F495863

General Info

Members Datasets Scaffolds Average Seq Length
1840 727 1654 149

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10100918|Ga0157380_101009183
Length 179
Sequence LRRRLSARWPDAGRRHSIGVTNNDKWEGFPMNRIATTLSLAAAFAAGCSVTHLLRPAIAAENITAQVIHTGELEGDALGMPSGTGMRSKMFVSADGMTISVQDGNVPKHMHPNTNEIQYILEGTGTVWLGDKEVRVKPGDLVVIPKGTPHGGTKPDGRTLKAIAIKTPPQAPDDTKMLN

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
17 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
18 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
19 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
20 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
21 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
22 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
23 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
24 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
25 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
26 2791355199
27 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
28 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
29 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
30 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
31 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
32 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
33 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
34 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
35 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
36 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
37 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
38 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
39 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
40 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
41 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
42 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
43 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
44 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
45 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
46 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
47 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
48 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
49 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
50 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
51 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
52 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
53 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
54 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
55 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
56 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
57 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
58 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
59 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
60 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
61 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
62 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
63 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
64 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
65 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
66 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
67 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
68 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
69 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
70 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
71 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
72 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
73 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
74 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
75 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
76 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
77 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
78 2904699407
79 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
80 2906610324
81 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
82 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
83 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
84 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
85 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
86 2922368715
87 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
88 2922425934
89 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
90 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
91 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
92 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
93 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
94 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
95 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
96 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
97 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
98 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
99 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
100 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
101 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
102 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
103 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
104 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
105 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
106 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
107 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
108 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
109 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
110 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
111 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
112 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
113 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
114 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
115 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
116 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
117 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
118 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
119 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
120 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
121 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
122 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
123 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
124 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
125 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
126 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
127 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
128 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
129 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
130 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
131 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
132 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
133 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
134 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
135 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
136 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
137 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
138 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
139 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
140 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
141 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
142 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
143 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
144 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
145 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
146 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
147 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
148 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
149 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
150 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
151 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
152 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
153 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
154 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
155 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
156 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
157 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
158 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
159 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
160 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
161 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
162 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
163 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
164 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
166 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
167 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
168 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
169 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
170 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
171 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
172 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
173 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
174 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
175 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
176 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
177 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
178 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
179 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
180 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
181 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
182 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
183 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
184 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
185 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
186 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
187 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
188 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
189 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
190 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
191 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
192 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
193 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
194 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
195 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
196 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
197 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
198 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
199 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
200 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
201 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
202 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
203 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
204 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
205 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
206 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
207 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
208 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
209 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
210 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
211 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
212 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
213 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
214 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
215 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
216 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
217 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
218 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
219 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
220 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
221 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
222 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
223 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
224 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
225 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
226 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
227 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
228 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
229 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
230 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
231 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
232 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
233 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
234 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
235 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
236 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
237 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
238 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
239 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
240 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
241 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
242 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
243 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
244 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
245 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
246 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
247 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
248 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
249 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
250 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
251 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
252 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
253 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
254 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
255 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
256 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
257 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
258 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
259 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
260 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
261 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
262 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
263 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
264 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
265 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
266 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
267 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
268 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
269 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
270 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
271 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
272 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
273 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
274 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
275 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
276 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
277 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
278 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
279 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
280 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
281 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
282 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
283 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
284 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
285 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
286 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
287 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
288 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
289 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
290 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
291 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
292 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
293 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
294 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
295 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
296 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
297 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
298 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
299 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
300 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
301 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
302 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
303 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
307 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
309 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
310 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
311 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
312 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
313 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
315 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
380 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
381 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
382 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
383 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
384 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
385 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
389 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
390 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
391 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
392 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
393 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
394 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
395 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
396 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
397 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
398 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
399 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
400 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
401 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
402 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
403 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
404 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
405 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
406 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
407 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
408 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
409 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
410 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
411 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
412 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
413 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
414 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
415 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
416 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
417 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
418 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
419 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
420 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
421 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
422 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
423 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
424 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
425 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
426 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
427 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
428 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
429 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
430 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
431 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
432 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
433 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
434 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
435 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
436 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
437 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
438 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
439 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
440 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
441 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
442 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
443 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
444 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
445 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
446 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
447 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
448 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
449 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
450 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
451 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
452 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
453 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
454 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
455 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
456 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
457 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
458 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
459 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
460 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
461 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
462 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
463 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
464 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
465 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
466 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
467 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
468 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
469 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
470 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
471 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
472 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
473 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
474 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
475 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
476 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
477 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
478 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
479 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
480 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
481 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
482 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
483 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
484 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
485 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
486 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
487 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
488 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
489 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
490 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
491 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
492 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
493 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
494 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
495 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
496 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
497 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
498 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
499 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
500 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
501 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
502 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
503 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
504 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
505 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
506 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
507 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
508 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
509 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
510 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
511 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
512 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
513 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
514 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
515 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
516 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
517 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
518 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
519 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
520 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
521 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
522 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
523 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
524 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
525 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
526 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
527 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
528 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
529 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
530 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
531 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
532 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
533 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
534 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
535 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
536 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
537 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
538 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
539 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
540 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
541 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
542 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
543 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
544 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
545 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
546 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
547 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
548 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
549 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
550 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
551 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
552 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
553 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
554 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
555 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
556 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
557 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
558 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
559 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
560 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
561 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
562 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
563 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
564 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
565 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
566 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
567 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
568 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
569 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
570 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
571 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
572 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
573 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
574 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
575 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
576 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
577 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
578 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
579 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
580 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
581 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
582 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
583 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
584 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
585 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
586 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
587 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
588 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
589 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
590 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
591 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
592 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
593 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
594 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
595 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
596 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
597 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
598 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
599 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
600 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
601 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
602 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
603 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
604 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
605 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
606 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
607 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
608 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
609 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
610 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
611 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
612 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
613 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
614 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
615 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
616 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
617 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
618 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
619 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
620 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
621 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
622 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
623 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
624 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
625 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
626 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
627 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
628 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
629 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
630 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
631 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
632 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
633 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
634 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
635 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
636 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
637 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
638 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
639 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
640 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
641 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
642 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
643 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
644 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
645 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
646 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
647 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
648 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
649 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
650 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
651 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
652 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
653 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
654 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
655 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
656 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
657 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
658 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
659 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
660 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
661 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
662 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
663 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
664 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
665 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
666 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
667 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
668 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
669 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
670 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
671 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
672 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
673 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
674 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
675 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
676 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
677 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
678 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
679 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
680 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
681 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
682 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
683 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
684 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
685 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
686 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
687 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
688 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
689 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
690 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
691 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
692 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
693 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
694 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
695 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
696 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
697 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
698 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
699 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
700 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
701 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
702 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
703 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
704 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
705 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
706 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
707 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
708 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
709 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
710 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
711 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
712 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
713 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
714 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
715 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
716 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
717 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
718 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
719 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
720 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
721 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
722 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
723 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
724 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
725 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
726 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
727 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.32
Metatranscriptomes 0.82
Isolates 9.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.45
Nodule 8.32
Rhizoplane 6.74
Rhizosphere 64.51
Stem 0
Stem Tuber 0
Unclassified 7.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214814962 2209111006 Unclassified 677
2 JGI24739J22299_10053737 3300001989 Bacteria 1292
3 JGI24737J22298_10172787 3300001990 Bacteria 638
4 JGI24738J21930_10096315 3300002075 Bacteria 629
5 JGI24742J22300_10017201 3300002244 Bacteria 1222
6 JGI24751J29686_10040469 3300002459 Bacteria 965
7 JGI25153J46596_10001613 3300003215 Bacteria 13373
8 JGI25153J46596_10006408 3300003215 Bacteria 5957
9 JGI25160J50197_1002315 3300003354 Bacteria 8917
10 JGI25160J50197_1017116 3300003354 Bacteria 2309
11 Ga0055542_1010193 3300003762 Bacteria 1731
12 Ga0055529_1011412 3300003763 Bacteria 1144
13 Ga0058863_11267463 3300004799 Bacteria 507
14 Ga0065165_1000437 3300005262 Bacteria 65503
15 Ga0065165_1001951 3300005262 Bacteria 19574
16 Ga0065712_10184569 3300005290 Bacteria 1176
17 Ga0065715_10166218 3300005293 Bacteria 1580
18 Ga0070658_10214222 3300005327 Bacteria 1628
19 Ga0070676_10125466 3300005328 Bacteria 1617
20 Ga0070676_10127094 3300005328 Bacteria 1607
21 Ga0070676_10187090 3300005328 Bacteria 1350
22 Ga0070676_10341808 3300005328 Bacteria 1027
23 Ga0070683_100162394 3300005329 Bacteria 2120
24 Ga0070683_101478914 3300005329 Bacteria 653
25 Ga0070690_100193209 3300005330 Unclassified 1412
26 Ga0070690_100239189 3300005330 Bacteria 1280
27 Ga0070670_100271810 3300005331 Bacteria 1479
28 Ga0070670_101093918 3300005331 Bacteria 727
29 Ga0070670_101177805 3300005331 Bacteria 700
30 Ga0070677_10029717 3300005333 Bacteria 2075
31 Ga0070677_10094607 3300005333 Bacteria 1306
32 Ga0068869_100267014 3300005334 Bacteria 1372
33 Ga0068869_100269471 3300005334 Bacteria 1366
34 Ga0070666_10008638 3300005335 Bacteria 6333
35 Ga0070666_10075916 3300005335 Bacteria 2292
36 Ga0070666_10268351 3300005335 Bacteria 1211
37 Ga0070680_100018027 3300005336 Bacteria 5576
38 Ga0070680_101545674 3300005336 Bacteria 575
39 Ga0068868_100024743 3300005338 Bacteria 4558
40 Ga0068868_100140422 3300005338 Bacteria 1983
41 Ga0068868_100148090 3300005338 Bacteria 1932
42 Ga0068868_100174997 3300005338 Bacteria 1778
43 Ga0068868_101017958 3300005338 Bacteria 758
44 Ga0068868_101117733 3300005338 Bacteria 726
45 Ga0070660_100364427 3300005339 Bacteria 1191
46 Ga0070660_100372110 3300005339 Bacteria 1179
47 Ga0070660_100903632 3300005339 Bacteria 745
48 Ga0070660_101134627 3300005339 Bacteria 662
49 Ga0070689_101261410 3300005340 Bacteria 665
50 Ga0070691_10096833 3300005341 Bacteria 1461
51 Ga0070687_100138119 3300005343 Bacteria 1416
52 Ga0070687_100542160 3300005343 Bacteria 790
53 Ga0070687_100673168 3300005343 Bacteria 720
54 Ga0070661_100084660 3300005344 Bacteria 2342
55 Ga0070668_100120988 3300005347 Bacteria 2092
56 Ga0070668_100320806 3300005347 Bacteria 1304
57 Ga0070669_100172181 3300005353 Bacteria 1688
58 Ga0070669_100336845 3300005353 Bacteria 1221
59 Ga0070669_100688319 3300005353 Bacteria 863
60 Ga0070669_100834424 3300005353 Bacteria 785
61 Ga0070669_101447885 3300005353 Bacteria 596
62 Ga0070675_100242240 3300005354 Bacteria 1576
63 Ga0070675_100522162 3300005354 Bacteria 1071
64 Ga0070675_100686590 3300005354 Bacteria 932
65 Ga0070675_101261938 3300005354 Bacteria 680
66 Ga0070671_100006274 3300005355 Bacteria 9475
