116 | Ga0500592_032094 | Ga0500592_032094_370_819 | 149 |
| 1763 | 3300053118 | Ga0500594_0125961 | Ga0500594_0125961_208_657 | 149 |
| 1764 | 3300053119 | Ga0500595_000146 | Ga0500595_000146_37317_37766 | 149 |
| 1765 | 3300053119 | Ga0500595_016698 | Ga0500595_016698_153_602 | 149 |
| 1766 | 3300053119 | Ga0500595_021184 | Ga0500595_021184_1241_1690 | 149 |
| 1767 | 3300053119 | Ga0500595_035545 | Ga0500595_035545_481_930 | 149 |
| 1768 | 3300053119 | Ga0500595_044103 | Ga0500595_044103_498_947 | 149 |
| 1769 | 3300053119 | Ga0500595_108409 | Ga0500595_108409_206_655 | 149 |
| 1770 | 3300053120 | Ga0500597_078318 | Ga0500597_078318_101_550 | 149 |
| 1771 | 3300053121 | Ga0500607_254200 | Ga0500607_254200_209_658 | 149 |
| 1772 | 3300053122 | Ga0500608_078190 | Ga0500608_078190_821_1270 | 149 |
| 1773 | 3300053122 | Ga0500608_147819 | Ga0500608_147819_60_521 | 149 |
| 1774 | 3300053126 | Ga0500621_190292 | Ga0500621_190292_145_603 | 149 |
| 1775 | 3300053128 | Ga0500626_113230 | Ga0500626_113230_451_900 | 149 |
| 1776 | 3300053130 | Ga0500642_0000025 | Ga0500642_0000025_2136_2597 | 149 |
| 1777 | 3300053130 | Ga0500642_0000294 | Ga0500642_0000294_4143_4592 | 149 |
| 1778 | 3300053130 | Ga0500642_0006956 | Ga0500642_0006956_2391_2840 | 149 |
| 1779 | 3300053130 | Ga0500642_0284256 | Ga0500642_0284256_235_684 | 149 |
| 1780 | 3300053130 | Ga0500642_0365903 | Ga0500642_0365903_53_502 | 149 |
| 1781 | 3300053131 | Ga0500652_010275 | Ga0500652_010275_784_1245 | 149 |
| 1782 | 3300053131 | Ga0500652_273446 | Ga0500652_273446_13_462 | 149 |
| 1783 | 3300053133 | Ga0500655_047627 | Ga0500655_047627_14_463 | 149 |
| 1784 | 3300053133 | Ga0500655_084418 | Ga0500655_084418_26_487 | 149 |
| 1785 | 3300053134 | Ga0500658_0015391 | Ga0500658_0015391_592_1053 | 149 |
| 1786 | 3300053134 | Ga0500658_0145854 | Ga0500658_0145854_200_649 | 149 |
| 1787 | 3300053136 | Ga0500559_0001270 | Ga0500559_0001270_8636_9097 | 149 |
| 1788 | 3300053136 | Ga0500559_0209412 | Ga0500559_0209412_177_626 | 149 |
| 1789 | 3300053136 | Ga0500559_0374340 | Ga0500559_0374340_178_627 | 149 |
| 1790 | 3300053139 | Ga0500568_0000833 | Ga0500568_0000833_20944_21405 | 149 |
| 1791 | 3300053139 | Ga0500568_0018742 | Ga0500568_0018742_1303_1752 | 149 |
| 1792 | 3300053139 | Ga0500568_0077476 | Ga0500568_0077476_776_1225 | 149 |
| 1793 | 3300053139 | Ga0500568_0081189 | Ga0500568_0081189_127_585 | 149 |
| 1794 | 3300053142 | Ga0500577_0196826 | Ga0500577_0196826_57_506 | 149 |
| 1795 | 3300053142 | Ga0500577_0223639 | Ga0500577_0223639_70_531 | 149 |
| 1796 | 3300053142 | Ga0500577_0230969 | Ga0500577_0230969_52_501 | 149 |
| 1797 | 3300053145 | Ga0500586_008323 | Ga0500586_008323_1960_2421 | 149 |
| 1798 | 3300053148 | Ga0500590_134736 | Ga0500590_134736_11_460 | 149 |
| 1799 | 3300053148 | Ga0500590_268625 | Ga0500590_268625_108_557 | 149 |
| 1800 | 3300053148 | Ga0500590_284628 | Ga0500590_284628_107_556 | 149 |
| 1801 | 3300053151 | Ga0500604_0001603 | Ga0500604_0001603_1412_1873 | 149 |
| 1802 | 3300053151 | Ga0500604_0055233 | Ga0500604_0055233_126_575 | 149 |
| 1803 | 3300053151 | Ga0500604_0172857 | Ga0500604_0172857_256_705 | 149 |
| 1804 | 3300053151 | Ga0500604_0288003 | Ga0500604_0288003_55_516 | 149 |
| 1805 | 3300053153 | Ga0500616_0000031 | Ga0500616_0000031_414367_414828 | 149 |
| 1806 | 3300053154 | Ga0500619_036636 | Ga0500619_036636_933_1382 | 149 |
| 1807 | 3300053156 | Ga0500622_0000783 | Ga0500622_0000783_6252_6713 | 149 |
| 1808 | 3300053156 | Ga0500622_0006295 | Ga0500622_0006295_871_1320 | 149 |
| 1809 | 3300053158 | Ga0500627_0139073 | Ga0500627_0139073_147_605 | 149 |
| 1810 | 3300053158 | Ga0500627_0172235 | Ga0500627_0172235_332_781 | 149 |
| 1811 | 3300053158 | Ga0500627_0368277 | Ga0500627_0368277_28_489 | 149 |