67 Ga0070671_100483066 3300005355 Bacteria 1065
68 Ga0070671_100912787 3300005355 Bacteria 767
69 Ga0070671_101486568 3300005355 Bacteria 599
70 Ga0070674_100074733 3300005356 Bacteria 2405
71 Ga0070674_100258298 3300005356 Bacteria 1371
72 Ga0070674_100392083 3300005356 Unclassified 1132
73 Ga0070673_100116311 3300005364 Bacteria 2224
74 Ga0070673_100153511 3300005364 Bacteria 1952
75 Ga0070673_100413045 3300005364 Bacteria 1209
76 Ga0070673_100480292 3300005364 Bacteria 1122
77 Ga0070688_100251830 3300005365 Bacteria 1258
78 Ga0070688_100395623 3300005365 Bacteria 1022
79 Ga0070688_100861205 3300005365 Unclassified 712
80 Ga0070688_100986016 3300005365 Bacteria 669
81 Ga0070659_100182395 3300005366 Bacteria 1723
82 Ga0070659_100237636 3300005366 Bacteria 1507
83 Ga0070659_100482612 3300005366 Bacteria 1055
84 Ga0070659_100574413 3300005366 Bacteria 967
85 Ga0070659_100760004 3300005366 Bacteria 841
86 Ga0070659_101167680 3300005366 Bacteria 680
87 Ga0070667_100016970 3300005367 Bacteria 6027
88 Ga0070667_100274656 3300005367 Bacteria 1512
89 Ga0070667_100275142 3300005367 Bacteria 1511
90 Ga0070667_100986553 3300005367 Bacteria 786
91 Ga0070667_101290568 3300005367 Bacteria 684
92 Ga0070703_10112008 3300005406 Bacteria 978
93 Ga0070709_10426569 3300005434 Bacteria 995
94 Ga0070709_10534843 3300005434 Bacteria 895
95 Ga0070709_11375871 3300005434 Bacteria 571
96 Ga0070709_11453862 3300005434 Bacteria 556
97 Ga0070714_102210494 3300005435 Bacteria 536
98 Ga0070714_102483409 3300005435 Bacteria 503
99 Ga0070713_100932763 3300005436 Bacteria 836
100 Ga0070701_10666884 3300005438 Bacteria 696
101 Ga0070711_100575500 3300005439 Bacteria 937
102 Ga0070711_100686924 3300005439 Bacteria 861
103 Ga0070711_100829331 3300005439 Bacteria 786
104 Ga0070711_101422535 3300005439 Bacteria 604
105 Ga0070705_100434794 3300005440 Bacteria 980
106 Ga0070700_100048865 3300005441 Bacteria 2623
107 Ga0070700_100076673 3300005441 Bacteria 2147
108 Ga0070700_100719204 3300005441 Bacteria 796
109 Ga0070663_100041743 3300005455 Bacteria 3220
110 Ga0070663_100046047 3300005455 Bacteria 3085
111 Ga0070663_100166126 3300005455 Bacteria 1702
112 Ga0070663_100172906 3300005455 Bacteria 1671
113 Ga0070663_100675713 3300005455 Bacteria 876
114 Ga0070663_100697163 3300005455 Bacteria 863
115 Ga0070678_100040131 3300005456 Bacteria 3309
116 Ga0070678_100074215 3300005456 Bacteria 2555
117 Ga0070678_100287658 3300005456 Unclassified 1392
118 Ga0070678_100313726 3300005456 Bacteria 1337
119 Ga0070678_100386189 3300005456 Bacteria 1212
120 Ga0070678_100443219 3300005456 Bacteria 1136
121 Ga0070678_101436922 3300005456 Bacteria 645
122 Ga0070662_100038911 3300005457 Bacteria 3381
123 Ga0070662_100336141 3300005457 Bacteria 1235
124 Ga0070681_10009008 3300005458 Bacteria 9810
125 Ga0070681_10020592 3300005458 Bacteria 6610
126 Ga0070681_10029069 3300005458 Bacteria 5549
127 Ga0070681_10577783 3300005458 Bacteria 1038
128 Ga0068867_100047151 3300005459 Bacteria 3167
129 Ga0068867_101153755 3300005459 Bacteria 710
130 Ga0070685_10075464 3300005466 Bacteria 2009
131 Ga0070685_10740491 3300005466 Bacteria 720
132 Ga0070698_100152883 3300005471 Bacteria 2254
133 Ga0070699_100051453 3300005518 Bacteria 3566
134 Ga0070679_100013970 3300005530 Bacteria 7696
135 Ga0070679_100051260 3300005530 Bacteria 4110
136 Ga0070679_100069459 3300005530 Bacteria 3513
137 Ga0070679_100216670 3300005530 Bacteria 1877
138 Ga0070679_100293284 3300005530 Bacteria 1578
139 Ga0070679_100743704 3300005530 Bacteria 923
140 Ga0070679_100876830 3300005530 Bacteria 841
141 Ga0070684_100008399 3300005535 Bacteria 8067
142 Ga0070684_100167686 3300005535 Bacteria 1994
143 Ga0070684_101236178 3300005535 Bacteria 703
144 Ga0068853_100083711 3300005539 Bacteria 2795
145 Ga0068853_100304238 3300005539 Bacteria 1474
146 Ga0068853_100699513 3300005539 Bacteria 967
147 Ga0068853_101209706 3300005539 Bacteria 729
148 Ga0068853_101684408 3300005539 Bacteria 615
149 Ga0070672_100012165 3300005543 Bacteria 6029
150 Ga0070672_100059526 3300005543 Bacteria 3005
151 Ga0070672_100141674 3300005543 Bacteria 1983
152 Ga0070672_100816723 3300005543 Bacteria 821
153 Ga0070672_101297178 3300005543 Unclassified 650
154 Ga0070686_100045395 3300005544 Bacteria 2767
155 Ga0070686_100718183 3300005544 Bacteria 798
156 Ga0070696_100770705 3300005546 Bacteria 790
157 Ga0070693_100110410 3300005547 Bacteria 1691
158 Ga0070693_100127685 3300005547 Bacteria 1585
159 Ga0070665_100002836 3300005548 Bacteria 18755
160 Ga0070665_100020991 3300005548 Bacteria 6566
161 Ga0070665_100090862 3300005548 Bacteria 3059
162 Ga0070665_100361634 3300005548 Bacteria 1457
163 Ga0070665_100394107 3300005548 Bacteria 1392
164 Ga0070665_100414850 3300005548 Bacteria 1355
165 Ga0070665_100954742 3300005548 Bacteria 870
166 Ga0070665_101004452 3300005548 Bacteria 846
167 Ga0070665_102292314 3300005548 Bacteria 543
168 Ga0070704_101806829 3300005549 Bacteria 566
169 Ga0068855_100048966 3300005563 Bacteria 4986
170 Ga0068855_100118628 3300005563 Bacteria 3030
171 Ga0068855_100382227 3300005563 Bacteria 1546
172 Ga0068855_100424140 3300005563 Bacteria 1454
173 Ga0068855_100578959 3300005563 Bacteria 1213
174 Ga0068855_100885109 3300005563 Bacteria 944
175 Ga0068855_100953314 3300005563 Bacteria 904
176 Ga0068855_101221266 3300005563 Bacteria 781
177 Ga0068855_101249644 3300005563 Bacteria 770
178 Ga0070664_100055443 3300005564 Bacteria 3365
179 Ga0070664_100724271 3300005564 Bacteria 928
180 Ga0070664_101159151 3300005564 Bacteria 728
181 Ga0070664_101184430 3300005564 Bacteria 721
182 Ga0070664_101988826 3300005564 Bacteria 552
183 Ga0068857_100050231 3300005577 Bacteria 3700
184 Ga0068857_100076130 3300005577 Bacteria 2992
185 Ga0068857_100787166 3300005577 Bacteria 907
186 Ga0068857_100828220 3300005577 Bacteria 885
187 Ga0068857_101349550 3300005577 Bacteria 693
188 Ga0068854_100132186 3300005578 Bacteria 1907
189 Ga0068854_100181384 3300005578 Bacteria 1645
190 Ga0068854_100293190 3300005578 Bacteria 1313
191 Ga0068856_100115016 3300005614 Bacteria 2689
192 Ga0068856_100141100 3300005614 Bacteria 2416
193 Ga0068856_100604436 3300005614 Bacteria 1118
194 Ga0068856_100720495 3300005614 Bacteria 1018
195 Ga0068856_101739441 3300005614 Bacteria 636
196 Ga0070702_100012071 3300005615 Bacteria 4317
197 Ga0070702_100314450 3300005615 Bacteria 1089
198 Ga0068852_100009742 3300005616 Bacteria 7142
199 Ga0068852_100027366 3300005616 Bacteria 4647
200 Ga0068852_100197310 3300005616 Bacteria 1903
201 Ga0068852_100243561 3300005616 Bacteria 1720
202 Ga0068852_100801266 3300005616 Bacteria 956
203 Ga0068859_100068797 3300005617 Bacteria 3575
204 Ga0068859_100280933 3300005617 Bacteria 1757
205 Ga0068859_100760486 3300005617 Bacteria 1058
206 Ga0068859_100871492 3300005617 Bacteria 986
207 Ga0068859_100998106 3300005617 Bacteria 919
208 Ga0068859_101513048 3300005617 Bacteria 741
209 Ga0068864_100183815 3300005618 Bacteria 1913
210 Ga0068864_100377581 3300005618 Bacteria 1342
211 Ga0068864_100531768 3300005618 Bacteria 1134
212 Ga0068864_101432327 3300005618 Bacteria 693
213 Ga0068866_10067829 3300005718 Bacteria 1874
214 Ga0068866_10076509 3300005718 Bacteria 1785
215 Ga0068866_10112938 3300005718 Bacteria 1519
216 Ga0068866_10941699 3300005718 Bacteria 610
217 Ga0068866_10975709 3300005718 Bacteria 601
218 Ga0068861_100026582 3300005719 Bacteria 4209
219 Ga0068861_100121826 3300005719 Bacteria 2105
220 Ga0068861_100646204 3300005719 Bacteria 977
221 Ga0068861_100650641 3300005719 Bacteria 974
222 Ga0068870_10148608 3300005840 Bacteria 1378
223 Ga0068870_10237005 3300005840 Bacteria 1125
224 Ga0068870_10281989 3300005840 Bacteria 1042
225 Ga0068870_10326224 3300005840 Bacteria 977
226 Ga0068870_11111921 3300005840 Bacteria 569
227 Ga0068863_100178497 3300005841 Bacteria 2038
228 Ga0068863_100883288 3300005841 Bacteria 894
229 Ga0068858_100207125 3300005842 Bacteria 1855
230 Ga0068858_100523554 3300005842 Bacteria 1147
231 Ga0068858_100655991 3300005842 Bacteria 1020
232 Ga0068858_101090867 3300005842 Bacteria 784
233 Ga0068858_101203786 3300005842 Bacteria 745
234 Ga0068860_100184261 3300005843 Bacteria 2018
235 Ga0068860_100254850 3300005843 Bacteria 1709
236 Ga0068860_100721029 3300005843 Bacteria 1008
237 Ga0068860_100811235 3300005843 Bacteria 949
238 Ga0068862_100054909 3300005844 Bacteria 3411
239 Ga0068862_100401356 3300005844 Bacteria 1282
240 Ga0068862_100429423 3300005844 Bacteria 1241
241 Ga0081455_10005318 3300005937 Bacteria 14137
242 Ga0081455_10050771 3300005937 Bacteria 3563
243 Ga0081455_10221734 3300005937 Bacteria 1401
244 Ga0081540_1010304 3300005983 Bacteria 6341
245 Ga0081540_1017033 3300005983 Bacteria 4516
246 Ga0081540_1336585 3300005983 Bacteria 517
247 Ga0081539_10000008 3300005985 Bacteria 525071
248 Ga0081539_10033177 3300005985 Bacteria 3150
249 Ga0081539_10158269 3300005985 Bacteria 1082
250 Ga0075365_10006261 3300006038 Bacteria 6528
251 Ga0075365_10093449 3300006038 Bacteria 2052
252 Ga0075365_10161152 3300006038 Bacteria 1563
253 Ga0075365_10391589 3300006038 Bacteria 980
254 Ga0075365_10638562 3300006038 Bacteria 752
255 Ga0075368_10125154 3300006042 Bacteria 1066
256 Ga0075368_10155787 3300006042 Bacteria 955
257 Ga0075368_10418012 3300006042 Bacteria 591
258 Ga0075363_100017307 3300006048 Bacteria 3572
259 Ga0075363_100039953 3300006048 Bacteria 2472
260 Ga0075363_100337333 3300006048 Bacteria 879
261 Ga0075364_10014626 3300006051 Bacteria 4852
262 Ga0075364_10036555 3300006051 Bacteria 3175
263 Ga0075364_10047544 3300006051 Bacteria 2795
264 Ga0075364_10141493 3300006051 Bacteria 1618
265 Ga0075364_10716470 3300006051 Bacteria 683
266 Ga0070712_100537832 3300006175 Bacteria 983
267 Ga0070712_100759626 3300006175 Bacteria 830
268 Ga0075362_10042082 3300006177 Bacteria 2018
269 Ga0075362_10133856 3300006177 Bacteria 1181
270 Ga0075362_10202294 3300006177 Bacteria 967
271 Ga0075362_10230203 3300006177 Bacteria 907
272 Ga0075362_10551560 3300006177 Bacteria 593
273 Ga0075367_10297684 3300006178 Bacteria 1015
274 Ga0075367_10305623 3300006178 Bacteria 1001
275 Ga0075367_10528756 3300006178 Bacteria 749
276 Ga0075367_11029911 3300006178 Bacteria 526
277 Ga0075369_10058083 3300006186 Bacteria 1684
278 Ga0075369_10070652 3300006186 Bacteria 1536
279 Ga0075366_10001094 3300006195 Bacteria 13300
280 Ga0075366_10215725 3300006195 Bacteria 1169
281 Ga0075366_10270509 3300006195 Bacteria 1038
282 Ga0075366_10298268 3300006195 Bacteria 986
283 Ga0075366_10466057 3300006195 Bacteria 780
284 Ga0097621_100035743 3300006237 Bacteria 3971
285 Ga0097621_100055409 3300006237 Bacteria 3237
286 Ga0097621_100056750 3300006237 Bacteria 3200
287 Ga0097621_100232958 3300006237 Unclassified 1608
288 Ga0097621_100261967 3300006237 Bacteria 1517
289 Ga0097621_101122735 3300006237 Bacteria 739
290 Ga0097621_101189075 3300006237 Bacteria 718
291 Ga0075370_10121882 3300006353 Bacteria 1518
292 Ga0075370_10307095 3300006353 Bacteria 944
293 Ga0075370_10310308 3300006353 Bacteria 939
294 Ga0075370_10354444 3300006353 Bacteria 877
295 Ga0075370_10428933 3300006353 Bacteria 794
296 Ga0068871_100090290 3300006358 Bacteria 2551
297 Ga0068871_100315688 3300006358 Bacteria 1375
298 Ga0068871_100369057 3300006358 Bacteria 1273
299 Ga0068871_100438932 3300006358 Bacteria 1168
300 Ga0068871_100868243 3300006358 Bacteria 835
301 Ga0075428_100843747 3300006844 Bacteria 973
302 Ga0075428_102153653 3300006844 Bacteria 576
303 Ga0075431_100991661 3300006847 Bacteria 807
304 Ga0075434_100304337 3300006871 Bacteria 1614
305 Ga0075434_100890683 3300006871 Bacteria 905
306 Ga0075429_100660807 3300006880 Bacteria 916
307 Ga0068865_100029057 3300006881 Bacteria 3664
308 Ga0068865_100096067 3300006881 Bacteria 2160
309 Ga0068865_100166160 3300006881 Bacteria 1687
310 Ga0068865_100889627 3300006881 Bacteria 774
311 Ga0068865_101396759 3300006881 Bacteria 625
312 Ga0075436_100119212 3300006914 Bacteria 1845
313 Ga0097620_100068794 3300006931 Bacteria 3575
314 Ga0097620_100280945 3300006931 Bacteria 1757
315 Ga0097620_100760482 3300006931 Bacteria 1058
316 Ga0097620_100871523 3300006931 Bacteria 986
317 Ga0097620_100998217 3300006931 Bacteria 919
318 Ga0097620_101512944 3300006931 Bacteria 741
319 Ga0099825_1018382 3300006941 Bacteria 5461
320 Ga0099824_1026579 3300006942 Bacteria 2956
321 Ga0099823_1033130 3300006944 Bacteria 4164
322 Ga0075435_100114100 3300007076 Bacteria 2249
323 Ga0075435_100155415 3300007076 Bacteria 1924
324 Ga0099795_10065487 3300007788 Bacteria 1359
325 Ga0105250_10045585 3300009092 Bacteria 1758
326 Ga0105240_10013828 3300009093 Bacteria 11055
327 Ga0105240_10027519 3300009093 Bacteria 7441
328 Ga0105240_10044366 3300009093 Bacteria 5650
329 Ga0105240_10138125 3300009093 Bacteria 2916
330 Ga0105240_10262166 3300009093 Bacteria 1993
331 Ga0105240_10440058 3300009093 Bacteria 1461
332 Ga0105240_12380091 3300009093 Bacteria 548
333 Ga0111539_10188422 3300009094 Bacteria 2408
334 Ga0111539_10659240 3300009094 Bacteria 1218
335 Ga0111539_11053311 3300009094 Bacteria 945
336 Ga0105245_10009595 3300009098 Bacteria 8440
337 Ga0105245_10050761 3300009098 Bacteria 3719
338 Ga0105245_10078640 3300009098 Bacteria 3010
339 Ga0105245_10522359 3300009098 Bacteria 1206
340 Ga0105245_10542236 3300009098 Bacteria 1184
341 Ga0105245_10607399 3300009098 Bacteria 1121
342 Ga0105247_10085968 3300009101 Bacteria 1990
343 Ga0105247_10181627 3300009101 Bacteria 1404
344 Ga0105247_10181866 3300009101 Bacteria 1403
345 Ga0105247_10192544 3300009101 Bacteria 1366
346 Ga0105247_10202702 3300009101 Bacteria 1334
347 Ga0105247_10240311 3300009101 Bacteria 1234
348 Ga0105247_10282214 3300009101 Bacteria 1146
349 Ga0105247_10382440 3300009101 Bacteria 998
350 Ga0105247_10602714 3300009101 Bacteria 815
351 Ga0114129_10945285 3300009147 Bacteria 1089
352 Ga0114129_11426653 3300009147 Bacteria 853
353 Ga0105243_10115754 3300009148 Bacteria 2252
354 Ga0105243_10480224 3300009148 Bacteria 1173
355 Ga0105243_10545240 3300009148 Bacteria 1107
356 Ga0105243_11234157 3300009148 Bacteria 762
357 Ga0105243_11286594 3300009148 Bacteria 748
358 Ga0105243_12080973 3300009148 Bacteria 603
359 Ga0105241_10018533 3300009174 Bacteria 5120
360 Ga0105241_10030488 3300009174 Bacteria 4031
361 Ga0105241_10044097 3300009174 Bacteria 3379
362 Ga0105241_10077496 3300009174 Bacteria 2595
363 Ga0105241_11839943 3300009174 Bacteria 592
364 Ga0105241_11869337 3300009174 Unclassified 588
365 Ga0105242_10031555 3300009176 Bacteria 4233
366 Ga0105242_10232529 3300009176 Bacteria 1653
367 Ga0105242_10236710 3300009176 Bacteria 1639
368 Ga0105242_10343904 3300009176 Bacteria 1375
369 Ga0105242_10522963 3300009176 Bacteria 1132
370 Ga0105248_10031653 3300009177 Bacteria 5910
371 Ga0105248_10260831 3300009177 Bacteria 1951
372 Ga0105248_10308481 3300009177 Bacteria 1782
373 Ga0105248_10385201 3300009177 Bacteria 1579
374 Ga0105248_10683491 3300009177 Bacteria 1158
375 Ga0105248_10755529 3300009177 Bacteria 1097
376 Ga0105248_10805331 3300009177 Bacteria 1060
377 Ga0105248_10833276 3300009177 Bacteria 1041
378 Ga0105248_11274679 3300009177 Bacteria 831
379 Ga0105237_10003348 3300009545 Bacteria 19080
380 Ga0105237_10091843 3300009545 Bacteria 3026
381 Ga0105237_10097904 3300009545 Bacteria 2924
382 Ga0105237_10202631 3300009545 Bacteria 1985
383 Ga0105237_10359153 3300009545 Bacteria 1461
384 Ga0105237_10487553 3300009545 Bacteria 1239
385 Ga0105237_10774716 3300009545 Bacteria 966
386 Ga0105237_10898197 3300009545 Bacteria 893
387 Ga0105237_10906613 3300009545 Bacteria 888
388 Ga0105237_11226549 3300009545 Bacteria 756
389 Ga0105238_10079817 3300009551 Bacteria 3262
390 Ga0105238_10484653 3300009551 Bacteria 1236
391 Ga0105238_10561912 3300009551 Bacteria 1146
392 Ga0105238_10831399 3300009551 Bacteria 940
393 Ga0105249_10302860 3300009553 Bacteria 1604
394 Ga0105249_10440733 3300009553 Bacteria 1340
395 Ga0105249_10898227 3300009553 Bacteria 953
396 Ga0105249_11771734 3300009553 Bacteria 690
397 Ga0105239_10018332 3300010375 Bacteria 7738
398 Ga0105239_10104301 3300010375 Bacteria 3139
399 Ga0105239_10131922 3300010375 Bacteria 2780
400 Ga0105239_10149301 3300010375 Bacteria 2608
401 Ga0105239_10295644 3300010375 Bacteria 1823
402 Ga0105239_10511702 3300010375 Bacteria 1365
403 Ga0105239_10530521 3300010375 Bacteria 1340
404 Ga0105239_10532014 3300010375 Bacteria 1338
405 Ga0105239_10840982 3300010375 Bacteria 1052
406 Ga0105239_10952383 3300010375 Bacteria 986
407 Ga0105239_10973716 3300010375 Bacteria 975
408 Ga0105239_11279412 3300010375 Bacteria 846
409 Ga0105239_11965021 3300010375 Bacteria 679
410 Ga0105246_10038063 3300011119 Bacteria 3231
411 Ga0105246_10088764 3300011119 Bacteria 2222
412 Ga0105246_10115570 3300011119 Bacteria 1979
413 Ga0105246_10136061 3300011119 Bacteria 1842
414 Ga0105246_10579784 3300011119 Bacteria 966
415 Ga0105246_10761716 3300011119 Bacteria 855
416 Ga0105246_10818123 3300011119 Bacteria 828
417 Ga0105246_12280998 3300011119 Bacteria 528
418 Ga0157345_1006877 3300012498 Bacteria 916
419 Ga0157313_1011018 3300012503 Bacteria 778
420 Ga0157373_10458265 3300013100 Bacteria 918
421 Ga0157373_10515056 3300013100 Bacteria 865
422 Ga0157371_10201583 3300013102 Bacteria 1426
423 Ga0157371_10390220 3300013102 Bacteria 1017
424 Ga0157370_10200281 3300013104 Bacteria 1852
425 Ga0157370_10700278 3300013104 Bacteria 925
426 Ga0157370_10718813 3300013104 Bacteria 911
427 Ga0157369_10006967 3300013105 Bacteria 13032
428 Ga0157369_10029245 3300013105 Bacteria 6090
429 Ga0157369_10231572 3300013105 Bacteria 1931
430 Ga0157369_10252747 3300013105 Bacteria 1839
431 Ga0157374_10024124 3300013296 Bacteria 5449
432 Ga0157374_10068209 3300013296 Unclassified 3346
433 Ga0157374_10296880 3300013296 Bacteria 1598
434 Ga0157374_10432369 3300013296 Bacteria 1316
435 Ga0157374_11052100 3300013296 Bacteria 834
436 Ga0157374_11095515 3300013296 Bacteria 817
437 Ga0157374_11262369 3300013296 Bacteria 760
438 Ga0157374_11594968 3300013296 Bacteria 677
439 Ga0157374_11623872 3300013296 Bacteria 671
440 Ga0157378_10154622 3300013297 Bacteria 2139
441 Ga0157378_10232677 3300013297 Bacteria 1757
442 Ga0157378_10249166 3300013297 Bacteria 1700
443 Ga0157378_10255428 3300013297 Bacteria 1679
444 Ga0157378_10257551 3300013297 Bacteria 1673
445 Ga0163162_10059973 3300013306 Bacteria 3838
446 Ga0163162_10428584 3300013306 Bacteria 1455
447 Ga0163162_10608268 3300013306 Bacteria 1219
448 Ga0163162_10644818 3300013306 Bacteria 1183
449 Ga0163162_10731650 3300013306 Bacteria 1109
450 Ga0163162_10735665 3300013306 Bacteria 1106
451 Ga0163162_10849319 3300013306 Bacteria 1028
452 Ga0163162_11144359 3300013306 Bacteria 882
453 Ga0163162_11157027 3300013306 Bacteria 877
454 Ga0157372_10038207 3300013307 Bacteria 5298
455 Ga0157372_10410606 3300013307 Bacteria 1578
456 Ga0157372_10549398 3300013307 Bacteria 1346
457 Ga0157372_10756343 3300013307 Bacteria 1130
458 Ga0157372_10877840 3300013307 Bacteria 1041
459 Ga0157375_10010993 3300013308 Bacteria 7983
460 Ga0157375_10101270 3300013308 Bacteria 2963
461 Ga0157375_10598315 3300013308 Bacteria 1262
462 Ga0157375_10672554 3300013308 Bacteria 1190
463 Ga0157375_10745630 3300013308 Bacteria 1131
464 Ga0157375_11334070 3300013308 Bacteria 844
465 Ga0163163_10006916 3300014325 Bacteria 9958
466 Ga0163163_10062028 3300014325 Bacteria 3704
467 Ga0163163_10341962 3300014325 Bacteria 1552
468 Ga0163163_10536097 3300014325 Bacteria 1233
469 Ga0163163_10652628 3300014325 Bacteria 1116
470 Ga0163163_11007505 3300014325 Bacteria 896
471 Ga0163163_11908193 3300014325 Bacteria 654
472 Ga0163163_12815287 3300014325 Bacteria 543
473 Ga0157380_10100918 3300014326 Bacteria 2404
474 Ga0157380_11033756 3300014326 Bacteria 857
475 Ga0157380_11561973 3300014326 Bacteria 714
476 Ga0182008_10663247 3300014497 Bacteria 592
477 Ga0157377_10026554 3300014745 Bacteria 3100
478 Ga0157377_10338862 3300014745 Bacteria 1005
479 Ga0157379_10296259 3300014968 Bacteria 1474
480 Ga0157379_10340773 3300014968 Bacteria 1371
481 Ga0157379_10388144 3300014968 Bacteria 1282
482 Ga0157379_10714271 3300014968 Bacteria 941
483 Ga0157376_10008762 3300014969 Bacteria 7315
484 Ga0157376_10012225 3300014969 Bacteria 6364
485 Ga0157376_10049941 3300014969 Bacteria 3467
486 Ga0157376_10269468 3300014969 Bacteria 1599
487 Ga0157376_11093359 3300014969 Bacteria 823
488 Ga0157376_11780286 3300014969 Bacteria 652
489 Ga0182007_10252909 3300015262 Bacteria 633
490 Ga0163161_10155939 3300017792 Bacteria 1738
491 Ga0163161_10160410 3300017792 Bacteria 1714
492 Ga0163161_10194624 3300017792 Bacteria 1560
493 Ga0163161_10756901 3300017792 Bacteria 813
494 Ga0163161_10788628 3300017792 Bacteria 797
495 Ga0163161_11800366 3300017792 Bacteria 544
496 Ga0197907_10464309 3300020069 Bacteria 555
497 Ga0197907_10526031 3300020069 Bacteria 1464
498 Ga0197907_10831135 3300020069 Bacteria 596
499 Ga0206356_10656885 3300020070 Bacteria 1285
500 Ga0206356_11377276 3300020070 Bacteria 723
501 Ga0206356_11842844 3300020070 Bacteria 737
502 Ga0206351_10675134 3300020077 Bacteria 512
503 Ga0206352_10265531 3300020078 Bacteria 658
504 Ga0206352_10786040 3300020078 Bacteria 543
505 Ga0206350_10535223 3300020080 Bacteria 678
506 Ga0206353_10765933 3300020082 Bacteria 549
507 Ga0206353_10960214 3300020082 Bacteria 716
508 Ga0213874_10029949 3300021377 Bacteria 1565
509 Ga0213876_10013409 3300021384 Bacteria 4354
510 Ga0213876_10025379 3300021384 Bacteria 3127
511 Ga0224712_10641122 3300022467 Bacteria 520
512 Ga0209563_110550 3300025230 Bacteria 1341
513 Ga0209677_102452 3300025253 Bacteria 6965
514 Ga0209148_1002608 3300025254 Bacteria 5894
515 Ga0209233_1001880 3300025261 Bacteria 8058
516 Ga0209233_1010217 3300025261 Bacteria 2823
517 Ga0209455_1000714 3300025272 Bacteria 19245
518 Ga0209673_1027816 3300025273 Bacteria 1832
519 Ga0209564_1004469 3300025295 Bacteria 8541
520 Ga0209564_1013773 3300025295 Bacteria 3408
521 Ga0209564_1013929 3300025295 Bacteria 3378
522 Ga0209758_1000141 3300025297 Bacteria 172481
523 Ga0209758_1002921 3300025297 Bacteria 16464
524 Ga0209758_1003483 3300025297 Bacteria 14255
525 Ga0209758_1004079 3300025297 Bacteria 12557
526 Ga0209758_1020105 3300025297 Bacteria 3179
527 Ga0209758_1082898 3300025297 Bacteria 963
528 Ga0209758_1129680 3300025297 Bacteria 668
529 Ga0209256_1002956 3300025299 Bacteria 12733
530 Ga0207426_1000437 3300025302 Bacteria 67439
531 Ga0207426_1001139 3300025302 Bacteria 24022
532 Ga0207426_1008512 3300025302 Bacteria 4128
533 Ga0207426_1014295 3300025302 Bacteria 2911
534 Ga0207426_1027953 3300025302 Bacteria 1873
535 Ga0209051_1022867 3300025303 Bacteria 2617
536 Ga0209257_1006467 3300025304 Bacteria 7527
537 Ga0209257_1041881 3300025304 Bacteria 1355
538 Ga0207697_10090616 3300025315 Bacteria 1296
539 Ga0207697_10161404 3300025315 Bacteria 978
540 Ga0207697_10349939 3300025315 Bacteria 656
541 Ga0207696_1163742 3300025711 Bacteria 591
542 Ga0207682_10003043 3300025893 Bacteria 7362
543 Ga0207692_10612950 3300025898 Bacteria 701
544 Ga0207642_10012062 3300025899 Bacteria 3108
545 Ga0207642_10209809 3300025899 Bacteria 1081
546 Ga0207710_10213592 3300025900 Bacteria 956
547 Ga0207710_10265723 3300025900 Bacteria 861
548 Ga0207710_10309245 3300025900 Bacteria 800
549 Ga0207710_10314634 3300025900 Bacteria 793
550 Ga0207688_10020261 3300025901 Bacteria 3630
551 Ga0207688_10021578 3300025901 Bacteria 3520
552 Ga0207688_10025537 3300025901 Bacteria 3245
553 Ga0207688_10211763 3300025901 Bacteria 1165
554 Ga0207680_10085545 3300025903 Bacteria 1992
555 Ga0207680_10265851 3300025903 Bacteria 1188
556 Ga0207680_10850649 3300025903 Bacteria 654
557 Ga0207647_10044022 3300025904 Bacteria 2791
558 Ga0207647_10097140 3300025904 Bacteria 1752
559 Ga0207647_10218637 3300025904 Bacteria 1098
560 Ga0207645_10019706 3300025907 Bacteria 4421
561 Ga0207645_10057779 3300025907 Bacteria 2477
562 Ga0207645_10091167 3300025907 Bacteria 1960
563 Ga0207645_10172579 3300025907 Bacteria 1418
564 Ga0207645_10269356 3300025907 Bacteria 1129
565 Ga0207645_10290778 3300025907 Bacteria 1087
566 Ga0207645_10473006 3300025907 Bacteria 847
567 Ga0207643_10626496 3300025908 Bacteria 693
568 Ga0207705_10259019 3300025909 Bacteria 1328
569 Ga0207705_10373921 3300025909 Bacteria 1100
570 Ga0207654_10039611 3300025911 Bacteria 2651
571 Ga0207654_10045872 3300025911 Bacteria 2490
572 Ga0207654_10149230 3300025911 Bacteria 1499
573 Ga0207707_10000754 3300025912 Bacteria 31878
574 Ga0207707_10191557 3300025912 Bacteria 1784
575 Ga0207707_10219014 3300025912 Bacteria 1657
576 Ga0207707_10530243 3300025912 Bacteria 1002
577 Ga0207695_10000062 3300025913 Bacteria 351979
578 Ga0207695_10050638 3300025913 Bacteria 4367
579 Ga0207671_10001897 3300025914 Bacteria 23245
580 Ga0207671_10051511 3300025914 Bacteria 3051
581 Ga0207671_10060968 3300025914 Bacteria 2799
582 Ga0207693_10159079 3300025915 Bacteria 1777
583 Ga0207693_10591358 3300025915 Bacteria 864
584 Ga0207693_11166919 3300025915 Bacteria 582
585 Ga0207663_10705132 3300025916 Bacteria 799
586 Ga0207663_10922191 3300025916 Bacteria 699
587 Ga0207660_10043144 3300025917 Bacteria 3168
588 Ga0207660_10048371 3300025917 Bacteria 3009
589 Ga0207660_10163794 3300025917 Bacteria 1718
590 Ga0207662_10135318 3300025918 Bacteria 1557
591 Ga0207662_10627391 3300025918 Bacteria 749
592 Ga0207662_10734437 3300025918 Bacteria 693
593 Ga0207657_10003905 3300025919 Bacteria 15817
594 Ga0207657_10258482 3300025919 Bacteria 1386
595 Ga0207657_10357412 3300025919 Bacteria 1151
596 Ga0207657_11210963 3300025919 Bacteria 574
597 Ga0207649_10072579 3300025920 Bacteria 2202
598 Ga0207649_10121305 3300025920 Bacteria 1763
599 Ga0207652_10005840 3300025921 Bacteria 9970
600 Ga0207652_10029294 3300025921 Bacteria 4602
601 Ga0207652_10193719 3300025921 Bacteria 1828
602 Ga0207652_10333981 3300025921 Bacteria 1368
603 Ga0207652_10558527 3300025921 Bacteria 1028
604 Ga0207652_11396455 3300025921 Bacteria 604
605 Ga0207646_11222457 3300025922 Bacteria 658
606 Ga0207681_10239480 3300025923 Bacteria 1412
607 Ga0207681_10391042 3300025923 Bacteria 1121
608 Ga0207681_10570152 3300025923 Bacteria 933
609 Ga0207681_10920387 3300025923 Bacteria 732
610 Ga0207694_10273712 3300025924 Bacteria 1385
611 Ga0207694_10350128 3300025924 Bacteria 1222
612 Ga0207694_11004218 3300025924 Bacteria 706
613 Ga0207694_11438027 3300025924 Bacteria 582
614 Ga0207650_10195427 3300025925 Bacteria 1618
615 Ga0207650_10701976 3300025925 Bacteria 855
616 Ga0207650_10744973 3300025925 Bacteria 829
617 Ga0207659_10070799 3300025926 Bacteria 2544
618 Ga0207659_10329702 3300025926 Bacteria 1261
619 Ga0207659_10350653 3300025926 Bacteria 1224
620 Ga0207659_10611148 3300025926 Bacteria 930
621 Ga0207659_10616588 3300025926 Bacteria 926
622 Ga0207659_10941915 3300025926 Bacteria 743
623 Ga0207687_10010386 3300025927 Bacteria 6084
624 Ga0207687_10021894 3300025927 Bacteria 4249
625 Ga0207687_10151887 3300025927 Bacteria 1768
626 Ga0207687_10322087 3300025927 Bacteria 1252
627 Ga0207687_10330403 3300025927 Bacteria 1236
628 Ga0207687_11412429 3300025927 Bacteria 598
629 Ga0207700_10447055 3300025928 Bacteria 1139
630 Ga0207664_10582856 3300025929 Bacteria 1004
631 Ga0207664_11406083 3300025929 Bacteria 618
632 Ga0207644_10051283 3300025931 Bacteria 2961
633 Ga0207644_10089423 3300025931 Bacteria 2292
634 Ga0207644_10292458 3300025931 Bacteria 1310
635 Ga0207644_10373385 3300025931 Bacteria 1162
636 Ga0207644_10409760 3300025931 Bacteria 1109
637 Ga0207644_10607914 3300025931 Bacteria 908
638 Ga0207644_11153061 3300025931 Bacteria 651
639 Ga0207690_10225060 3300025932 Bacteria 1437
640 Ga0207690_10464249 3300025932 Bacteria 1019
641 Ga0207690_10648931 3300025932 Bacteria 865
642 Ga0207690_10984603 3300025932 Bacteria 701
643 Ga0207690_11016117 3300025932 Bacteria 690
644 Ga0207690_11113027 3300025932 Bacteria 658
645 Ga0207706_10034566 3300025933 Bacteria 4496
646 Ga0207706_10177295 3300025933 Bacteria 1872
647 Ga0207706_10255486 3300025933 Bacteria 1530
648 Ga0207706_11191986 3300025933 Bacteria 633
649 Ga0207686_10070784 3300025934 Bacteria 2242
650 Ga0207686_10339537 3300025934 Bacteria 1128
651 Ga0207686_10379580 3300025934 Bacteria 1071
652 Ga0207709_10075840 3300025935 Bacteria 2151
653 Ga0207709_10456047 3300025935 Bacteria 989
654 Ga0207709_10552107 3300025935 Bacteria 906
655 Ga0207709_10815073 3300025935 Bacteria 754
656 Ga0207709_10877478 3300025935 Bacteria 728
657 Ga0207670_10796620 3300025936 Bacteria 787
658 Ga0207669_10006478 3300025937 Bacteria 5354
659 Ga0207669_10028974 3300025937 Bacteria 3055
660 Ga0207669_10110785 3300025937 Unclassified 1839
661 Ga0207669_10251934 3300025937 Bacteria 1315
662 Ga0207704_10390159 3300025938 Bacteria 1096
663 Ga0207704_10943309 3300025938 Bacteria 727
664 Ga0207665_10203125 3300025939 Bacteria 1445
665 Ga0207691_10005845 3300025940 Bacteria 11900
666 Ga0207691_10093331 3300025940 Bacteria 2695
667 Ga0207691_10156366 3300025940 Bacteria 2002
668 Ga0207691_10390768 3300025940 Bacteria 1187
669 Ga0207691_10634759 3300025940 Unclassified 903
670 Ga0207691_10756413 3300025940 Bacteria 818
671 Ga0207691_11593870 3300025940 Bacteria 531
672 Ga0207711_10050250 3300025941 Bacteria 3569
673 Ga0207711_10184988 3300025941 Bacteria 1896
674 Ga0207711_10441642 3300025941 Bacteria 1211
675 Ga0207711_10442707 3300025941 Bacteria 1209
676 Ga0207711_10614434 3300025941 Bacteria 1014
677 Ga0207689_10048255 3300025942 Bacteria 3512
678 Ga0207689_10281584 3300025942 Bacteria 1377
679 Ga0207689_10426439 3300025942 Bacteria 1107
680 Ga0207661_10003055 3300025944 Bacteria 11584
681 Ga0207661_11351331 3300025944 Bacteria 654
682 Ga0207679_10140634 3300025945 Bacteria 1950
683 Ga0207679_10324455 3300025945 Bacteria 1334
684 Ga0207679_10525044 3300025945 Bacteria 1059
685 Ga0207667_10037813 3300025949 Bacteria 5159
686 Ga0207667_10082010 3300025949 Bacteria 3341
687 Ga0207667_10439076 3300025949 Bacteria 1327
688 Ga0207651_10320090 3300025960 Bacteria 1296
689 Ga0207651_10360164 3300025960 Bacteria 1227
690 Ga0207651_10488967 3300025960 Bacteria 1062
691 Ga0207712_10271398 3300025961 Bacteria 1380
692 Ga0207712_10656339 3300025961 Bacteria 912
693 Ga0207712_10675421 3300025961 Bacteria 900
694 Ga0207712_11087175 3300025961 Bacteria 712
695 Ga0207668_10035749 3300025972 Bacteria 3310
696 Ga0207668_10279303 3300025972 Bacteria 1369
697 Ga0207668_10313641 3300025972 Bacteria 1299
698 Ga0207668_10627425 3300025972 Bacteria 938
699 Ga0207668_10807630 3300025972 Bacteria 831
700 Ga0207668_11206295 3300025972 Bacteria 680
701 Ga0207640_10090881 3300025981 Bacteria 2114
702 Ga0207640_10337633 3300025981 Bacteria 1206
703 Ga0207640_10510928 3300025981 Bacteria 1002
704 Ga0207640_10903981 3300025981 Bacteria 771
705 Ga0207658_10030927 3300025986 Bacteria 3797
706 Ga0207658_10134571 3300025986 Bacteria 1991
707 Ga0207658_10196013 3300025986 Bacteria 1683
708 Ga0207658_10232830 3300025986 Bacteria 1556
709 Ga0207658_10699199 3300025986 Bacteria 916
710 Ga0207677_10010248 3300026023 Bacteria 5298
711 Ga0207677_10272560 3300026023 Bacteria 1385
712 Ga0207677_10322327 3300026023 Bacteria 1284
713 Ga0207677_11636900 3300026023 Bacteria 596
714 Ga0207703_10012005 3300026035 Bacteria 6746
715 Ga0207703_10045747 3300026035 Bacteria 3522
716 Ga0207703_10444883 3300026035 Bacteria 1209
717 Ga0207703_10633035 3300026035 Bacteria 1014
718 Ga0207703_10780517 3300026035 Bacteria 911
719 Ga0207639_10059133 3300026041 Bacteria 2951
720 Ga0207639_10149925 3300026041 Bacteria 1952
721 Ga0207639_10306699 3300026041 Bacteria 1405
722 Ga0207639_10981045 3300026041 Unclassified 791
723 Ga0207639_11449589 3300026041 Bacteria 644
724 Ga0207678_10005024 3300026067 Bacteria 11867
725 Ga0207678_10081977 3300026067 Bacteria 2760
726 Ga0207678_10162810 3300026067 Bacteria 1905
727 Ga0207678_10190588 3300026067 Bacteria 1752
728 Ga0207678_10220596 3300026067 Bacteria 1623
729 Ga0207678_10234728 3300026067 Bacteria 1570
730 Ga0207678_10245528 3300026067 Bacteria 1533
731 Ga0207678_10366915 3300026067 Bacteria 1243
732 Ga0207678_10372302 3300026067 Bacteria 1234
733 Ga0207678_10721338 3300026067 Bacteria 878
734 Ga0207708_10115299 3300026075 Bacteria 2089
735 Ga0207708_10170152 3300026075 Bacteria 1725
736 Ga0207702_10427084 3300026078 Bacteria 1282
737 Ga0207702_10805980 3300026078 Bacteria 928
738 Ga0207641_10202741 3300026088 Bacteria 1830
739 Ga0207641_11031056 3300026088 Bacteria 820
740 Ga0207648_10266420 3300026089 Bacteria 1530
741 Ga0207648_10589050 3300026089 Bacteria 1024
742 Ga0207676_10070319 3300026095 Bacteria 2806
743 Ga0207676_10108982 3300026095 Bacteria 2313
744 Ga0207676_10883904 3300026095 Bacteria 876
745 Ga0207676_10990238 3300026095 Bacteria 828
746 Ga0207674_10066105 3300026116 Bacteria 3643
747 Ga0207674_10070326 3300026116 Bacteria 3519
748 Ga0207674_10329357 3300026116 Bacteria 1477
749 Ga0207674_10419592 3300026116 Bacteria 1293
750 Ga0207674_10712038 3300026116 Bacteria 969
751 Ga0207674_10847657 3300026116 Bacteria 881
752 Ga0207674_11028151 3300026116 Bacteria 793
753 Ga0207675_100028089 3300026118 Bacteria 5238
754 Ga0207675_100034859 3300026118 Bacteria 4693
755 Ga0207675_100091356 3300026118 Bacteria 2863
756 Ga0207675_100827403 3300026118 Bacteria 940
757 Ga0207683_10003145 3300026121 Bacteria 14423
758 Ga0207683_10016895 3300026121 Bacteria 6209
759 Ga0207683_10065573 3300026121 Bacteria 3202
760 Ga0207683_10100910 3300026121 Bacteria 2577
761 Ga0207683_10123996 3300026121 Bacteria 2321
762 Ga0207683_10236280 3300026121 Bacteria 1667
763 Ga0207683_10316422 3300026121 Bacteria 1429
764 Ga0207683_10316838 3300026121 Unclassified 1428
765 Ga0207683_10539136 3300026121 Bacteria 1079
766 Ga0207683_12084583 3300026121 Bacteria 515
767 Ga0207698_10054121 3300026142 Bacteria 3086
768 Ga0207698_10237666 3300026142 Bacteria 1658
769 Ga0207698_10595012 3300026142 Bacteria 1090
770 Ga0207698_11205121 3300026142 Bacteria 771
771 Ga0209389_1000004 3300027296 Bacteria 263759
772 Ga0209389_1000023 3300027296 Bacteria 150730
773 Ga0209589_1000010 3300027357 Bacteria 237657
774 Ga0209489_100011 3300027361 Bacteria 244710
775 Ga0209489_100777 3300027361 Bacteria 63061
776 Ga0209700_100013 3300027363 Bacteria 341906
777 Ga0209813_10439730 3300027866 Bacteria 532
778 Ga0207428_10353908 3300027907 Bacteria 1080
779 Ga0268266_10009595 3300028379 Bacteria 8511
780 Ga0268266_10012387 3300028379 Bacteria 7371
781 Ga0268266_10027174 3300028379 Bacteria 4868
782 Ga0268266_10029034 3300028379 Bacteria 4700
783 Ga0268266_10060413 3300028379 Bacteria 3268
784 Ga0268266_10101020 3300028379 Bacteria 2542
785 Ga0268266_10244955 3300028379 Bacteria 1656
786 Ga0268266_10445290 3300028379 Bacteria 1230
787 Ga0268266_10900505 3300028379 Bacteria 855
788 Ga0268265_10175616 3300028380 Bacteria 1835
789 Ga0268265_11453198 3300028380 Bacteria 688
790 Ga0268264_10070546 3300028381 Bacteria 2958
791 Ga0268264_10096546 3300028381 Bacteria 2560
792 Ga0268264_10288185 3300028381 Bacteria 1541
793 Ga0268264_10340486 3300028381 Bacteria 1424
794 Ga0268264_10937683 3300028381 Bacteria 870
795 Ga0265334_10074909 3300028573 Bacteria 1255
796 Ga0265334_10219126 3300028573 Bacteria 658
797 Ga0265318_10077310 3300028577 Bacteria 1230
798 Ga0265318_10114355 3300028577 Bacteria 992
799 Ga0307517_10315997 3300028786 Bacteria 867
800 Ga0307517_10337442 3300028786 Bacteria 825
801 Ga0307517_10425343 3300028786 Bacteria 695
802 Ga0307515_10000138 3300028794 Bacteria 173220
803 Ga0307515_10264895 3300028794 Bacteria 1449
804 Ga0265338_10949659 3300028800 Bacteria 584
805 Ga0307511_10279278 3300030521 Bacteria 774
806 Ga0307512_10014863 3300030522 Bacteria 7239
807 Ga0265330_10018939 3300031235 Bacteria 3159
808 Ga0265330_10064203 3300031235 Bacteria 1595
809 Ga0265330_10112575 3300031235 Bacteria 1161
810 Ga0265332_10025346 3300031238 Bacteria 2605
811 Ga0265320_10052783 3300031240 Bacteria 1966
812 Ga0265320_10141408 3300031240 Bacteria 1090
813 Ga0265340_10014105 3300031247 Bacteria 4183
814 Ga0265340_10045752 3300031247 Bacteria 2136
815 Ga0265340_10155304 3300031247 Bacteria 1041
816 Ga0265339_10067321 3300031249 Bacteria 1916
817 Ga0265339_10208319 3300031249 Bacteria 961
818 Ga0265331_10013745 3300031250 Bacteria 4340
819 Ga0265327_10041483 3300031251 Bacteria 2480
820 Ga0265316_10114448 3300031344 Bacteria 2040
821 Ga0307513_10107304 3300031456 Bacteria 2796
822 Ga0307513_10108360 3300031456 Bacteria 2779
823 Ga0307513_10841998 3300031456 Bacteria 624
824 Ga0307513_10999689 3300031456 Bacteria 546
825 Ga0307509_10466932 3300031507 Bacteria 953
826 Ga0307408_100474506 3300031548 Bacteria 1090
827 Ga0307408_100834826 3300031548 Bacteria 839
828 Ga0265313_10007286 3300031595 Bacteria 7594
829 Ga0307508_10218752 3300031616 Bacteria 1505
830 Ga0307508_10463055 3300031616 Bacteria 861
831 Ga0307508_10779389 3300031616 Bacteria 571
832 Ga0265314_10002834 3300031711 Bacteria 17262
833 Ga0265314_10069141 3300031711 Bacteria 2371
834 Ga0265314_10085887 3300031711 Bacteria 2062
835 Ga0265342_10029554 3300031712 Bacteria 3402
836 Ga0265342_10388722 3300031712 Bacteria 722
837 Ga0307516_10090518 3300031730 Bacteria 2888
838 Ga0307413_10056827 3300031824 Bacteria 2389
839 Ga0307413_10336378 3300031824 Bacteria 1159
840 Ga0307410_10366741 3300031852 Bacteria 1155
841 Ga0307410_10453456 3300031852 Bacteria 1047
842 Ga0307407_10130185 3300031903 Bacteria 1609
843 Ga0307407_11064949 3300031903 Bacteria 627
844 Ga0307412_11102560 3300031911 Bacteria 706
845 Ga0307409_100936430 3300031995 Bacteria 881
846 Ga0307416_100377265 3300032002 Bacteria 1447
847 Ga0307416_101033131 3300032002 Bacteria 925
848 Ga0307411_10122442 3300032005 Bacteria 1885
849 Ga0307411_10404440 3300032005 Bacteria 1129
850 Ga0307507_10400362 3300033179 Bacteria 781
851 Ga0307510_10027691 3300033180 Bacteria 6487
852 Ga0307510_10050413 3300033180 Bacteria 4416
853 Ga0307510_10071369 3300033180 Bacteria 3458
854 Ga0307510_10166074 3300033180 Bacteria 1795
855 Ga0307510_10552723 3300033180 Bacteria 598
856 Ga0315911_1000010 3300033442 Bacteria 322197
857 Ga0373948_0149087 3300034817 Bacteria 583
858 Ga0373948_0210465 3300034817 Bacteria 511
859 Ga0373926_0135979 3300035083 Bacteria 932
860 Ga0373934_0018297 3300035086 Bacteria 2680
861 Ga0373944_0014723 3300035089 Bacteria 2187
862 Ga0373923_0000955 3300035111 Bacteria 7770
863 Ga0373923_0021274 3300035111 Bacteria 2530
864 Ga0373936_0069611 3300035113 Bacteria 1448
865 Ga0373945_0106673 3300035116 Bacteria 1102
866 Ga0373945_0369810 3300035116 Bacteria 624
867 Ga0373953_0000357 3300035117 Bacteria 12330
868 Ga0373954_0000156 3300035118 Bacteria 24327
869 Ga0373954_0019571 3300035118 Bacteria 3054
870 Ga0373956_0000252 3300035119 Bacteria 21307
871 Ga0373957_0000344 3300035120 Bacteria 11777
872 Ga0373943_0019168 3300035170 Bacteria 3146
873 Ga0373946_0009713 3300035171 Bacteria 3552
874 Ga0373946_0318842 3300035171 Bacteria 772
875 Ga0373955_0000229 3300035172 Bacteria 23386
876 Ga0373955_0110994 3300035172 Bacteria 1585
877 Ga0373924_0000488 3300035410 Bacteria 12126
878 Ga0373924_0013574 3300035410 Bacteria 3062
879 Ga0373931_0003537 3300035691 Bacteria 7043
880 Ga0373931_1050708 3300035691 Bacteria 553
881 Ga0373935_0727666 3300035692 Bacteria 730
882 Ga0373935_0833672 3300035692 Bacteria 681
883 Ga0373927_0340136 3300035695 Bacteria 988
884 Ga0373927_0431051 3300035695 Bacteria 870
885 Ga0373933_0000628 3300035724 Bacteria 22042
886 Ga0373933_0563627 3300035724 Bacteria 747
887 Ga0373947_0014655 3300035725 Bacteria 4496
888 Ga0373937_0001337 3300036401 Bacteria 20615
889 Ga0373937_0234160 3300036401 Bacteria 1730
890 Ga0373937_0266048 3300036401 Bacteria 1617
891 Ga0373925_0040808 3300037068 Bacteria 3437
892 Ga0373925_0137551 3300037068 Bacteria 1910
893 Ga0373925_0907524 3300037068 Bacteria 726
894 Ga0373925_0938093 3300037068 Bacteria 713
895 Ga0395899_0109507 3300037312 Bacteria 1987
896 Ga0395899_0315229 3300037312 Bacteria 1055
897 Ga0395900_0033149 3300037418 Bacteria 5315
898 Ga0395900_0360038 3300037418 Bacteria 1426
899 Ga0395898_0003786 3300037466 Bacteria 16735
900 Ga0395898_0015935 3300037466 Bacteria 7703
901 Ga0395898_0134436 3300037466 Bacteria 2368
902 Ga0395905_0048221 3300037471 Bacteria 3992
903 Ga0395905_0363338 3300037471 Bacteria 1340
904 Ga0395901_0059357 3300038443 Bacteria 3980
905 Ga0395901_0233871 3300038443 Bacteria 1918
906 Ga0395901_0553309 3300038443 Bacteria 1166
907 Ga0436365_0088538 3300039437 Bacteria 655
908 Ga0436365_0276774 3300039437 Bacteria 904
909 Ga0436365_0350765 3300039437 Bacteria 817
910 Ga0436365_0488039 3300039437 Bacteria 664
911 Ga0436365_0714504 3300039437 Bacteria 793
912 Ga0436365_1475101 3300039437 Bacteria 1349
913 Ga0436365_1782951 3300039437 Bacteria 2426
914 Ga0436360_0553077 3300039438 Bacteria 1151
915 Ga0436363_0227726 3300039450 Bacteria 2889
916 Ga0439465_0148926 3300041413 Bacteria 835
917 Ga0451791_0856061 3300041451 Bacteria 663
918 Ga0451795_0835100 3300041456 Bacteria 865
919 Ga0451798_0527849 3300041458 Bacteria 548
920 Ga0451800_1247451 3300041459 Bacteria 743
921 Ga0451807_0027761 3300041486 Bacteria 758
922 Ga0451833_0052533 3300041491 Bacteria 553
923 Ga0451833_1385877 3300041491 Bacteria 931
924 Ga0451835_0439563 3300041492 Bacteria 716
925 Ga0451847_0468734 3300041503 Bacteria 1297
926 Ga0451849_0164067 3300041505 Bacteria 946
927 Ga0451855_1457165 3300041511 Bacteria 506
928 Ga0451853_3206365 3300041512 Bacteria 845
929 Ga0439431_0121816 3300041997 Bacteria 728
930 Ga0439448_0287128 3300042005 Bacteria 583
931 Ga0439455_0133576 3300042012 Bacteria 701
932 Ga0439458_0058281 3300042157 Bacteria 961
933 Ga0439464_0143287 3300042439 Bacteria 745
934 Ga0466969_0049764 3300044656 Bacteria 2067
935 Ga0466972_0000998 3300044658 Bacteria 13595
936 Ga0466972_0304179 3300044658 Bacteria 745
937 Ga0466965_0071991 3300044683 Bacteria 1739
938 Ga0466966_0000551 3300044684 Bacteria 23873
939 Ga0466961_0000020 3300044693 Bacteria 107610
940 Ga0466961_0201182 3300044693 Bacteria 1232
941 Ga0466963_0127317 3300044694 Bacteria 1756
942 Ga0466964_0022484 3300044706 Bacteria 2447
943 Ga0466964_0045822 3300044706 Bacteria 1781
944 Ga0466968_0018330 3300044735 Bacteria 2807
945 Ga0466960_0018738 3300044901 Bacteria 3038
946 Ga0466960_0035273 3300044901 Bacteria 2336
947 Ga0466960_0157633 3300044901 Bacteria 1217
948 Ga0466960_0222530 3300044901 Bacteria 1039
949 Ga0466959_0135055 3300045049 Bacteria 1746
950 Ga0466958_0047710 3300045836 Bacteria 2586
951 Ga0466967_0049530 3300045976 Bacteria 3674
952 Ga0466967_0384955 3300045976 Bacteria 1362
953 Ga0466967_0863173 3300045976 Bacteria 899
954 Ga0495617_027271 3300046452 Bacteria 1922
955 Ga0495592_0003818 3300046454 Bacteria 10889
956 Ga0495592_0026973 3300046454 Bacteria 4355
957 Ga0495592_0078412 3300046454 Bacteria 2393
958 Ga0495592_0777290 3300046454 Bacteria 570
959 Ga0495603_0007836 3300046455 Bacteria 6439
960 Ga0495603_0088424 3300046455 Bacteria 1813
961 Ga0495603_0353566 3300046455 Bacteria 843
962 Ga0495603_0539916 3300046455 Bacteria 668
963 Ga0495590_0098438 3300046457 Bacteria 1038
964 Ga0495590_0108269 3300046457 Bacteria 990
965 Ga0495629_0001098 3300046459 Bacteria 21450
966 Ga0495629_0002258 3300046459 Bacteria 14852
967 Ga0495629_0526638 3300046459 Bacteria 795
968 Ga0495629_0952121 3300046459 Bacteria 561
969 Ga0495638_0004483 3300046460 Bacteria 10577
970 Ga0495638_0037446 3300046460 Bacteria 3085
971 Ga0495638_0110489 3300046460 Bacteria 1633
972 Ga0495638_0220113 3300046460 Bacteria 1061
973 Ga0495638_0221466 3300046460 Bacteria 1057
974 Ga0495638_0322130 3300046460 Bacteria 825
975 Ga0495638_0448805 3300046460 Bacteria 659
976 Ga0495641_0289181 3300046461 Bacteria 738
977 Ga0495641_0577651 3300046461 Bacteria 514
978 Ga0495651_0002766 3300046462 Bacteria 13608
979 Ga0495651_0026823 3300046462 Bacteria 4486
980 Ga0495651_0144905 3300046462 Bacteria 1718
981 Ga0495653_0000562 3300046463 Bacteria 28426
982 Ga0495653_0710019 3300046463 Bacteria 610
983 Ga0495653_0758354 3300046463 Bacteria 586
984 Ga0495650_0078899 3300046471 Bacteria 1274
985 Ga0495650_0163114 3300046471 Bacteria 793
986 Ga0495650_0329557 3300046471 Bacteria 507
987 Ga0495580_0059649 3300046472 Bacteria 2681
988 Ga0495582_0031742 3300046473 Bacteria 2904
989 Ga0495582_0124821 3300046473 Bacteria 1452
990 Ga0495582_0606980 3300046473 Bacteria 633
991 Ga0495605_0107267 3300046474 Bacteria 1278
992 Ga0495605_0124937 3300046474 Bacteria 1164
993 Ga0495605_0296553 3300046474 Bacteria 684
994 Ga0495639_0005522 3300046475 Bacteria 5443
995 Ga0495639_0287282 3300046475 Bacteria 818
996 Ga0495662_0351016 3300046476 Bacteria 725
997 Ga0495664_0045364 3300046477 Bacteria 2607
998 Ga0495664_0064925 3300046477 Bacteria 2176
999 Ga0495664_0346055 3300046477 Bacteria 895
1000 Ga0495664_0473968 3300046477 Bacteria 748
1001 Ga0495584_0095822 3300046491 Bacteria 1498
1002 Ga0495584_0108738 3300046491 Bacteria 1402
1003 Ga0495584_0600267 3300046491 Bacteria 561
1004 Ga0495585_0012463 3300046492 Bacteria 5009
1005 Ga0495585_0030579 3300046492 Bacteria 3062
1006 Ga0495585_0100946 3300046492 Bacteria 1543
1007 Ga0495594_0150020 3300046499 Bacteria 1323
1008 Ga0495594_0288174 3300046499 Bacteria 936
1009 Ga0495607_0157633 3300046501 Bacteria 1156
1010 Ga0495607_0169951 3300046501 Bacteria 1102
1011 Ga0495607_0340206 3300046501 Bacteria 695
1012 Ga0495583_0012826 3300046506 Bacteria 4715
1013 Ga0495583_0095646 3300046506 Bacteria 1274
1014 Ga0495583_0117913 3300046506 Bacteria 1120
1015 Ga0495583_0249626 3300046506 Bacteria 712
1016 Ga0495583_0259105 3300046506 Bacteria 696
1017 Ga0495606_0023943 3300046507 Bacteria 4412
1018 Ga0495606_0047831 3300046507 Bacteria 2818
1019 Ga0495606_0100654 3300046507 Bacteria 1760
1020 Ga0495606_0166745 3300046507 Bacteria 1281
1021 Ga0495606_0357107 3300046507 Bacteria 774
1022 Ga0495608_0005591 3300046511 Bacteria 8974
1023 Ga0495608_0098774 3300046511 Bacteria 1884
1024 Ga0495608_0132774 3300046511 Bacteria 1592
1025 Ga0495608_0162907 3300046511 Bacteria 1418
1026 Ga0495610_0035063 3300046512 Bacteria 2579
1027 Ga0495610_0067501 3300046512 Bacteria 1680
1028 Ga0495610_0219535 3300046512 Bacteria 768
1029 Ga0495616_0219405 3300046513 Bacteria 829
1030 Ga0495616_0254434 3300046513 Bacteria 753
1031 Ga0495616_0416327 3300046513 Bacteria 550
1032 Ga0495616_0423651 3300046513 Bacteria 543
1033 Ga0495618_0008913 3300046514 Bacteria 6054
1034 Ga0495618_0024236 3300046514 Bacteria 3756
1035 Ga0495618_0647008 3300046514 Bacteria 625
1036 Ga0495620_0085144 3300046515 Bacteria 1274
1037 Ga0495620_0143201 3300046515 Bacteria 934
1038 Ga0495620_0234790 3300046515 Bacteria 700
1039 Ga0495628_0011937 3300046516 Bacteria 7327
1040 Ga0495628_0063195 3300046516 Bacteria 2901
1041 Ga0495628_0202189 3300046516 Bacteria 1496
1042 Ga0495630_0007480 3300046517 Bacteria 7806
1043 Ga0495630_0272757 3300046517 Bacteria 1292
1044 Ga0495631_0287003 3300046518 Bacteria 700
1045 Ga0495632_0044408 3300046519 Bacteria 2218
1046 Ga0495632_0112610 3300046519 Bacteria 1276
1047 Ga0495632_0268345 3300046519 Bacteria 762
1048 Ga0495632_0402733 3300046519 Bacteria 597
1049 Ga0495643_0183760 3300046522 Bacteria 1014
1050 Ga0495643_0196523 3300046522 Bacteria 971
1051 Ga0495644_0090747 3300046523 Bacteria 1153
1052 Ga0495644_0150411 3300046523 Bacteria 891
1053 Ga0495644_0325423 3300046523 Bacteria 603
1054 Ga0495648_0001038 3300046524 Bacteria 28176
1055 Ga0495648_0051219 3300046524 Bacteria 2517
1056 Ga0495648_0057693 3300046524 Bacteria 2326
1057 Ga0495648_0151294 3300046524 Bacteria 1210
1058 Ga0495648_0241622 3300046524 Bacteria 877
1059 Ga0495648_0325792 3300046524 Bacteria 710
1060 Ga0495666_0100113 3300046526 Bacteria 1366
1061 Ga0495652_0008672 3300046529 Bacteria 9267
1062 Ga0495652_0026299 3300046529 Bacteria 5142
1063 Ga0495652_0032344 3300046529 Bacteria 4575
1064 Ga0495652_0147759 3300046529 Bacteria 1840
1065 Ga0495654_0127169 3300046530 Bacteria 1147
1066 Ga0495654_0132792 3300046530 Bacteria 1116
1067 Ga0495654_0341496 3300046530 Bacteria 604
1068 Ga0495665_0097042 3300046531 Bacteria 1547
1069 Ga0495665_0100779 3300046531 Bacteria 1516
1070 Ga0495640_0013143 3300046533 Bacteria 6300
1071 Ga0495640_0026031 3300046533 Bacteria 4234
1072 Ga0495640_0029945 3300046533 Bacteria 3901
1073 Ga0495586_0428462 3300046535 Bacteria 762
1074 Ga0495586_0880338 3300046535 Bacteria 516
1075 Ga0495587_0003932 3300046536 Bacteria 9864
1076 Ga0495587_0725404 3300046536 Bacteria 544
1077 Ga0495598_0020638 3300046537 Bacteria 1742
1078 Ga0495598_0051329 3300046537 Bacteria 1242
1079 Ga0495598_0088094 3300046537 Bacteria 1007
1080 Ga0495609_0096278 3300046538 Bacteria 1284
1081 Ga0495609_0213858 3300046538 Bacteria 802
1082 Ga0495609_0273470 3300046538 Bacteria 692
1083 Ga0495609_0304751 3300046538 Bacteria 648
1084 Ga0495621_0013157 3300046539 Bacteria 2595
1085 Ga0495621_0033997 3300046539 Bacteria 1760
1086 Ga0495621_0527581 3300046539 Bacteria 511
1087 Ga0495597_0013096 3300046542 Bacteria 3981
1088 Ga0495597_0194201 3300046542 Bacteria 815
1089 Ga0495645_0086399 3300046543 Bacteria 2244
1090 Ga0495645_0130007 3300046543 Bacteria 1765
1091 Ga0495645_0241215 3300046543 Bacteria 1206
1092 Ga0495622_0001657 3300046557 Bacteria 11014
1093 Ga0495622_0035703 3300046557 Bacteria 2318
1094 Ga0495622_0078296 3300046557 Bacteria 1522
1095 Ga0495622_0329488 3300046557 Bacteria 662
1096 Ga0495622_0422520 3300046557 Bacteria 573
1097 Ga0495633_0163362 3300046558 Bacteria 1027
1098 Ga0495633_0349937 3300046558 Bacteria 669
1099 Ga0495667_0001588 3300046559 Bacteria 15076
1100 Ga0495667_0029808 3300046559 Bacteria 3671
1101 Ga0495667_0034368 3300046559 Bacteria 3390
1102 Ga0495667_0398470 3300046559 Bacteria 867
1103 Ga0495656_0011088 3300046615 Bacteria 3299
1104 Ga0495656_0069986 3300046615 Bacteria 1556
1105 Ga0495656_0120824 3300046615 Bacteria 1236
1106 Ga0495656_0149617 3300046615 Bacteria 1126
1107 Ga0495656_0278044 3300046615 Bacteria 852
1108 Ga0495668_0090246 3300046616 Bacteria 1679
1109 Ga0495668_0111608 3300046616 Bacteria 1495
1110 Ga0495668_0276874 3300046616 Bacteria 919
1111 Ga0495668_0441184 3300046616 Bacteria 716
1112 Ga0495668_0509948 3300046616 Bacteria 663
1113 Ga0495634_0002373 3300046642 Bacteria 15688
1114 Ga0495634_0006397 3300046642 Bacteria 8952
1115 Ga0495634_0883147 3300046642 Bacteria 506
1116 Ga0495611_0087276 3300046648 Bacteria 1440
1117 Ga0495611_0163188 3300046648 Bacteria 1041
1118 Ga0495611_0170791 3300046648 Bacteria 1016
1119 Ga0495611_0200653 3300046648 Bacteria 930
1120 Ga0495611_0335740 3300046648 Bacteria 694
1121 Ga0495611_0350887 3300046648 Bacteria 677
1122 Ga0495625_0035691 3300046660 Bacteria 3662
1123 Ga0495625_0086733 3300046660 Bacteria 2171
1124 Ga0495625_0149756 3300046660 Bacteria 1569
1125 Ga0495625_0231837 3300046660 Bacteria 1205
1126 Ga0495625_0363792 3300046660 Bacteria 911
1127 Ga0495625_0415194 3300046660 Bacteria 838
1128 Ga0495635_0000346 3300046663 Bacteria 29602
1129 Ga0495635_0001380 3300046663 Bacteria 16199
1130 Ga0495635_0119709 3300046663 Bacteria 1796
1131 Ga0495635_0269841 3300046663 Bacteria 1144
1132 Ga0495659_0024844 3300046664 Bacteria 2046
1133 Ga0495659_0092874 3300046664 Bacteria 1160
1134 Ga0495661_0189773 3300046665 Bacteria 1083
1135 Ga0495661_0211192 3300046665 Bacteria 1010
1136 Ga0495661_0287916 3300046665 Bacteria 826
1137 Ga0495661_0294470 3300046665 Bacteria 814
1138 Ga0495661_0386476 3300046665 Bacteria 683
1139 Ga0495588_0007097 3300046674 Bacteria 5078
1140 Ga0495588_0124350 3300046674 Bacteria 1360
1141 Ga0495588_0199828 3300046674 Bacteria 1056
1142 Ga0495588_0559621 3300046674 Bacteria 599
1143 Ga0495588_0658749 3300046674 Bacteria 548
1144 Ga0495657_0010298 3300046675 Bacteria 7041
1145 Ga0495657_0011353 3300046675 Bacteria 6664
1146 Ga0495657_0034813 3300046675 Bacteria 3495
1147 Ga0495657_0337918 3300046675 Bacteria 893
1148 Ga0495599_0000522 3300046678 Bacteria 22066
1149 Ga0495599_0046395 3300046678 Bacteria 2725
1150 Ga0495599_0092868 3300046678 Bacteria 1883
1151 Ga0495599_0139647 3300046678 Bacteria 1503
1152 Ga0495623_0005412 3300046679 Bacteria 8340
1153 Ga0495623_0091055 3300046679 Bacteria 1872
1154 Ga0495646_0000537 3300046680 Bacteria 20375
1155 Ga0495647_0051142 3300046681 Bacteria 1605
1156 Ga0495658_0017128 3300046683 Bacteria 3738
1157 Ga0495658_0457918 3300046683 Bacteria 815
1158 Ga0495669_0003415 3300046684 Bacteria 6539
1159 Ga0495669_0048084 3300046684 Bacteria 1907
1160 Ga0495669_0263510 3300046684 Bacteria 828
1161 Ga0495669_0453859 3300046684 Bacteria 622
1162 Ga0495613_0027437 3300046689 Bacteria 4237
1163 Ga0495613_0047407 3300046689 Bacteria 3174
1164 Ga0495613_0256867 3300046689 Bacteria 1218
1165 Ga0495624_0004020 3300046690 Bacteria 10818
1166 Ga0495624_0108267 3300046690 Bacteria 1709
1167 Ga0495624_0198871 3300046690 Bacteria 1218
1168 Ga0495624_0234435 3300046690 Bacteria 1111
1169 Ga0495624_0393044 3300046690 Bacteria 833
1170 Ga0495670_0000757 3300046691 Bacteria 15507
1171 Ga0495670_0026769 3300046691 Bacteria 2855
1172 Ga0495671_0117840 3300046692 Bacteria 1296
1173 Ga0495671_0127622 3300046692 Bacteria 1240
1174 Ga0495671_0222292 3300046692 Bacteria 914
1175 Ga0495671_0249479 3300046692 Bacteria 857
1176 Ga0495671_0440731 3300046692 Bacteria 623
1177 Ga0495649_0022922 3300046694 Bacteria 3490
1178 Ga0495649_0213505 3300046694 Bacteria 999
1179 Ga0495649_0375921 3300046694 Bacteria 715
1180 Ga0495649_0390316 3300046694 Bacteria 700
1181 Ga0495649_0521523 3300046694 Bacteria 590
1182 Ga0495589_0101402 3300046794 Bacteria 1393
1183 Ga0495589_0235451 3300046794 Bacteria 858
1184 Ga0495589_0333251 3300046794 Bacteria 700
1185 Ga0495600_0000398 3300046809 Bacteria 22465
1186 Ga0495600_0008503 3300046809 Bacteria 6308
1187 Ga0495600_0024296 3300046809 Bacteria 3900
1188 Ga0495600_0147695 3300046809 Bacteria 1523
1189 Ga0495600_0219559 3300046809 Bacteria 1216
1190 Ga0495600_0320235 3300046809 Bacteria 975
1191 Ga0495600_0417361 3300046809 Bacteria 833
1192 Ga0495581_0051626 3300047315 Bacteria 2374
1193 Ga0495581_0187432 3300047315 Bacteria 1210
1194 Ga0495604_0004007 3300047317 Bacteria 11715
1195 Ga0495604_0005171 3300047317 Bacteria 10334
1196 Ga0495604_0007540 3300047317 Bacteria 8607
1197 Ga0495604_0034557 3300047317 Bacteria 3999
1198 Ga0495604_0443734 3300047317 Bacteria 849
1199 Ga0495636_0011599 3300047318 Bacteria 3489
1200 Ga0495636_0467951 3300047318 Bacteria 607
1201 Ga0495674_0004134 3300047319 Bacteria 14015
1202 Ga0495674_0006731 3300047319 Bacteria 11003
1203 Ga0495674_0076952 3300047319 Bacteria 2869
1204 Ga0495672_0165212 3300047320 Bacteria 1134
1205 Ga0495672_0333381 3300047320 Bacteria 709
1206 Ga0495676_0025537 3300047321 Bacteria 5099
1207 Ga0495676_0034955 3300047321 Bacteria 4210
1208 Ga0495676_0117815 3300047321 Bacteria 1937
1209 Ga0495680_0002197 3300047322 Bacteria 20191
1210 Ga0495680_0006139 3300047322 Bacteria 11212
1211 Ga0495680_0770156 3300047322 Bacteria 631
1212 Ga0495683_0167698 3300047323 Bacteria 1011
1213 Ga0495687_075687 3300047443 Bacteria 1334
1214 Ga0495675_0001020 3300047444 Bacteria 17009
1215 Ga0495675_0087204 3300047444 Bacteria 1961
1216 Ga0495677_0128474 3300047445 Bacteria 969
1217 Ga0495685_059079 3300047447 Bacteria 1294
1218 Ga0495673_0083555 3300047469 Bacteria 1318
1219 Ga0495673_0092356 3300047469 Bacteria 1235
1220 Ga0495673_0140598 3300047469 Bacteria 941
1221 Ga0495673_0173904 3300047469 Bacteria 819
1222 Ga0495673_0217501 3300047469 Bacteria 708
1223 Ga0495681_0318410 3300047470 Bacteria 598
1224 Ga0495684_0001669 3300047471 Bacteria 17830
1225 Ga0495684_0004704 3300047471 Bacteria 10654
1226 Ga0495684_0024356 3300047471 Bacteria 4660
1227 Ga0495686_0055110 3300047472 Bacteria 2488
1228 Ga0495686_0310311 3300047472 Bacteria 868
1229 Ga0495593_0000190 3300047673 Bacteria 32323
1230 Ga0495593_0021782 3300047673 Bacteria 3576
1231 Ga0495593_0022440 3300047673 Bacteria 3516
1232 Ga0495602_0001719 3300048088 Bacteria 21809
1233 Ga0495602_0004841 3300048088 Bacteria 14086
1234 Ga0495602_0044617 3300048088 Bacteria 4020
1235 Ga0495615_0003530 3300048090 Bacteria 2629
1236 Ga0495626_0212925 3300048091 Bacteria 788
1237 Ga0496100_0065196 3300048903 Bacteria 2412
1238 Ga0496100_0362376 3300048903 Bacteria 1097
1239 Ga0496100_0932015 3300048903 Bacteria 682
1240 Ga0496101_0018829 3300048904 Bacteria 4702
1241 Ga0496101_0188809 3300048904 Bacteria 1590
1242 Ga0496101_0205581 3300048904 Bacteria 1523
1243 Ga0496101_0212782 3300048904 Bacteria 1498
1244 Ga0496101_0334223 3300048904 Bacteria 1189
1245 Ga0496101_0340419 3300048904 Bacteria 1178
1246 Ga0496101_0427283 3300048904 Bacteria 1044
1247 Ga0496101_0610706 3300048904 Bacteria 862
1248 Ga0496101_1189213 3300048904 Bacteria 598
1249 Ga0496101_1266611 3300048904 Bacteria 577
1250 Ga0496102_0010809 3300048905 Bacteria 7862
1251 Ga0496102_0059740 3300048905 Bacteria 3487
1252 Ga0496102_0090008 3300048905 Bacteria 2839
1253 Ga0496102_0108748 3300048905 Bacteria 2583
1254 Ga0496102_0347586 3300048905 Bacteria 1396
1255 Ga0496102_0458804 3300048905 Bacteria 1195
1256 Ga0496102_0641467 3300048905 Bacteria 985
1257 Ga0496102_0701273 3300048905 Bacteria 935
1258 Ga0496102_0855582 3300048905 Unclassified 831
1259 Ga0496102_1361471 3300048905 Bacteria 629
1260 Ga0496103_0006115 3300048906 Bacteria 7191
1261 Ga0496103_0083756 3300048906 Bacteria 2008
1262 Ga0496103_0157727 3300048906 Bacteria 1455
1263 Ga0496103_0206929 3300048906 Bacteria 1262
1264 Ga0496103_0258809 3300048906 Bacteria 1120
1265 Ga0496103_0658467 3300048906 Bacteria 665
1266 Ga0496103_0935536 3300048906 Bacteria 542
1267 Ga0496104_0002128 3300048907 Bacteria 17188
1268 Ga0496104_0006775 3300048907 Bacteria 10091
1269 Ga0496104_0049600 3300048907 Bacteria 3958
1270 Ga0496104_0101083 3300048907 Bacteria 2760
1271 Ga0496104_0263757 3300048907 Bacteria 1635
1272 Ga0496104_0757248 3300048907 Bacteria 878
1273 Ga0496104_0786942 3300048907 Bacteria 857
1274 Ga0496105_0005208 3300048908 Bacteria 9852
1275 Ga0496105_0009083 3300048908 Bacteria 7754
1276 Ga0496105_0029203 3300048908 Bacteria 4513
1277 Ga0496105_0111707 3300048908 Bacteria 2255
1278 Ga0496105_0171132 3300048908 Bacteria 1780
1279 Ga0496105_0205500 3300048908 Bacteria 1606
1280 Ga0496105_0247020 3300048908 Bacteria 1447
1281 Ga0496105_0335751 3300048908 Bacteria 1209
1282 Ga0496105_0572776 3300048908 Bacteria 879
1283 Ga0496106_0004764 3300048909 Bacteria 10028
1284 Ga0496106_0058382 3300048909 Bacteria 2921
1285 Ga0496106_0121811 3300048909 Bacteria 2039
1286 Ga0496106_0133749 3300048909 Bacteria 1946
1287 Ga0496106_0342849 3300048909 Bacteria 1200
1288 Ga0496106_0376869 3300048909 Bacteria 1140
1289 Ga0496106_0911546 3300048909 Bacteria 694
1290 Ga0496107_0001840 3300048910 Bacteria 13399
1291 Ga0496107_0008370 3300048910 Bacteria 7156
1292 Ga0496107_0026974 3300048910 Bacteria 4077
1293 Ga0496107_0129249 3300048910 Bacteria 1864
1294 Ga0496107_0320513 3300048910 Bacteria 1153
1295 Ga0496107_0602014 3300048910 Bacteria 812
1296 Ga0496107_0852801 3300048910 Bacteria 665
1297 Ga0496108_0001980 3300048911 Bacteria 16402
1298 Ga0496108_0024345 3300048911 Bacteria 4983
1299 Ga0496108_0054851 3300048911 Bacteria 3345
1300 Ga0496108_0062831 3300048911 Bacteria 3126
1301 Ga0496108_0325002 3300048911 Bacteria 1341
1302 Ga0496108_0410058 3300048911 Bacteria 1183
1303 Ga0496109_0015085 3300048912 Bacteria 6725
1304 Ga0496109_0029396 3300048912 Bacteria 4921
1305 Ga0496109_0031537 3300048912 Bacteria 4756
1306 Ga0496109_0172858 3300048912 Bacteria 2027
1307 Ga0496109_0317776 3300048912 Bacteria 1469
1308 Ga0496109_0593596 3300048912 Bacteria 1043
1309 Ga0496110_0006296 3300048913 Bacteria 9370
1310 Ga0496110_0020595 3300048913 Bacteria 5571
1311 Ga0496110_0031676 3300048913 Bacteria 4563
1312 Ga0496110_0227924 3300048913 Bacteria 1694
1313 Ga0496110_0312467 3300048913 Bacteria 1431
1314 Ga0496110_0318973 3300048913 Bacteria 1415
1315 Ga0496110_0349333 3300048913 Bacteria 1347
1316 Ga0496110_0796989 3300048913 Bacteria 849
1317 Ga0496111_0240487 3300048914 Bacteria 1344
1318 Ga0496111_0281550 3300048914 Bacteria 1233
1319 Ga0496111_0285343 3300048914 Bacteria 1224
1320 Ga0496111_0289130 3300048914 Bacteria 1215
1321 Ga0496111_0305041 3300048914 Bacteria 1180
1322 Ga0496111_0393252 3300048914 Bacteria 1025
1323 Ga0496111_0402074 3300048914 Bacteria 1012
1324 Ga0496112_0004485 3300048915 Bacteria 11845
1325 Ga0496112_0019812 3300048915 Bacteria 6363
1326 Ga0496112_0057366 3300048915 Bacteria 3833
1327 Ga0496112_0079729 3300048915 Bacteria 3238
1328 Ga0496112_0188187 3300048915 Bacteria 2027
1329 Ga0496112_0253295 3300048915 Bacteria 1711
1330 Ga0496112_0305707 3300048915 Bacteria 1535
1331 Ga0496112_0659880 3300048915 Bacteria 975
1332 Ga0496113_0175413 3300048916 Bacteria 1698
1333 Ga0496113_0232226 3300048916 Bacteria 1471
1334 Ga0496113_0268418 3300048916 Bacteria 1363
1335 Ga0496113_0355584 3300048916 Bacteria 1175
1336 Ga0496113_0372887 3300048916 Bacteria 1145
1337 Ga0496113_0427384 3300048916 Bacteria 1064
1338 Ga0496114_0008932 3300048917 Bacteria 7944
1339 Ga0496114_0060493 3300048917 Bacteria 3166
1340 Ga0496114_0071900 3300048917 Bacteria 2908
1341 Ga0496114_0093078 3300048917 Bacteria 2562
1342 Ga0496114_0517443 3300048917 Bacteria 1055
1343 Ga0496114_0520904 3300048917 Bacteria 1051
1344 Ga0496114_0887600 3300048917 Bacteria 772
1345 Ga0496115_0001528 3300048918 Bacteria 16623
1346 Ga0496115_0014005 3300048918 Bacteria 6071
1347 Ga0496115_0067015 3300048918 Bacteria 2902
1348 Ga0496115_0107934 3300048918 Bacteria 2285
1349 Ga0496115_0149426 3300048918 Bacteria 1928
1350 Ga0496115_0149762 3300048918 Bacteria 1926
1351 Ga0496115_0435765 3300048918 Bacteria 1060
1352 Ga0496115_0503641 3300048918 Bacteria 973
1353 Ga0496115_0842098 3300048918 Bacteria 711
1354 Ga0496115_1311962 3300048918 Bacteria 538
1355 Ga0496116_0002360 3300048919 Bacteria 19968
1356 Ga0496116_0055335 3300048919 Bacteria 2607
1357 Ga0496117_0024592 3300048920 Bacteria 4759
1358 Ga0496117_0055499 3300048920 Bacteria 2768
1359 Ga0496117_0069138 3300048920 Bacteria 2380
1360 Ga0496117_0098446 3300048920 Bacteria 1859
1361 Ga0496117_0147648 3300048920 Bacteria 1397
1362 Ga0496117_0247274 3300048920 Bacteria 975
1363 Ga0496117_0319027 3300048920 Bacteria 815
1364 Ga0496117_0353543 3300048920 Bacteria 758
1365 Ga0496118_0037036 3300048921 Bacteria 3933
1366 Ga0496118_0108199 3300048921 Bacteria 1854
1367 Ga0496118_0190023 3300048921 Bacteria 1229
1368 Ga0496118_0254707 3300048921 Bacteria 995
1369 Ga0496118_0431380 3300048921 Bacteria 675
1370 Ga0496118_0505845 3300048921 Bacteria 599
1371 Ga0496118_0559530 3300048921 Bacteria 556
1372 Ga0496119_0044767 3300048922 Bacteria 2782
1373 Ga0496119_0083600 3300048922 Bacteria 1832
1374 Ga0496119_0177088 3300048922 Bacteria 1121
1375 Ga0496119_0293595 3300048922 Bacteria 804
1376 Ga0496119_0566901 3300048922 Bacteria 520
1377 Ga0496120_0021422 3300048923 Bacteria 4086
1378 Ga0496120_0026469 3300048923 Bacteria 3581
1379 Ga0496121_0004217 3300048924 Bacteria 19593
1380 Ga0496121_0024578 3300048924 Bacteria 5756
1381 Ga0496121_0026133 3300048924 Bacteria 5514
1382 Ga0496121_0042542 3300048924 Bacteria 3948
1383 Ga0496121_0059217 3300048924 Bacteria 3159
1384 Ga0496121_0146344 3300048924 Bacteria 1745
1385 Ga0496121_0308783 3300048924 Bacteria 1070
1386 Ga0496121_0335526 3300048924 Bacteria 1012
1387 Ga0496121_0383863 3300048924 Bacteria 925
1388 Ga0496121_0393818 3300048924 Bacteria 909
1389 Ga0496121_0409651 3300048924 Bacteria 885
1390 Ga0496121_0445241 3300048924 Bacteria 836
1391 Ga0496121_0619446 3300048924 Bacteria 664
1392 Ga0496121_0691491 3300048924 Bacteria 615
1393 Ga0496123_0041651 3300048926 Bacteria 3180
1394 Ga0496123_0129019 3300048926 Bacteria 1405
1395 Ga0496124_0107574 3300048927 Bacteria 2250
1396 Ga0496124_0131041 3300048927 Bacteria 1992
1397 Ga0496124_0282785 3300048927 Bacteria 1208
1398 Ga0496124_0300355 3300048927 Bacteria 1160
1399 Ga0496124_0656285 3300048927 Bacteria 672
1400 Ga0496124_0714667 3300048927 Bacteria 633
1401 Ga0496125_0022040 3300048928 Bacteria 5923
1402 Ga0496125_0022335 3300048928 Bacteria 5878
1403 Ga0496125_0060254 3300048928 Bacteria 3052
1404 Ga0496125_0062839 3300048928 Bacteria 2966
1405 Ga0496125_0091796 3300048928 Bacteria 2273
1406 Ga0496125_0283924 3300048928 Bacteria 1023
1407 Ga0496125_0618190 3300048928 Bacteria 589
1408 Ga0496126_0014622 3300048929 Bacteria 7924
1409 Ga0496126_0025409 3300048929 Bacteria 5698
1410 Ga0496126_0037954 3300048929 Bacteria 4485
1411 Ga0496126_0054823 3300048929 Bacteria 3608
1412 Ga0496126_0061444 3300048929 Bacteria 3374
1413 Ga0496126_0130622 3300048929 Bacteria 2171
1414 Ga0496126_0140303 3300048929 Bacteria 2081
1415 Ga0496126_0252266 3300048929 Bacteria 1470
1416 Ga0496126_0260491 3300048929 Bacteria 1442
1417 Ga0496126_0316920 3300048929 Bacteria 1283
1418 Ga0496126_0422499 3300048929 Bacteria 1077
1419 Ga0496126_1009061 3300048929 Bacteria 624
1420 Ga0496126_1060356 3300048929 Bacteria 604
1421 Ga0495682_0112000 3300049460 Bacteria 978
1422 Ga0495682_0150374 3300049460 Bacteria 830
1423 Ga0495682_0225797 3300049460 Bacteria 663
1424 Ga0501032_0000076 3300049569 Bacteria 83609
1425 Ga0501032_0001266 3300049569 Bacteria 20268
1426 Ga0501033_0000093 3300049570 Bacteria 85243
1427 Ga0501034_0001640 3300049571 Bacteria 28905
1428 Ga0501034_0235039 3300049571 Bacteria 1781
1429 Ga0501034_1162371 3300049571 Bacteria 651
1430 Ga0501036_0000035 3300049572 Bacteria 88062
1431 Ga0501037_0000026 3300049573 Bacteria 142936
1432 Ga0501038_0000037 3300049574 Bacteria 124444
1433 Ga0501038_0000133 3300049574 Bacteria 63587
1434 Ga0501039_0000263 3300049575 Bacteria 38312
1435 Ga0501043_0000115 3300049579 Bacteria 75659
1436 Ga0501046_0000210 3300049580 Bacteria 60801
1437 Ga0501047_0000094 3300049581 Bacteria 109928
1438 Ga0501047_0045478 3300049581 Bacteria 4245
1439 Ga0501048_0000306 3300049582 Bacteria 33320
1440 Ga0501048_0012411 3300049582 Bacteria 6338
1441 Ga0501048_0125237 3300049582 Bacteria 1817
1442 Ga0501067_0001472 3300049583 Bacteria 12790
1443 Ga0501067_0026617 3300049583 Bacteria 3203
1444 Ga0501067_0140788 3300049583 Bacteria 1343
1445 Ga0501068_0001034 3300049584 Bacteria 14700
1446 Ga0501068_0017076 3300049584 Bacteria 4194
1447 Ga0501069_0004848 3300049585 Bacteria 6968
1448 Ga0501069_0009809 3300049585 Bacteria 5062
1449 Ga0501069_0155153 3300049585 Bacteria 1317
1450 Ga0501070_0000134 3300049586 Bacteria 66993
1451 Ga0501070_0053140 3300049586 Bacteria 3361
1452 Ga0501072_0059293 3300049588 Bacteria 3018
1453 Ga0501073_0007576 3300049589 Bacteria 8067
1454 Ga0501073_0207705 3300049589 Bacteria 1353
1455 Ga0501073_0275856 3300049589 Bacteria 1160
1456 Ga0501073_1063235 3300049589 Bacteria 556
1457 Ga0501074_0005960 3300049590 Bacteria 8792
1458 Ga0501074_0166763 3300049590 Bacteria 1572
1459 Ga0501080_0000076 3300049742 Bacteria 66341
1460 Ga0501080_0040484 3300049742 Bacteria 4346
1461 Ga0501080_0162213 3300049742 Bacteria 2064
1462 Ga0501083_0085514 3300049744 Bacteria 2086
1463 Ga0501083_0978690 3300049744 Bacteria 550
1464 Ga0501035_0000533 3300049822 Bacteria 42510
1465 Ga0501044_0000507 3300049823 Bacteria 47418
1466 Ga0501044_0555403 3300049823 Bacteria 1045
1467 nmdc:mga03683_183258_c1 3300050489 Bacteria 956
1468 nmdc:mga03683_353232_c1 3300050489 Bacteria 696
1469 nmdc:mga03683_385757_c1 3300050489 Bacteria 667
1470 nmdc:mga03n38_222446_c1 3300050490 Bacteria 986
1471 nmdc:mga00v17_157454_c1 3300050491 Bacteria 1461
1472 nmdc:mga00v17_23984_c1 3300050491 Bacteria 3534
1473 nmdc:mga00v17_332290_c1 3300050491 Bacteria 988
1474 nmdc:mga00v17_337861_c1 3300050491 Bacteria 979
1475 nmdc:mga00v17_928073_c1 3300050491 Bacteria 550
1476 nmdc:mga0yw44_118957_c1 3300050492 Bacteria 1700
1477 nmdc:mga0yw44_18253_c1 3300050492 Bacteria 3836
1478 nmdc:mga0yw44_490286_c1 3300050492 Bacteria 834
1479 nmdc:mga0yw44_61539_c1 3300050492 Bacteria 2304
1480 nmdc:mga0yw44_69378_c1 3300050492 Bacteria 2183
1481 nmdc:mga0k408_218381_c1 3300050493 Bacteria 1138
1482 nmdc:mga0k408_284606_c1 3300050493 Bacteria 987
1483 nmdc:mga0k408_29471_c1 3300050493 Bacteria 2628
1484 nmdc:mga0k408_663762_c1 3300050493 Bacteria 612
1485 nmdc:mga0k408_73771_c1 3300050493 Bacteria 1993
1486 nmdc:mga06z11_172523_c1 3300050494 Bacteria 1243
1487 nmdc:mga06z11_180910_c1 3300050494 Bacteria 1216
1488 nmdc:mga06z11_424049_c1 3300050494 Bacteria 802
1489 nmdc:mga06z11_471066_c1 3300050494 Bacteria 760
1490 nmdc:mga04h51_221672_c1 3300050495 Bacteria 750
1491 nmdc:mga04h51_223004_c1 3300050495 Bacteria 748
1492 nmdc:mga07m45_184829_c1 3300050496 Bacteria 1212
1493 nmdc:mga07m45_204325_c1 3300050496 Bacteria 1149
1494 nmdc:mga07m45_218851_c1 3300050496 Bacteria 1108
1495 nmdc:mga07m45_322869_c1 3300050496 Bacteria 897
1496 nmdc:mga07m45_35536_c1 3300050496 Bacteria 2772
1497 nmdc:mga07m45_377597_c1 3300050496 Bacteria 823
1498 nmdc:mga07m45_531301_c1 3300050496 Bacteria 681
1499 nmdc:mga07m45_65834_c1 3300050496 Bacteria 2058
1500 nmdc:mga07m45_702870_c1 3300050496 Bacteria 581
1501 nmdc:mga07m45_85017_c1 3300050496 Bacteria 1809
1502 nmdc:mga05p37_318829_c1 3300050507 Bacteria 1840
1503 nmdc:mga05p37_974915_c1 3300050507 Bacteria 904
1504 nmdc:mga09592_733831_c1 3300050508 Bacteria 839
1505 nmdc:mga08y16_120205_c1 3300050511 Bacteria 2734
1506 nmdc:mga08y16_1963255_c1 3300050511 Bacteria 535
1507 nmdc:mga08y16_862629_c1 3300050511 Bacteria 894
1508 nmdc:mga0n895_14081_c1 3300050512 Bacteria 7251
1509 nmdc:mga08x19_920167_c1 3300050514 Bacteria 621
1510 nmdc:mga0sz30_21570_c1 3300050516 Bacteria 2608
1511 nmdc:mga0sz30_539945_c1 3300050516 Bacteria 526
1512 nmdc:mga0sz30_83531_c1 3300050516 Bacteria 1384
1513 Ga0495601_0013705 3300053077 Bacteria 4877
1514 Ga0495601_0050280 3300053077 Bacteria 2629
1515 Ga0495601_0120675 3300053077 Bacteria 1702
1516 Ga0495601_0285131 3300053077 Bacteria 1077
1517 Ga0495601_0477811 3300053077 Bacteria 805
1518 Ga0495612_0023553 3300053078 Bacteria 2471
1519 Ga0495612_0058623 3300053078 Bacteria 1591
1520 Ga0500610_0072351 3300053079 Bacteria 1798
1521 Ga0500635_0092661 3300053080 Bacteria 1101
1522 Ga0495655_0052088 3300053083 Bacteria 1087
1523 Ga0495655_0058818 3300053083 Bacteria 1042
1524 Ga0495655_0136904 3300053083 Bacteria 759
1525 Ga0495655_0181156 3300053083 Bacteria 679
1526 Ga0495595_0000170 3300053084 Bacteria 25705
1527 Ga0495595_0167853 3300053084 Bacteria 1085
1528 Ga0495595_0242386 3300053084 Bacteria 902
1529 Ga0495619_0000803 3300053085 Bacteria 20555
1530 Ga0495619_0006966 3300053085 Bacteria 7154
1531 Ga0495619_0192320 3300053085 Bacteria 1412
1532 Ga0495619_0680058 3300053085 Bacteria 701
1533 Ga0495619_0802659 3300053085 Bacteria 636
1534 Ga0500578_0202710 3300053086 Bacteria 1213
1535 Ga0500578_0211384 3300053086 Bacteria 1183
1536 Ga0500578_0233959 3300053086 Bacteria 1112
1537 Ga0500578_0272475 3300053086 Bacteria 1012
1538 Ga0500578_0286372 3300053086 Bacteria 981
1539 Ga0500578_0453092 3300053086 Bacteria 730
1540 Ga0500578_0606971 3300053086 Bacteria 601
1541 Ga0500643_000018 3300053087 Bacteria 296505
1542 Ga0500643_054343 3300053087 Bacteria 1137
1543 Ga0500644_0071203 3300053088 Bacteria 1254
1544 Ga0500644_0412800 3300053088 Bacteria 589
1545 Ga0500581_038250 3300053089 Bacteria 2459
1546 Ga0500646_0096244 3300053090 Bacteria 923
1547 Ga0500647_0045892 3300053091 Bacteria 2099
1548 Ga0500647_0062219 3300053091 Bacteria 1796
1549 Ga0500651_0055493 3300053093 Bacteria 2481
1550 Ga0500651_0091172 3300053093 Bacteria 1876
1551 Ga0500651_0126865 3300053093 Bacteria 1545
1552 Ga0500651_0180309 3300053093 Bacteria 1255
1553 Ga0500651_0293463 3300053093 Bacteria 934
1554 Ga0500651_0590600 3300053093 Bacteria 603
1555 Ga0500566_0000066 3300053094 Bacteria 50309
1556 Ga0500566_0264962 3300053094 Bacteria 827
1557 Ga0500640_063827 3300053095 Bacteria 1591
1558 Ga0500641_0085253 3300053096 Bacteria 1344
1559 Ga0500641_0097248 3300053096 Bacteria 1260
1560 Ga0500650_0000287 3300053098 Bacteria 12200
1561 Ga0500650_0283182 3300053098 Bacteria 737
1562 Ga0500555_003373 3300053103 Bacteria 4554
1563 Ga0500555_128064 3300053103 Bacteria 631
1564 Ga0500556_0000058 3300053104 Bacteria 114257
1565 Ga0500557_000008 3300053105 Bacteria 127284
1566 Ga0500562_001778 3300053108 Bacteria 5386
1567 Ga0500562_012928 3300053108 Bacteria 2125
1568 Ga0500562_016626 3300053108 Bacteria 1893
1569 Ga0500562_072939 3300053108 Bacteria 927
1570 Ga0500569_005296 3300053109 Bacteria 2764
1571 Ga0500569_023221 3300053109 Bacteria 1664
1572 Ga0500569_181696 3300053109 Bacteria 714
1573 Ga0500592_010653 3300053116 Bacteria 1467
1574 Ga0500592_025793 3300053116 Bacteria 948
1575 Ga0500592_032094 3300053116 Bacteria 847
1576 Ga0500594_0125961 3300053118 Bacteria 808
1577 Ga0500595_000146 3300053119 Bacteria 46362
1578 Ga0500595_016698 3300053119 Bacteria 2728
1579 Ga0500595_021184 3300053119 Bacteria 2324
1580 Ga0500595_035545 3300053119 Bacteria 1640
1581 Ga0500595_044103 3300053119 Bacteria 1415
1582 Ga0500595_108409 3300053119 Bacteria 791
1583 Ga0500597_078318 3300053120 Bacteria 1433
1584 Ga0500607_254200 3300053121 Bacteria 695
1585 Ga0500608_078190 3300053122 Bacteria 1564
1586 Ga0500608_147819 3300053122 Bacteria 1033
1587 Ga0500621_190292 3300053126 Bacteria 736
1588 Ga0500626_113230 3300053128 Bacteria 1169
1589 Ga0500642_0000025 3300053130 Bacteria 130425
1590 Ga0500642_0000294 3300053130 Bacteria 18100
1591 Ga0500642_0006956 3300053130 Bacteria 3769
1592 Ga0500642_0284256 3300053130 Bacteria 751
1593 Ga0500642_0365903 3300053130 Bacteria 637
1594 Ga0500652_010275 3300053131 Bacteria 3201
1595 Ga0500652_273446 3300053131 Bacteria 662
1596 Ga0500655_047627 3300053133 Bacteria 850
1597 Ga0500655_084418 3300053133 Bacteria 656
1598 Ga0500658_0015391 3300053134 Bacteria 2839
1599 Ga0500658_0145854 3300053134 Bacteria 1064
1600 Ga0500559_0001270 3300053136 Bacteria 14757
1601 Ga0500559_0209412 3300053136 Bacteria 919
1602 Ga0500559_0374340 3300053136 Bacteria 664
1603 Ga0500568_0000833 3300053139 Bacteria 21699
1604 Ga0500568_0018742 3300053139 Bacteria 3020
1605 Ga0500568_0077476 3300053139 Bacteria 1265
1606 Ga0500568_0081189 3300053139 Bacteria 1231
1607 Ga0500577_0196826 3300053142 Bacteria 869
1608 Ga0500577_0223639 3300053142 Bacteria 815
1609 Ga0500577_0230969 3300053142 Bacteria 802
1610 Ga0500586_008323 3300053145 Bacteria 2820
1611 Ga0500590_134736 3300053148 Bacteria 1138
1612 Ga0500590_268625 3300053148 Bacteria 664
1613 Ga0500590_284628 3300053148 Bacteria 632
1614 Ga0500604_0001603 3300053151 Bacteria 6347
1615 Ga0500604_0055233 3300053151 Bacteria 1235
1616 Ga0500604_0172857 3300053151 Bacteria 739
1617 Ga0500604_0288003 3300053151 Bacteria 569
1618 Ga0500616_0000031 3300053153 Bacteria 415013
1619 Ga0500619_036636 3300053154 Bacteria 1528
1620 Ga0500622_0000783 3300053156 Bacteria 27611
1621 Ga0500622_0006295 3300053156 Bacteria 6929
1622 Ga0500627_0139073 3300053158 Bacteria 1097
1623 Ga0500627_0172235 3300053158 Bacteria 975
1624 Ga0500627_0368277 3300053158 Bacteria 617
1625 Ga0500627_0406239 3300053158 Bacteria 579
1626 Ga0500633_0016500 3300053160 Bacteria 2145
1627 Ga0500633_0173307 3300053160 Bacteria 809
1628 Ga0500634_0040764 3300053161 Bacteria 2523
1629 Ga0500634_0175751 3300053161 Bacteria 970
1630 Ga0500638_071504 3300053162 Bacteria 1658
1631 Ga0500638_146932 3300053162 Bacteria 1052
1632 Ga0500638_209792 3300053162 Bacteria 817
1633 Ga0500636_0000550 3300053177 Bacteria 20404
1634 Ga0500636_0000803 3300053177 Bacteria 16935
1635 Ga0500636_0063170 3300053177 Bacteria 2158
1636 Ga0500636_0159098 3300053177 Bacteria 1233
1637 Ga0500637_0254581 3300053178 Bacteria 978
1638 Ga0500649_157189 3300053722 Bacteria 806
1639 Ga0500611_015384 3300053727 Bacteria 1354
1640 Ga0500611_034709 3300053727 Bacteria 1070
1641 Ga0500611_073330 3300053727 Bacteria 839
1642 Ga0500625_011535 3300053729 Bacteria 4016
1643 Ga0500645_018190 3300053730 Bacteria 2196
1644 Ga0500645_019058 3300053730 Bacteria 2137
1645 Ga0500645_025642 3300053730 Bacteria 1798
1646 Ga0500609_033219 3300053731 Bacteria 710
1647 Ga0500599_008514 3300053736 Bacteria 1333
1648 Ga0500601_000062 3300053737 Bacteria 22260
1649 Ga0500601_015101 3300053737 Bacteria 878
1650 Ga0500661_010169 3300055283 Bacteria 1714
1651 Ga0587071_163124 3300060344 Bacteria 562
1652 Ga0501082_0006966 3300060353 Bacteria 9764
1653 Ga0501082_0293473 3300060353 Bacteria 1416
1654 Ga0501082_0347917 3300060353 Bacteria 1292

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046674 Ga0495588_0124350 Ga0495588_0124350_952_1335 125
2 3300005366 Ga0070659_100760004 Ga0070659_1007600041 145
3 3300025932 Ga0207690_11016117 Ga0207690_110161171 145
4 iso_pu_bacteria 2507262055 2507510897 145
5 iso_pu_bacteria 2508501009 2508544710 145
6 iso_pu_bacteria 2508501042 2508697062 145
7 iso_pu_bacteria 2511231028 2511394416 145
8 iso_pu_bacteria 2513237092 2513629152 145
9 iso_pu_bacteria 2513237095 2513649558 145
10 iso_pu_bacteria 2513237096 2513654912 145
11 iso_pu_bacteria 2513237104 2513719251 145
12 iso_pu_bacteria 2513237137 2513861290 145
13 iso_pu_bacteria 2513237139 2513874548 145
14 iso_pu_bacteria 2513237145 2513916065 145
15 iso_pu_bacteria 2513237161 2514015550 145
16 iso_pu_bacteria 2515154112 2515625559 145
17 iso_pu_bacteria 2517093001 2517100476 145
18 iso_pu_bacteria 2524023205 2524437337 145
19 iso_pu_bacteria 2524023228 2524534372 145
20 iso_pu_bacteria 2528768022 2528853223 145
21 iso_pu_bacteria 2602042107 2603861248 145
22 iso_pu_bacteria 2617270735 2617350654 145
23 iso_pu_bacteria 2643221547 2643755243 145
24 iso_pu_bacteria 2728368998 2728747709 145
25 iso_pu_bacteria 2744054633 2745076812 145
26 iso_pu_bacteria 2791355196 2793065180 145
27 iso_pu_bacteria 2791355197 2793072312 145
28 iso_pu_bacteria 2791355199 2793083120 145
29 iso_pu_bacteria 2802429603 2805916543 145
30 iso_pu_bacteria 2816332527 2818238028 145
31 iso_pu_bacteria 2824600985 2824606130 145
32 iso_pu_bacteria 2824609381 2824616042 145
33 iso_pu_bacteria 2824653114 2824657340 145
34 iso_pu_bacteria 2824661429 2824663091 145
35 iso_pu_bacteria 2824671348 2824676958 145
36 iso_pu_bacteria 2824679649 2824682047 145
37 iso_pu_bacteria 2824687955 2824693647 145
38 iso_pu_bacteria 2824696289 2824698718 145
39 iso_pu_bacteria 2824704595 2824706502 145
40 iso_pu_bacteria 2824753945 2824756950 145
41 iso_pu_bacteria 2824763712 2824769746 145
42 iso_pu_bacteria 2824773399 2824778483 145
43 iso_pu_bacteria 2838122688 2838127786 145
44 iso_pu_bacteria 2841941048 2841943079 145
45 iso_pu_bacteria 2841949485 2841956100 145
46 iso_pu_bacteria 2841957949 2841960328 145
47 iso_pu_bacteria 2841966195 2841968279 145
48 iso_pu_bacteria 2841974524 2841976507 145
49 iso_pu_bacteria 2841983080 2841987883 145
50 iso_pu_bacteria 2842038055 2842042818 145
51 iso_pu_bacteria 2842045827 2842050859 145
52 iso_pu_bacteria 2847930680 2847938460 145
53 iso_pu_bacteria 2847939898 2847944342 145
54 iso_pu_bacteria 2857509624 2857512077 145
55 iso_pu_bacteria 2857524615 2857530033 145
56 iso_pu_bacteria 2874590934 2874597622 145
57 iso_pu_bacteria 2874620515 2874623537 145
58 iso_pu_bacteria 2874628541 2874630526 145
59 iso_pu_bacteria 2874645413 2874649186 145
60 iso_pu_bacteria 2876761206 2876767788 145
61 iso_pu_bacteria 2876771140 2876774905 145
62 iso_pu_bacteria 2876818435 2876822343 145
63 iso_pu_bacteria 2879074833 2879077993 145
64 iso_pu_bacteria 2879083081 2879088699 145
65 iso_pu_bacteria 2879099564 2879103940 145
66 iso_pu_bacteria 2879110137 2879117936 145
67 iso_pu_bacteria 2879127579 2879132456 145
68 iso_pu_bacteria 2879142872 2879145244 145
69 iso_pu_bacteria 2881665667 2881667338 145
70 iso_pu_bacteria 2885374607 2885378077 145
71 iso_pu_bacteria 2885409591 2885416542 145
72 iso_pu_bacteria 2888378607 2888381655 145
73 iso_pu_bacteria 2888388044 2888388978 145
74 iso_pu_bacteria 2888419890 2888422045 145
75 iso_pu_bacteria 2889033259 2889033523 145
76 iso_pu_bacteria 2893066018 2893071044 145
77 iso_pu_bacteria 2903748898 2903758071 145
78 iso_pu_bacteria 2904666416 2904667659 145
79 iso_pu_bacteria 2904690495 2904697024 145
80 iso_pu_bacteria 2904699407 2904705665 145
81 iso_pu_bacteria 2904711408 2904719086 145
82 iso_pu_bacteria 2906610324 2906611366 145
83 iso_pu_bacteria 2906635258 2906641602 145
84 iso_pu_bacteria 2906660503 2906661306 145
85 iso_pu_bacteria 2908739725 2908744949 145
86 iso_pu_bacteria 2908756301 2908762707 145
87 iso_pu_bacteria 2919073203 2919077050 145
88 iso_pu_bacteria 2922368715 2922371325 145
89 iso_pu_bacteria 2922393267 2922393771 145
90 iso_pu_bacteria 2922425934 2922428009 145
91 iso_pu_bacteria 2929615660 2929619703 145
92 iso_pu_bacteria 2929624759 2929627826 145
93 iso_pu_bacteria 2932784394 2932786035 145
94 iso_pu_bacteria 2932794094 2932798197 145
95 iso_pu_bacteria 2932801729 2932803990 145
96 iso_pu_bacteria 2932809354 2932817017 145
97 iso_pu_bacteria 2932818245 2932822492 145
98 iso_pu_bacteria 2932828146 2932831079 145
99 iso_pu_bacteria 2933577622 2933581622 145
100 iso_pu_bacteria 2935608549 2935612885 145
101 iso_pu_bacteria 2935616580 2935624134 145
102 iso_pu_bacteria 2935630451 2935632074 145
103 iso_pu_bacteria 2935638405 2935640220 145
104 iso_pu_bacteria 2935648319 2935655010 145
105 iso_pu_bacteria 2935656913 2935663890 145
106 iso_pu_bacteria 2935665750 2935666942 145
107 iso_pu_bacteria 2935675223 2935680419 145
108 iso_pu_bacteria 2935684952 2935690073 145
109 iso_pu_bacteria 2935694250 2935699845 145
110 iso_pu_bacteria 2935703347 2935704697 145
111 iso_pu_bacteria 2935713505 2935722215 145
112 iso_pu_bacteria 2935722832 2935731524 145
113 iso_pu_bacteria 2935732158 2935735388 145
114 iso_pu_bacteria 2935741537 2935745341 145
115 iso_pu_bacteria 2935750917 2935755084 145
116 iso_pu_bacteria 2935760218 2935762402 145
117 iso_pu_bacteria 2935769743 2935775436 145
118 iso_pu_bacteria 2935777560 2935780338 145
119 iso_pu_bacteria 2935785616 2935790685 145
120 iso_pu_bacteria 2935793552 2935799132 145
121 iso_pu_bacteria 2935801545 2935803900 145
122 iso_pu_bacteria 2935810662 2935811818 145
123 iso_pu_bacteria 2935819856 2935824373 145
124 iso_pu_bacteria 2935827899 2935829703 145
125 iso_pu_bacteria 2935837841 2935842965 145
126 iso_pu_bacteria 2935847175 2935852482 145
127 iso_pu_bacteria 2935855204 2935862366 145
128 iso_pu_bacteria 2935864058 2935870501 145
129 iso_pu_bacteria 2935873716 2935881083 145
130 iso_pu_bacteria 2935883170 2935884204 145
131 iso_pu_bacteria 2935908558 2935912363 145
132 iso_pu_bacteria 2935916978 2935923963 145
133 iso_pu_bacteria 2935926038 2935929392 145
134 iso_pu_bacteria 2935934488 2935936023 145
135 iso_pu_bacteria 2935942939 2935949923 145
136 iso_pu_bacteria 2935951376 2935957311 145
137 iso_pu_bacteria 2935959822 2935962170 145
138 iso_pu_bacteria 2935967501 2935968342 145
139 iso_pu_bacteria 2935975950 2935976528 145
140 iso_pu_bacteria 2935984226 2935988026 145
141 iso_pu_bacteria 2935992306 2935993580 145
142 iso_pu_bacteria 2936002035 2936004476 145
143 iso_pu_bacteria 2936011229 2936018041 145
144 iso_pu_bacteria 2936019824 2936026549 145
145 iso_pu_bacteria 2936028420 2936035292 145
146 iso_pu_bacteria 2936037263 2936038401 145
147 iso_pu_bacteria 2936046547 2936053436 145
148 iso_pu_bacteria 2936055302 2936059417 145
149 iso_pu_bacteria 2940556831 2940561636 145
150 iso_pu_bacteria 2941507105 2941508022 145
151 iso_pu_bacteria 2941515067 2941515473 145
152 iso_pu_bacteria 2941523033 2941523952 145
153 iso_pu_bacteria 2941531003 2941533815 145
154 iso_pu_bacteria 2941538514 2941544189 145
155 iso_pu_bacteria 3005474847 3005477707 145
156 iso_pu_bacteria 3005594810 3005596676 145
157 iso_pu_bacteria 8006933436 8006933510 145
158 iso_pu_bacteria 8006973647 8006983183 145
159 iso_pu_bacteria 8006984368 8006989262 145
160 iso_pu_bacteria 8016511872 8016516302 145
161 iso_pu_bacteria 8016522445 8016523698 145
162 iso_pu_bacteria 8016530956 8016537221 145
163 iso_pu_bacteria 8016539877 8016541481 145
164 iso_pu_bacteria 8016548790 8016551772 145
165 iso_pu_bacteria 8016557553 8016560162 145
166 iso_pu_bacteria 8016566248 8016566873 145
167 iso_pu_bacteria 8016575299 8016579605 145
168 iso_pu_bacteria 8016595262 8016598079 145
169 iso_pu_bacteria 8016603502 8016604218 145
170 iso_pu_bacteria 8016613128 8016620800 145
171 iso_pu_bacteria 8016622563 8016629187 145
172 iso_pu_bacteria 8016630954 8016633712 145
173 iso_pu_bacteria 8017057580 8017060232 145
174 iso_pu_bacteria 8019530166 8019536910 145
175 iso_pu_bacteria 8019538911 8019542618 145
176 iso_pu_bacteria 8019547302 8019548117 145
177 iso_pu_bacteria 8019576017 8019579754 145
178 iso_pu_bacteria 8019586578 8019587464 145
179 iso_pu_bacteria 8019597564 8019603879 145
180 iso_pu_bacteria 8019608314 8019614660 145
181 iso_pu_bacteria 8019619141 8019625271 145
182 iso_pu_bacteria 8019629233 8019636910 145
183 iso_pu_bacteria 8019638758 8019642697 145
184 iso_pu_bacteria 8019648815 8019649889 145
185 iso_pu_bacteria 8019659431 8019664730 145
186 iso_pu_bacteria 8019668869 8019674316 145
187 iso_pu_bacteria 8019678201 8019681801 145
188 iso_pu_bacteria 8055742211 8055749041 145
189 iso_pu_bacteria 8056967851 8056969890 145
190 3300005353 Ga0070669_101447885 Ga0070669_1014478851 146
191 3300005355 Ga0070671_101486568 Ga0070671_1014865681 146
192 3300005364 Ga0070673_100153511 Ga0070673_1001535113 146
193 3300005543 Ga0070672_100816723 Ga0070672_1008167232 146
194 3300005577 Ga0068857_100828220 Ga0068857_1008282201 146
195 3300005985 Ga0081539_10000008 Ga0081539_100000081 146
196 3300006195 Ga0075366_10270509 Ga0075366_102705092 146
197 3300006844 Ga0075428_100843747 Ga0075428_1008437472 146
198 3300009094 Ga0111539_10188422 Ga0111539_101884223 146
199 3300009094 Ga0111539_10659240 Ga0111539_106592402 146
200 3300009098 Ga0105245_10607399 Ga0105245_106073992 146
201 3300011119 Ga0105246_10579784 Ga0105246_105797842 146
202 3300013296 Ga0157374_11052100 Ga0157374_110521001 146
203 3300013297 Ga0157378_10249166 Ga0157378_102491662 146
204 3300013306 Ga0163162_10735665 Ga0163162_107356652 146
205 3300014326 Ga0157380_11033756 Ga0157380_110337562 146
206 3300017792 Ga0163161_11800366 Ga0163161_118003661 146
207 3300025907 Ga0207645_10473006 Ga0207645_104730061 146
208 3300025923 Ga0207681_10239480 Ga0207681_102394802 146
209 3300025924 Ga0207694_11004218 Ga0207694_110042181 146
210 3300025926 Ga0207659_10329702 Ga0207659_103297021 146
211 3300025940 Ga0207691_10156366 Ga0207691_101563662 146
212 3300025960 Ga0207651_10360164 Ga0207651_103601642 146
213 3300025972 Ga0207668_11206295 Ga0207668_112062951 146
214 3300026089 Ga0207648_10266420 Ga0207648_102664201 146
215 3300026095 Ga0207676_10883904 Ga0207676_108839042 146
216 3300026116 Ga0207674_11028151 Ga0207674_110281512 146
217 3300027907 Ga0207428_10353908 Ga0207428_103539082 146
218 3300031247 Ga0265340_10014105 Ga0265340_100141053 146
219 3300031249 Ga0265339_10067321 Ga0265339_100673213 146
220 3300039437 Ga0436365_0276774 Ga0436365_0276774_63_503 146
221 3300048904 Ga0496101_1189213 Ga0496101_1189213_53_493 146
222 3300050493 nmdc:mga0k408_73771_c1 nmdc:mga0k408_73771_c1_239_688 146
223 3300050511 nmdc:mga08y16_120205_c1 nmdc:mga08y16_120205_c1_1927_2376 146
224 3300005336 Ga0070680_101545674 Ga0070680_1015456741 147
225 3300005618 Ga0068864_101432327 Ga0068864_1014323272 147
226 3300005842 Ga0068858_101203786 Ga0068858_1012037862 147
227 3300006871 Ga0075434_100890683 Ga0075434_1008906831 147
228 3300009148 Ga0105243_10480224 Ga0105243_104802242 147
229 3300013296 Ga0157374_11262369 Ga0157374_112623691 147
230 3300025911 Ga0207654_10149230 Ga0207654_101492302 147
231 3300028573 Ga0265334_10074909 Ga0265334_100749092 147
232 3300028577 Ga0265318_10077310 Ga0265318_100773102 147
233 3300028800 Ga0265338_10949659 Ga0265338_109496591 147
234 3300031235 Ga0265330_10112575 Ga0265330_101125752 147
235 3300031240 Ga0265320_10052783 Ga0265320_100527832 147
236 3300031247 Ga0265340_10155304 Ga0265340_101553042 147
237 3300031249 Ga0265339_10208319 Ga0265339_102083192 147
238 3300031250 Ga0265331_10013745 Ga0265331_100137453 147
239 3300031344 Ga0265316_10114448 Ga0265316_101144483 147
240 3300031595 Ga0265313_10007286 Ga0265313_100072864 147
241 3300031711 Ga0265314_10069141 Ga0265314_100691412 147
242 3300031712 Ga0265342_10029554 Ga0265342_100295542 147
243 3300049569 Ga0501032_0001266 Ga0501032_0001266_13806_14255 147
244 3300049574 Ga0501038_0000133 Ga0501038_0000133_5636_6085 147
245 3300049582 Ga0501048_0000306 Ga0501048_0000306_22705_23154 147
246 3300049583 Ga0501067_0001472 Ga0501067_0001472_3953_4402 147
247 3300049584 Ga0501068_0017076 Ga0501068_0017076_1630_2079 147
248 3300049585 Ga0501069_0009809 Ga0501069_0009809_3285_3734 147
249 3300060353 Ga0501082_0006966 Ga0501082_0006966_4929_5378 147
250 3300005293 Ga0065715_10166218 Ga0065715_101662182 148
251 3300005335 Ga0070666_10008638 Ga0070666_100086385 148
252 3300005347 Ga0070668_100120988 Ga0070668_1001209883 148
253 3300005356 Ga0070674_100258298 Ga0070674_1002582982 148
254 3300005365 Ga0070688_100861205 Ga0070688_1008612051 148
255 3300005365 Ga0070688_100986016 Ga0070688_1009860161 148
256 3300005367 Ga0070667_100016970 Ga0070667_1000169702 148
257 3300005543 Ga0070672_100012165 Ga0070672_1000121653 148
258 3300005548 Ga0070665_100002836 Ga0070665_10000283614 148
259 3300005548 Ga0070665_102292314 Ga0070665_1022923141 148
260 3300005617 Ga0068859_100998106 Ga0068859_1009981062 148
261 3300005718 Ga0068866_10975709 Ga0068866_109757091 148
262 3300006237 Ga0097621_100056750 Ga0097621_1000567502 148
263 3300006358 Ga0068871_100438932 Ga0068871_1004389322 148
264 3300006881 Ga0068865_100096067 Ga0068865_1000960674 148
265 3300006931 Ga0097620_100998217 Ga0097620_1009982172 148
266 3300009177 Ga0105248_10308481 Ga0105248_103084812 148
267 3300013296 Ga0157374_10432369 Ga0157374_104323692 148
268 3300013297 Ga0157378_10257551 Ga0157378_102575512 148
269 3300013306 Ga0163162_11157027 Ga0163162_111570272 148
270 3300013308 Ga0157375_10101270 Ga0157375_101012703 148
271 3300014969 Ga0157376_10008762 Ga0157376_100087624 148
272 3300025903 Ga0207680_10085545 Ga0207680_100855454 148
273 3300025937 Ga0207669_10251934 Ga0207669_102519342 148
274 3300025940 Ga0207691_10093331 Ga0207691_100933313 148
275 3300025941 Ga0207711_10442707 Ga0207711_104427072 148
276 3300025986 Ga0207658_10030927 Ga0207658_100309272 148
277 3300026121 Ga0207683_10123996 Ga0207683_101239963 148
278 3300026121 Ga0207683_12084583 Ga0207683_120845831 148
279 3300028379 Ga0268266_10009595 Ga0268266_100095953 148
280 3300028794 Ga0307515_10000138 Ga0307515_10000138135 148
281 3300030522 Ga0307512_10014863 Ga0307512_100148637 148
282 3300031235 Ga0265330_10064203 Ga0265330_100642032 148
283 3300039437 Ga0436365_0088538 Ga0436365_0088538_33_518 148
284 3300044658 Ga0466972_0304179 Ga0466972_0304179_76_603 148
285 3300046506 Ga0495583_0012826 Ga0495583_0012826_2273_2743 148
286 3300046683 Ga0495658_0457918 Ga0495658_0457918_253_723 148
287 3300047447 Ga0495685_059079 Ga0495685_059079_128_598 148
288 3300048904 Ga0496101_0188809 Ga0496101_0188809_1019_1489 148
289 3300048905 Ga0496102_0855582 Ga0496102_0855582_304_774 148
290 3300048906 Ga0496103_0206929 Ga0496103_0206929_422_892 148
291 3300048908 Ga0496105_0335751 Ga0496105_0335751_168_638 148
292 3300048910 Ga0496107_0852801 Ga0496107_0852801_38_508 148
293 3300048911 Ga0496108_0410058 Ga0496108_0410058_267_737 148
294 3300048912 Ga0496109_0172858 Ga0496109_0172858_1526_1996 148
295 3300048914 Ga0496111_0393252 Ga0496111_0393252_234_704 148
296 2209111006 2214814962 2213849004 149
297 3300001989 JGI24739J22299_10053737 JGI24739J22299_100537372 149
298 3300001990 JGI24737J22298_10172787 JGI24737J22298_101727871 149
299 3300002075 JGI24738J21930_10096315 JGI24738J21930_100963152 149
300 3300002244 JGI24742J22300_10017201 JGI24742J22300_100172012 149
301 3300002459 JGI24751J29686_10040469 JGI24751J29686_100404692 149
302 3300003215 JGI25153J46596_10001613 JGI25153J46596_100016134 149
303 3300003215 JGI25153J46596_10006408 JGI25153J46596_100064085 149
304 3300003354 JGI25160J50197_1002315 JGI25160J50197_10023156 149
305 3300003354 JGI25160J50197_1017116 JGI25160J50197_10171164 149
306 3300003762 Ga0055542_1010193 Ga0055542_10101932 149
307 3300003763 Ga0055529_1011412 Ga0055529_10114121 149
308 3300004799 Ga0058863_11267463 Ga0058863_112674631 149
309 3300005262 Ga0065165_1000437 Ga0065165_100043742 149
310 3300005262 Ga0065165_1001951 Ga0065165_100195114 149
311 3300005290 Ga0065712_10184569 Ga0065712_101845692 149
312 3300005327 Ga0070658_10214222 Ga0070658_102142221 149
313 3300005328 Ga0070676_10125466 Ga0070676_101254663 149
314 3300005328 Ga0070676_10127094 Ga0070676_101270942 149
315 3300005328 Ga0070676_10187090 Ga0070676_101870902 149
316 3300005328 Ga0070676_10341808 Ga0070676_103418081 149
317 3300005329 Ga0070683_100162394 Ga0070683_1001623943 149
318 3300005329 Ga0070683_101478914 Ga0070683_1014789141 149
319 3300005330 Ga0070690_100193209 Ga0070690_1001932091 149
320 3300005330 Ga0070690_100239189 Ga0070690_1002391892 149
321 3300005331 Ga0070670_100271810 Ga0070670_1002718102 149
322 3300005331 Ga0070670_101093918 Ga0070670_1010939181 149
323 3300005331 Ga0070670_101177805 Ga0070670_1011778051 149
324 3300005333 Ga0070677_10029717 Ga0070677_100297172 149
325 3300005333 Ga0070677_10094607 Ga0070677_100946071 149
326 3300005334 Ga0068869_100267014 Ga0068869_1002670142 149
327 3300005334 Ga0068869_100269471 Ga0068869_1002694712 149
328 3300005335 Ga0070666_10075916 Ga0070666_100759162 149
329 3300005335 Ga0070666_10268351 Ga0070666_102683511 149
330 3300005336 Ga0070680_100018027 Ga0070680_1000180274 149
331 3300005338 Ga0068868_100024743 Ga0068868_1000247432 149
332 3300005338 Ga0068868_100140422 Ga0068868_1001404222 149
333 3300005338 Ga0068868_100148090 Ga0068868_1001480903 149
334 3300005338 Ga0068868_100174997 Ga0068868_1001749971 149
335 3300005338 Ga0068868_101017958 Ga0068868_1010179582 149
336 3300005338 Ga0068868_101117733 Ga0068868_1011177331 149
337 3300005339 Ga0070660_100364427 Ga0070660_1003644271 149
338 3300005339 Ga0070660_100372110 Ga0070660_1003721101 149
339 3300005339 Ga0070660_100903632 Ga0070660_1009036321 149
340 3300005339 Ga0070660_101134627 Ga0070660_1011346271 149
341 3300005340 Ga0070689_101261410 Ga0070689_1012614101 149
342 3300005341 Ga0070691_10096833 Ga0070691_100968332 149
343 3300005343 Ga0070687_100138119 Ga0070687_1001381192 149
344 3300005343 Ga0070687_100542160 Ga0070687_1005421601 149
345 3300005343 Ga0070687_100673168 Ga0070687_1006731681 149
346 3300005344 Ga0070661_100084660 Ga0070661_1000846602 149
347 3300005347 Ga0070668_100320806 Ga0070668_1003208062 149
348 3300005353 Ga0070669_100172181 Ga0070669_1001721812 149
349 3300005353 Ga0070669_100336845 Ga0070669_1003368451 149
350 3300005353 Ga0070669_100688319 Ga0070669_1006883192 149
351 3300005353 Ga0070669_100834424 Ga0070669_1008344242 149
352 3300005354 Ga0070675_100242240 Ga0070675_1002422401 149
353 3300005354 Ga0070675_100522162 Ga0070675_1005221622 149
354 3300005354 Ga0070675_100686590 Ga0070675_1006865901 149
355 3300005354 Ga0070675_101261938 Ga0070675_1012619381 149
356 3300005355 Ga0070671_100006274 Ga0070671_1000062744 149
357 3300005355 Ga0070671_100483066 Ga0070671_1004830661 149
358 3300005355 Ga0070671_100912787 Ga0070671_1009127872 149
359 3300005356 Ga0070674_100074733 Ga0070674_1000747333 149
360 3300005356 Ga0070674_100392083 Ga0070674_1003920831 149
361 3300005364 Ga0070673_100116311 Ga0070673_1001163113 149
362 3300005364 Ga0070673_100413045 Ga0070673_1004130451 149
363 3300005364 Ga0070673_100480292 Ga0070673_1004802921 149
364 3300005365 Ga0070688_100251830 Ga0070688_1002518301 149
365 3300005365 Ga0070688_100395623 Ga0070688_1003956231 149
366 3300005366 Ga0070659_100182395 Ga0070659_1001823951 149
367 3300005366 Ga0070659_100237636 Ga0070659_1002376362 149
368 3300005366 Ga0070659_100482612 Ga0070659_1004826122 149
369 3300005366 Ga0070659_100574413 Ga0070659_1005744131 149
370 3300005366 Ga0070659_101167680 Ga0070659_1011676801 149
371 3300005367 Ga0070667_100274656 Ga0070667_1002746562 149
372 3300005367 Ga0070667_100275142 Ga0070667_1002751422 149
373 3300005367 Ga0070667_100986553 Ga0070667_1009865532 149
374 3300005367 Ga0070667_101290568 Ga0070667_1012905681 149
375 3300005406 Ga0070703_10112008 Ga0070703_101120081 149
376 3300005434 Ga0070709_10426569 Ga0070709_104265692 149
377 3300005434 Ga0070709_10534843 Ga0070709_105348432 149
378 3300005434 Ga0070709_11375871 Ga0070709_113758711 149
379 3300005434 Ga0070709_11453862 Ga0070709_114538621 149
380 3300005435 Ga0070714_102210494 Ga0070714_1022104941 149
381 3300005435 Ga0070714_102483409 Ga0070714_1024834091 149
382 3300005436 Ga0070713_100932763 Ga0070713_1009327631 149
383 3300005438 Ga0070701_10666884 Ga0070701_106668841 149
384 3300005439 Ga0070711_100575500 Ga0070711_1005755001 149
385 3300005439 Ga0070711_100686924 Ga0070711_1006869241 149
386 3300005439 Ga0070711_100829331 Ga0070711_1008293312 149
387 3300005439 Ga0070711_101422535 Ga0070711_1014225351 149
388 3300005440 Ga0070705_100434794 Ga0070705_1004347942 149
389 3300005441 Ga0070700_100048865 Ga0070700_1000488653 149
390 3300005441 Ga0070700_100076673 Ga0070700_1000766732 149
391 3300005441 Ga0070700_100719204 Ga0070700_1007192042 149
392 3300005455 Ga0070663_100041743 Ga0070663_1000417432 149
393 3300005455 Ga0070663_100046047 Ga0070663_1000460472 149
394 3300005455 Ga0070663_100166126 Ga0070663_1001661262 149
395 3300005455 Ga0070663_100172906 Ga0070663_1001729062 149
396 3300005455 Ga0070663_100675713 Ga0070663_1006757132 149
397 3300005455 Ga0070663_100697163 Ga0070663_1006971631 149
398 3300005456 Ga0070678_100040131 Ga0070678_1000401314 149
399 3300005456 Ga0070678_100074215 Ga0070678_1000742152 149
400 3300005456 Ga0070678_100287658 Ga0070678_1002876582 149
401 3300005456 Ga0070678_100313726 Ga0070678_1003137262 149
402 3300005456 Ga0070678_100386189 Ga0070678_1003861891 149
403 3300005456 Ga0070678_100443219 Ga0070678_1004432191 149
404 3300005456 Ga0070678_101436922 Ga0070678_1014369221 149
405 3300005457 Ga0070662_100038911 Ga0070662_1000389112 149
406 3300005457 Ga0070662_100336141 Ga0070662_1003361412 149
407 3300005458 Ga0070681_10009008 Ga0070681_100090086 149
408 3300005458 Ga0070681_10020592 Ga0070681_100205925 149
409 3300005458 Ga0070681_10029069 Ga0070681_100290693 149
410 3300005458 Ga0070681_10577783 Ga0070681_105777832 149
411 3300005459 Ga0068867_100047151 Ga0068867_1000471512 149
412 3300005459 Ga0068867_101153755 Ga0068867_1011537551 149
413 3300005466 Ga0070685_10075464 Ga0070685_100754642 149
414 3300005466 Ga0070685_10740491 Ga0070685_107404911 149
415 3300005471 Ga0070698_100152883 Ga0070698_1001528832 149
416 3300005518 Ga0070699_100051453 Ga0070699_1000514533 149
417 3300005530 Ga0070679_100013970 Ga0070679_1000139703 149
418 3300005530 Ga0070679_100051260 Ga0070679_1000512602 149
419 3300005530 Ga0070679_100069459 Ga0070679_1000694594 149
420 3300005530 Ga0070679_100216670 Ga0070679_1002166702 149
421 3300005530 Ga0070679_100293284 Ga0070679_1002932842 149
422 3300005530 Ga0070679_100743704 Ga0070679_1007437042 149
423 3300005530 Ga0070679_100876830 Ga0070679_1008768301 149
424 3300005535 Ga0070684_100008399 Ga0070684_1000083998 149
425 3300005535 Ga0070684_100167686 Ga0070684_1001676862 149
426 3300005535 Ga0070684_101236178 Ga0070684_1012361781 149
427 3300005539 Ga0068853_100083711 Ga0068853_1000837112 149
428 3300005539 Ga0068853_100304238 Ga0068853_1003042382 149
429 3300005539 Ga0068853_100699513 Ga0068853_1006995131 149
430 3300005539 Ga0068853_101209706 Ga0068853_1012097061 149
431 3300005539 Ga0068853_101684408 Ga0068853_1016844081 149
432 3300005543 Ga0070672_100059526 Ga0070672_1000595263 149
433 3300005543 Ga0070672_100141674 Ga0070672_1001416742 149
434 3300005543 Ga0070672_101297178 Ga0070672_1012971781 149
435 3300005544 Ga0070686_100045395 Ga0070686_1000453954 149
436 3300005544 Ga0070686_100718183 Ga0070686_1007181832 149
437 3300005546 Ga0070696_100770705 Ga0070696_1007707052 149
438 3300005547 Ga0070693_100110410 Ga0070693_1001104103 149
439 3300005547 Ga0070693_100127685 Ga0070693_1001276853 149
440 3300005548 Ga0070665_100020991 Ga0070665_1000209918 149
441 3300005548 Ga0070665_100090862 Ga0070665_1000908622 149
442 3300005548 Ga0070665_100361634 Ga0070665_1003616341 149
443 3300005548 Ga0070665_100394107 Ga0070665_1003941072 149
444 3300005548 Ga0070665_100414850 Ga0070665_1004148502 149
445 3300005548 Ga0070665_100954742 Ga0070665_1009547422 149
446 3300005548 Ga0070665_101004452 Ga0070665_1010044522 149
447 3300005549 Ga0070704_101806829 Ga0070704_1018068291 149
448 3300005563 Ga0068855_100048966 Ga0068855_1000489666 149
449 3300005563 Ga0068855_100118628 Ga0068855_1001186283 149
450 3300005563 Ga0068855_100382227 Ga0068855_1003822272 149
451 3300005563 Ga0068855_100424140 Ga0068855_1004241402 149
452 3300005563 Ga0068855_100578959 Ga0068855_1005789592 149
453 3300005563 Ga0068855_100885109 Ga0068855_1008851092 149
454 3300005563 Ga0068855_100953314 Ga0068855_1009533141 149
455 3300005563 Ga0068855_101221266 Ga0068855_1012212662 149
456 3300005563 Ga0068855_101249644 Ga0068855_1012496441 149
457 3300005564 Ga0070664_100055443 Ga0070664_1000554433 149
458 3300005564 Ga0070664_100724271 Ga0070664_1007242711 149
459 3300005564 Ga0070664_101159151 Ga0070664_1011591512 149
460 3300005564 Ga0070664_101184430 Ga0070664_1011844301 149
461 3300005564 Ga0070664_101988826 Ga0070664_1019888261 149
462 3300005577 Ga0068857_100050231 Ga0068857_1000502314 149
463 3300005577 Ga0068857_100076130 Ga0068857_1000761302 149
464 3300005577 Ga0068857_100787166 Ga0068857_1007871662 149
465 3300005577 Ga0068857_101349550 Ga0068857_1013495501 149
466 3300005578 Ga0068854_100132186 Ga0068854_1001321861 149
467 3300005578 Ga0068854_100181384 Ga0068854_1001813842 149
468 3300005578 Ga0068854_100293190 Ga0068854_1002931902 149
469 3300005614 Ga0068856_100115016 Ga0068856_1001150164 149
470 3300005614 Ga0068856_100141100 Ga0068856_1001411003 149
471 3300005614 Ga0068856_100604436 Ga0068856_1006044361 149
472 3300005614 Ga0068856_100720495 Ga0068856_1007204952 149
473 3300005614 Ga0068856_101739441 Ga0068856_1017394412 149
474 3300005615 Ga0070702_100012071 Ga0070702_1000120712 149
475 3300005615 Ga0070702_100314450 Ga0070702_1003144501 149
476 3300005616 Ga0068852_100009742 Ga0068852_1000097423 149
477 3300005616 Ga0068852_100027366 Ga0068852_1000273663 149
478 3300005616 Ga0068852_100197310 Ga0068852_1001973102 149
479 3300005616 Ga0068852_100243561 Ga0068852_1002435612 149
480 3300005616 Ga0068852_100801266 Ga0068852_1008012661 149
481 3300005617 Ga0068859_100068797 Ga0068859_1000687972 149
482 3300005617 Ga0068859_100280933 Ga0068859_1002809332 149
483 3300005617 Ga0068859_100760486 Ga0068859_1007604862 149
484 3300005617 Ga0068859_100871492 Ga0068859_1008714922 149
485 3300005617 Ga0068859_101513048 Ga0068859_1015130482 149
486 3300005618 Ga0068864_100183815 Ga0068864_1001838152 149
487 3300005618 Ga0068864_100377581 Ga0068864_1003775811 149
488 3300005618 Ga0068864_100531768 Ga0068864_1005317681 149
489 3300005718 Ga0068866_10067829 Ga0068866_100678291 149
490 3300005718 Ga0068866_10076509 Ga0068866_100765092 149
491 3300005718 Ga0068866_10112938 Ga0068866_101129382 149
492 3300005718 Ga0068866_10941699 Ga0068866_109416991 149
493 3300005719 Ga0068861_100026582 Ga0068861_1000265822 149
494 3300005719 Ga0068861_100121826 Ga0068861_1001218262 149
495 3300005719 Ga0068861_100646204 Ga0068861_1006462042 149
496 3300005719 Ga0068861_100650641 Ga0068861_1006506412 149
497 3300005840 Ga0068870_10148608 Ga0068870_101486082 149
498 3300005840 Ga0068870_10237005 Ga0068870_102370051 149
499 3300005840 Ga0068870_10281989 Ga0068870_102819892 149
500 3300005840 Ga0068870_10326224 Ga0068870_103262242 149
501 3300005840 Ga0068870_11111921 Ga0068870_111119211 149
502 3300005841 Ga0068863_100178497 Ga0068863_1001784973 149
503 3300005841 Ga0068863_100883288 Ga0068863_1008832882 149
504 3300005842 Ga0068858_100207125 Ga0068858_1002071252 149
505 3300005842 Ga0068858_100523554 Ga0068858_1005235542 149
506 3300005842 Ga0068858_100655991 Ga0068858_1006559912 149
507 3300005842 Ga0068858_101090867 Ga0068858_1010908672 149
508 3300005843 Ga0068860_100184261 Ga0068860_1001842613 149
509 3300005843 Ga0068860_100254850 Ga0068860_1002548502 149
510 3300005843 Ga0068860_100721029 Ga0068860_1007210292 149
511 3300005843 Ga0068860_100811235 Ga0068860_1008112352 149
512 3300005844 Ga0068862_100054909 Ga0068862_1000549094 149
513 3300005844 Ga0068862_100401356 Ga0068862_1004013562 149
514 3300005844 Ga0068862_100429423 Ga0068862_1004294232 149
515 3300005937 Ga0081455_10005318 Ga0081455_1000531812 149
516 3300005937 Ga0081455_10050771 Ga0081455_100507713 149
517 3300005937 Ga0081455_10221734 Ga0081455_102217342 149
518 3300005983 Ga0081540_1010304 Ga0081540_10103043 149
519 3300005983 Ga0081540_1017033 Ga0081540_10170331 149
520 3300005983 Ga0081540_1336585 Ga0081540_13365851 149
521 3300005985 Ga0081539_10033177 Ga0081539_100331772 149
522 3300005985 Ga0081539_10158269 Ga0081539_101582692 149
523 3300006038 Ga0075365_10006261 Ga0075365_100062616 149
524 3300006038 Ga0075365_10093449 Ga0075365_100934492 149
525 3300006038 Ga0075365_10161152 Ga0075365_101611522 149
526 3300006038 Ga0075365_10391589 Ga0075365_103915891 149
527 3300006038 Ga0075365_10638562 Ga0075365_106385621 149
528 3300006042 Ga0075368_10125154 Ga0075368_101251541 149
529 3300006042 Ga0075368_10155787 Ga0075368_101557872 149
530 3300006042 Ga0075368_10418012 Ga0075368_104180121 149
531 3300006048 Ga0075363_100017307 Ga0075363_1000173075 149
532 3300006048 Ga0075363_100039953 Ga0075363_1000399532 149
533 3300006048 Ga0075363_100337333 Ga0075363_1003373331 149
534 3300006051 Ga0075364_10014626 Ga0075364_100146265 149
535 3300006051 Ga0075364_10036555 Ga0075364_100365554 149
536 3300006051 Ga0075364_10047544 Ga0075364_100475443 149
537 3300006051 Ga0075364_10141493 Ga0075364_101414932 149
538 3300006051 Ga0075364_10716470 Ga0075364_107164702 149
539 3300006175 Ga0070712_100537832 Ga0070712_1005378321 149
540 3300006175 Ga0070712_100759626 Ga0070712_1007596261 149
541 3300006177 Ga0075362_10042082 Ga0075362_100420822 149
542 3300006177 Ga0075362_10133856 Ga0075362_101338562 149
543 3300006177 Ga0075362_10202294 Ga0075362_102022943 149
544 3300006177 Ga0075362_10230203 Ga0075362_102302031 149
545 3300006177 Ga0075362_10551560 Ga0075362_105515601 149
546 3300006178 Ga0075367_10297684 Ga0075367_102976841 149
547 3300006178 Ga0075367_10305623 Ga0075367_103056232 149
548 3300006178 Ga0075367_10528756 Ga0075367_105287562 149
549 3300006178 Ga0075367_11029911 Ga0075367_110299111 149
550 3300006186 Ga0075369_10058083 Ga0075369_100580832 149
551 3300006186 Ga0075369_10070652 Ga0075369_100706522 149
552 3300006195 Ga0075366_10001094 Ga0075366_100010949 149
553 3300006195 Ga0075366_10215725 Ga0075366_102157252 149
554 3300006195 Ga0075366_10298268 Ga0075366_102982681 149
555 3300006195 Ga0075366_10466057 Ga0075366_104660572 149
556 3300006237 Ga0097621_100035743 Ga0097621_1000357435 149
557 3300006237 Ga0097621_100055409 Ga0097621_1000554094 149
558 3300006237 Ga0097621_100232958 Ga0097621_1002329583 149
559 3300006237 Ga0097621_100261967 Ga0097621_1002619672 149
560 3300006237 Ga0097621_101122735 Ga0097621_1011227351 149
561 3300006237 Ga0097621_101189075 Ga0097621_1011890752 149
562 3300006353 Ga0075370_10121882 Ga0075370_101218822 149
563 3300006353 Ga0075370_10307095 Ga0075370_103070952 149
564 3300006353 Ga0075370_10310308 Ga0075370_103103082 149
565 3300006353 Ga0075370_10354444 Ga0075370_103544442 149
566 3300006353 Ga0075370_10428933 Ga0075370_104289332 149
567 3300006358 Ga0068871_100090290 Ga0068871_1000902903 149
568 3300006358 Ga0068871_100315688 Ga0068871_1003156882 149
569 3300006358 Ga0068871_100369057 Ga0068871_1003690572 149
570 3300006358 Ga0068871_100868243 Ga0068871_1008682432 149
571 3300006844 Ga0075428_102153653 Ga0075428_1021536531 149
572 3300006847 Ga0075431_100991661 Ga0075431_1009916611 149
573 3300006871 Ga0075434_100304337 Ga0075434_1003043373 149
574 3300006880 Ga0075429_100660807 Ga0075429_1006608072 149
575 3300006881 Ga0068865_100029057 Ga0068865_1000290572 149
576 3300006881 Ga0068865_100166160 Ga0068865_1001661601 149
577 3300006881 Ga0068865_100889627 Ga0068865_1008896271 149
578 3300006881 Ga0068865_101396759 Ga0068865_1013967591 149
579 3300006914 Ga0075436_100119212 Ga0075436_1001192122 149
580 3300006931 Ga0097620_100068794 Ga0097620_1000687942 149
581 3300006931 Ga0097620_100280945 Ga0097620_1002809452 149
582 3300006931 Ga0097620_100760482 Ga0097620_1007604822 149
583 3300006931 Ga0097620_100871523 Ga0097620_1008715232 149
584 3300006931 Ga0097620_101512944 Ga0097620_1015129442 149
585 3300006941 Ga0099825_1018382 Ga0099825_10183825 149
586 3300006942 Ga0099824_1026579 Ga0099824_10265792 149
587 3300006944 Ga0099823_1033130 Ga0099823_10331305 149
588 3300007076 Ga0075435_100114100 Ga0075435_1001141001 149
589 3300007076 Ga0075435_100155415 Ga0075435_1001554152 149
590 3300007788 Ga0099795_10065487 Ga0099795_100654872 149
591 3300009092 Ga0105250_10045585 Ga0105250_100455852 149
592 3300009093 Ga0105240_10013828 Ga0105240_100138284 149
593 3300009093 Ga0105240_10027519 Ga0105240_100275197 149
594 3300009093 Ga0105240_10044366 Ga0105240_100443666 149
595 3300009093 Ga0105240_10138125 Ga0105240_101381254 149
596 3300009093 Ga0105240_10262166 Ga0105240_102621661 149
597 3300009093 Ga0105240_10440058 Ga0105240_104400582 149
598 3300009093 Ga0105240_12380091 Ga0105240_123800911 149
599 3300009094 Ga0111539_11053311 Ga0111539_110533111 149
600 3300009098 Ga0105245_10009595 Ga0105245_100095952 149
601 3300009098 Ga0105245_10050761 Ga0105245_100507612 149
602 3300009098 Ga0105245_10078640 Ga0105245_100786403 149
603 3300009098 Ga0105245_10522359 Ga0105245_105223592 149
604 3300009098 Ga0105245_10542236 Ga0105245_105422362 149
605 3300009101 Ga0105247_10085968 Ga0105247_100859682 149
606 3300009101 Ga0105247_10181627 Ga0105247_101816272 149
607 3300009101 Ga0105247_10181866 Ga0105247_101818662 149
608 3300009101 Ga0105247_10192544 Ga0105247_101925442 149
609 3300009101 Ga0105247_10202702 Ga0105247_102027022 149
610 3300009101 Ga0105247_10240311 Ga0105247_102403112 149
611 3300009101 Ga0105247_10282214 Ga0105247_102822141 149
612 3300009101 Ga0105247_10382440 Ga0105247_103824402 149
613 3300009101 Ga0105247_10602714 Ga0105247_106027141 149
614 3300009147 Ga0114129_10945285 Ga0114129_109452851 149
615 3300009147 Ga0114129_11426653 Ga0114129_114266532 149
616 3300009148 Ga0105243_10115754 Ga0105243_101157543 149
617 3300009148 Ga0105243_10545240 Ga0105243_105452402 149
618 3300009148 Ga0105243_11234157 Ga0105243_112341572 149
619 3300009148 Ga0105243_11286594 Ga0105243_112865941 149
620 3300009148 Ga0105243_12080973 Ga0105243_120809731 149
621 3300009174 Ga0105241_10018533 Ga0105241_100185332 149
622 3300009174 Ga0105241_10030488 Ga0105241_100304883 149
623 3300009174 Ga0105241_10044097 Ga0105241_100440972 149
624 3300009174 Ga0105241_10077496 Ga0105241_100774961 149
625 3300009174 Ga0105241_11839943 Ga0105241_118399431 149
626 3300009174 Ga0105241_11869337 Ga0105241_118693371 149
627 3300009176 Ga0105242_10031555 Ga0105242_100315554 149
628 3300009176 Ga0105242_10232529 Ga0105242_102325292 149
629 3300009176 Ga0105242_10236710 Ga0105242_102367102 149
630 3300009176 Ga0105242_10343904 Ga0105242_103439042 149
631 3300009176 Ga0105242_10522963 Ga0105242_105229631 149
632 3300009177 Ga0105248_10031653 Ga0105248_100316536 149
633 3300009177 Ga0105248_10260831 Ga0105248_102608312 149
634 3300009177 Ga0105248_10385201 Ga0105248_103852012 149
635 3300009177 Ga0105248_10683491 Ga0105248_106834912 149
636 3300009177 Ga0105248_10755529 Ga0105248_107555291 149
637 3300009177 Ga0105248_10805331 Ga0105248_108053312 149
638 3300009177 Ga0105248_10833276 Ga0105248_108332762 149
639 3300009177 Ga0105248_11274679 Ga0105248_112746792 149
640 3300009545 Ga0105237_10003348 Ga0105237_100033488 149
641 3300009545 Ga0105237_10091843 Ga0105237_100918433 149
642 3300009545 Ga0105237_10097904 Ga0105237_100979041 149
643 3300009545 Ga0105237_10202631 Ga0105237_102026312 149
644 3300009545 Ga0105237_10359153 Ga0105237_103591532 149
645 3300009545 Ga0105237_10487553 Ga0105237_104875532 149
646 3300009545 Ga0105237_10774716 Ga0105237_107747161 149
647 3300009545 Ga0105237_10898197 Ga0105237_108981971 149
648 3300009545 Ga0105237_10906613 Ga0105237_109066131 149
649 3300009545 Ga0105237_11226549 Ga0105237_112265491 149
650 3300009551 Ga0105238_10079817 Ga0105238_100798172 149
651 3300009551 Ga0105238_10484653 Ga0105238_104846532 149
652 3300009551 Ga0105238_10561912 Ga0105238_105619121 149
653 3300009551 Ga0105238_10831399 Ga0105238_108313992 149
654 3300009553 Ga0105249_10302860 Ga0105249_103028602 149
655 3300009553 Ga0105249_10440733 Ga0105249_104407331 149
656 3300009553 Ga0105249_10898227 Ga0105249_108982272 149
657 3300009553 Ga0105249_11771734 Ga0105249_117717341 149
658 3300010375 Ga0105239_10018332 Ga0105239_100183322 149
659 3300010375 Ga0105239_10104301 Ga0105239_101043012 149
660 3300010375 Ga0105239_10131922 Ga0105239_101319221 149
661 3300010375 Ga0105239_10149301 Ga0105239_101493013 149
662 3300010375 Ga0105239_10295644 Ga0105239_102956443 149
663 3300010375 Ga0105239_10511702 Ga0105239_105117022 149
664 3300010375 Ga0105239_10530521 Ga0105239_105305212 149
665 3300010375 Ga0105239_10532014 Ga0105239_105320142 149
666 3300010375 Ga0105239_10840982 Ga0105239_108409821 149
667 3300010375 Ga0105239_10952383 Ga0105239_109523831 149
668 3300010375 Ga0105239_10973716 Ga0105239_109737162 149
669 3300010375 Ga0105239_11279412 Ga0105239_112794122 149
670 3300010375 Ga0105239_11965021 Ga0105239_119650211 149
671 3300011119 Ga0105246_10038063 Ga0105246_100380634 149
672 3300011119 Ga0105246_10088764 Ga0105246_100887643 149
673 3300011119 Ga0105246_10115570 Ga0105246_101155702 149
674 3300011119 Ga0105246_10136061 Ga0105246_101360612 149
675 3300011119 Ga0105246_10761716 Ga0105246_107617162 149
676 3300011119 Ga0105246_10818123 Ga0105246_108181231 149
677 3300011119 Ga0105246_12280998 Ga0105246_122809981 149
678 3300012498 Ga0157345_1006877 Ga0157345_10068771 149
679 3300012503 Ga0157313_1011018 Ga0157313_10110182 149
680 3300013100 Ga0157373_10458265 Ga0157373_104582651 149
681 3300013100 Ga0157373_10515056 Ga0157373_105150561 149
682 3300013102 Ga0157371_10201583 Ga0157371_102015832 149
683 3300013102 Ga0157371_10390220 Ga0157371_103902202 149
684 3300013104 Ga0157370_10200281 Ga0157370_102002812 149
685 3300013104 Ga0157370_10700278 Ga0157370_107002781 149
686 3300013104 Ga0157370_10718813 Ga0157370_107188131 149
687 3300013105 Ga0157369_10006967 Ga0157369_100069677 149
688 3300013105 Ga0157369_10029245 Ga0157369_100292457 149
689 3300013105 Ga0157369_10231572 Ga0157369_102315722 149
690 3300013105 Ga0157369_10252747 Ga0157369_102527472 149
691 3300013296 Ga0157374_10024124 Ga0157374_100241246 149
692 3300013296 Ga0157374_10068209 Ga0157374_100682094 149
693 3300013296 Ga0157374_10296880 Ga0157374_102968802 149
694 3300013296 Ga0157374_11095515 Ga0157374_110955152 149
695 3300013296 Ga0157374_11594968 Ga0157374_115949681 149
696 3300013296 Ga0157374_11623872 Ga0157374_116238721 149
697 3300013297 Ga0157378_10154622 Ga0157378_101546222 149
698 3300013297 Ga0157378_10232677 Ga0157378_102326772 149
699 3300013297 Ga0157378_10255428 Ga0157378_102554282 149
700 3300013306 Ga0163162_10059973 Ga0163162_100599731 149
701 3300013306 Ga0163162_10428584 Ga0163162_104285842 149
702 3300013306 Ga0163162_10608268 Ga0163162_106082682 149
703 3300013306 Ga0163162_10644818 Ga0163162_106448181 149
704 3300013306 Ga0163162_10731650 Ga0163162_107316501 149
705 3300013306 Ga0163162_10849319 Ga0163162_108493192 149
706 3300013306 Ga0163162_11144359 Ga0163162_111443592 149
707 3300013307 Ga0157372_10038207 Ga0157372_100382077 149
708 3300013307 Ga0157372_10410606 Ga0157372_104106061 149
709 3300013307 Ga0157372_10549398 Ga0157372_105493982 149
710 3300013307 Ga0157372_10756343 Ga0157372_107563432 149
711 3300013307 Ga0157372_10877840 Ga0157372_108778402 149
712 3300013308 Ga0157375_10010993 Ga0157375_1001099310 149
713 3300013308 Ga0157375_10598315 Ga0157375_105983152 149
714 3300013308 Ga0157375_10672554 Ga0157375_106725542 149
715 3300013308 Ga0157375_10745630 Ga0157375_107456301 149
716 3300013308 Ga0157375_11334070 Ga0157375_113340702 149
717 3300014325 Ga0163163_10006916 Ga0163163_100069168 149
718 3300014325 Ga0163163_10062028 Ga0163163_100620284 149
719 3300014325 Ga0163163_10341962 Ga0163163_103419622 149
720 3300014325 Ga0163163_10536097 Ga0163163_105360972 149
721 3300014325 Ga0163163_10652628 Ga0163163_106526281 149
722 3300014325 Ga0163163_11007505 Ga0163163_110075051 149
723 3300014325 Ga0163163_11908193 Ga0163163_119081931 149
724 3300014325 Ga0163163_12815287 Ga0163163_128152871 149
725 3300014326 Ga0157380_10100918 Ga0157380_101009183 149
726 3300014326 Ga0157380_11561973 Ga0157380_115619731 149
727 3300014497 Ga0182008_10663247 Ga0182008_106632471 149
728 3300014745 Ga0157377_10026554 Ga0157377_100265544 149
729 3300014745 Ga0157377_10338862 Ga0157377_103388622 149
730 3300014968 Ga0157379_10296259 Ga0157379_102962592 149
731 3300014968 Ga0157379_10340773 Ga0157379_103407731 149
732 3300014968 Ga0157379_10388144 Ga0157379_103881442 149
733 3300014968 Ga0157379_10714271 Ga0157379_107142713 149
734 3300014969 Ga0157376_10012225 Ga0157376_100122257 149
735 3300014969 Ga0157376_10049941 Ga0157376_100499411 149
736 3300014969 Ga0157376_10269468 Ga0157376_102694683 149
737 3300014969 Ga0157376_11093359 Ga0157376_110933592 149
738 3300014969 Ga0157376_11780286 Ga0157376_117802861 149
739 3300015262 Ga0182007_10252909 Ga0182007_102529091 149
740 3300017792 Ga0163161_10155939 Ga0163161_101559392 149
741 3300017792 Ga0163161_10160410 Ga0163161_101604101 149
742 3300017792 Ga0163161_10194624 Ga0163161_101946242 149
743 3300017792 Ga0163161_10756901 Ga0163161_107569012 149
744 3300017792 Ga0163161_10788628 Ga0163161_107886281 149
745 3300020069 Ga0197907_10464309 Ga0197907_104643091 149
746 3300020069 Ga0197907_10526031 Ga0197907_105260311 149
747 3300020069 Ga0197907_10831135 Ga0197907_108311351 149
748 3300020070 Ga0206356_10656885 Ga0206356_106568852 149
749 3300020070 Ga0206356_11377276 Ga0206356_113772761 149
750 3300020070 Ga0206356_11842844 Ga0206356_118428442 149
751 3300020077 Ga0206351_10675134 Ga0206351_106751341 149
752 3300020078 Ga0206352_10265531 Ga0206352_102655311 149
753 3300020078 Ga0206352_10786040 Ga0206352_107860401 149
754 3300020080 Ga0206350_10535223 Ga0206350_105352231 149
755 3300020082 Ga0206353_10765933 Ga0206353_107659331 149
756 3300020082 Ga0206353_10960214 Ga0206353_109602141 149
757 3300021377 Ga0213874_10029949 Ga0213874_100299491 149
758 3300021384 Ga0213876_10013409 Ga0213876_100134092 149
759 3300021384 Ga0213876_10025379 Ga0213876_100253794 149
760 3300022467 Ga0224712_10641122 Ga0224712_106411221 149
761 3300025230 Ga0209563_110550 Ga0209563_1105501 149
762 3300025253 Ga0209677_102452 Ga0209677_1024522 149
763 3300025254 Ga0209148_1002608 Ga0209148_10026082 149
764 3300025261 Ga0209233_1001880 Ga0209233_10018806 149
765 3300025261 Ga0209233_1010217 Ga0209233_10102173 149
766 3300025272 Ga0209455_1000714 Ga0209455_10007145 149
767 3300025273 Ga0209673_1027816 Ga0209673_10278162 149
768 3300025295 Ga0209564_1004469 Ga0209564_10044695 149
769 3300025295 Ga0209564_1013773 Ga0209564_10137734 149
770 3300025295 Ga0209564_1013929 Ga0209564_10139291 149
771 3300025297 Ga0209758_1000141 Ga0209758_100014142 149
772 3300025297 Ga0209758_1002921 Ga0209758_100292110 149
773 3300025297 Ga0209758_1003483 Ga0209758_10034833 149
774 3300025297 Ga0209758_1004079 Ga0209758_100407912 149
775 3300025297 Ga0209758_1020105 Ga0209758_10201052 149
776 3300025297 Ga0209758_1082898 Ga0209758_10828981 149
777 3300025297 Ga0209758_1129680 Ga0209758_11296801 149
778 3300025299 Ga0209256_1002956 Ga0209256_10029568 149
779 3300025302 Ga0207426_1000437 Ga0207426_100043715 149
780 3300025302 Ga0207426_1001139 Ga0207426_100113911 149
781 3300025302 Ga0207426_1008512 Ga0207426_10085124 149
782 3300025302 Ga0207426_1014295 Ga0207426_10142952 149
783 3300025302 Ga0207426_1027953 Ga0207426_10279532 149
784 3300025303 Ga0209051_1022867 Ga0209051_10228673 149
785 3300025304 Ga0209257_1006467 Ga0209257_10064679 149
786 3300025304 Ga0209257_1041881 Ga0209257_10418812 149
787 3300025315 Ga0207697_10090616 Ga0207697_100906161 149
788 3300025315 Ga0207697_10161404 Ga0207697_101614041 149
789 3300025315 Ga0207697_10349939 Ga0207697_103499391 149
790 3300025711 Ga0207696_1163742 Ga0207696_11637421 149
791 3300025893 Ga0207682_10003043 Ga0207682_100030433 149
792 3300025898 Ga0207692_10612950 Ga0207692_106129501 149
793 3300025899 Ga0207642_10012062 Ga0207642_100120624 149
794 3300025899 Ga0207642_10209809 Ga0207642_102098092 149
795 3300025900 Ga0207710_10213592 Ga0207710_102135921 149
796 3300025900 Ga0207710_10265723 Ga0207710_102657231 149
797 3300025900 Ga0207710_10309245 Ga0207710_103092452 149
798 3300025900 Ga0207710_10314634 Ga0207710_103146341 149
799 3300025901 Ga0207688_10020261 Ga0207688_100202614 149
800 3300025901 Ga0207688_10021578 Ga0207688_100215782 149
801 3300025901 Ga0207688_10025537 Ga0207688_100255373 149
802 3300025901 Ga0207688_10211763 Ga0207688_102117632 149
803 3300025903 Ga0207680_10265851 Ga0207680_102658513 149
804 3300025903 Ga0207680_10850649 Ga0207680_108506491 149
805 3300025904 Ga0207647_10044022 Ga0207647_100440224 149
806 3300025904 Ga0207647_10097140 Ga0207647_100971403 149
807 3300025904 Ga0207647_10218637 Ga0207647_102186372 149
808 3300025907 Ga0207645_10019706 Ga0207645_100197061 149
809 3300025907 Ga0207645_10057779 Ga0207645_100577793 149
810 3300025907 Ga0207645_10091167 Ga0207645_100911672 149
811 3300025907 Ga0207645_10172579 Ga0207645_101725791 149
812 3300025907 Ga0207645_10269356 Ga0207645_102693563 149
813 3300025907 Ga0207645_10290778 Ga0207645_