| 1812 | 3300053158 | Ga0500627_0406239 | Ga0500627_0406239_117_566 | 149 |
| 1813 | 3300053160 | Ga0500633_0016500 | Ga0500633_0016500_1610_2059 | 149 |
| 1814 | 3300053160 | Ga0500633_0173307 | Ga0500633_0173307_98_547 | 149 |
| 1815 | 3300053161 | Ga0500634_0040764 | Ga0500634_0040764_1432_1881 | 149 |
| 1816 | 3300053161 | Ga0500634_0175751 | Ga0500634_0175751_167_616 | 149 |
| 1817 | 3300053162 | Ga0500638_071504 | Ga0500638_071504_699_1148 | 149 |
| 1818 | 3300053162 | Ga0500638_146932 | Ga0500638_146932_62_511 | 149 |
| 1819 | 3300053162 | Ga0500638_209792 | Ga0500638_209792_150_599 | 149 |
| 1820 | 3300053177 | Ga0500636_0000550 | Ga0500636_0000550_17855_18304 | 149 |
| 1821 | 3300053177 | Ga0500636_0000803 | Ga0500636_0000803_11430_11891 | 149 |
| 1822 | 3300053177 | Ga0500636_0063170 | Ga0500636_0063170_1284_1736 | 149 |
| 1823 | 3300053177 | Ga0500636_0159098 | Ga0500636_0159098_634_1083 | 149 |
| 1824 | 3300053178 | Ga0500637_0254581 | Ga0500637_0254581_310_783 | 149 |
| 1825 | 3300053722 | Ga0500649_157189 | Ga0500649_157189_226_675 | 149 |
| 1826 | 3300053727 | Ga0500611_015384 | Ga0500611_015384_814_1275 | 149 |
| 1827 | 3300053727 | Ga0500611_034709 | Ga0500611_034709_114_572 | 149 |
| 1828 | 3300053727 | Ga0500611_073330 | Ga0500611_073330_10_459 | 149 |
| 1829 | 3300053729 | Ga0500625_011535 | Ga0500625_011535_1594_2043 | 149 |
| 1830 | 3300053730 | Ga0500645_018190 | Ga0500645_018190_1039_1488 | 149 |
| 1831 | 3300053730 | Ga0500645_019058 | Ga0500645_019058_320_769 | 149 |
| 1832 | 3300053730 | Ga0500645_025642 | Ga0500645_025642_1079_1540 | 149 |
| 1833 | 3300053731 | Ga0500609_033219 | Ga0500609_033219_44_493 | 149 |
| 1834 | 3300053736 | Ga0500599_008514 | Ga0500599_008514_381_830 | 149 |
| 1835 | 3300053737 | Ga0500601_000062 | Ga0500601_000062_16470_16919 | 149 |
| 1836 | 3300053737 | Ga0500601_015101 | Ga0500601_015101_62_511 | 149 |
| 1837 | 3300055283 | Ga0500661_010169 | Ga0500661_010169_122_586 | 149 |
| 1838 | 3300060344 | Ga0587071_163124 | Ga0587071_163124_54_503 | 149 |
| 1839 | 3300060353 | Ga0501082_0293473 | Ga0501082_0293473_155_619 | 149 |
| 1840 | 3300060353 | Ga0501082_0347917 | Ga0501082_0347917_63_512 | 149 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7zvm-assembly1.cif.gz_A-2 | thermococcus barophilus phosphomannose isomerase protein structure at 1.6 a | 0.8593 | 53 | 148 |
| 7zvy-assembly1.cif.gz_G | thermococcus kadokarensis phosphomannose isomerase | 0.859 | 56 | 148 |
| 7zvy-assembly2.cif.gz_B | thermococcus kadokarensis phosphomannose isomerase | 0.8583 | 50 | 148 |
| 8hfb-assembly1.cif.gz_B | evolved variant of quercetin 2,4-dioxygenase from bacillus subtilis | 0.8545 | 56 | 137 |
| 5wse-assembly2.cif.gz_C | crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i | 0.8505 | 55 | 137 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P24174_373_472_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8988 | 57 | 149 | 2.60.120.10 |
| af_Q9USR9_537_626_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8558 | 56 | 137 | 2.60.120.10 |
| 5fpxA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8473 | 52 | 138 | 2.60.120.10 |
| af_E7FAC3_1039_1126_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8429 | 56 | 137 | 2.60.120.10 |
| 2d40B00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8414 | 64 | 137 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1L7AJM5-F1-model_v4 | Cupin | 0.9655 | 33 | 149 |
|
| AF-H1SBP4-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9582 | 48 | 149 |
|
| AF-A0A1H4H3X3-F1-model_v4 | Cupin domain-containing protein | 0.9519 | 57 | 149 |
|
| AF-A0A536YKB3-F1-model_v4 | Cupin domain-containing protein | 0.945 | 68 | 149 |
|
| AF-A0A536YKB3-F1-model_v4 | Cupin domain-containing protein | 0.9341 | 68 | 149 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar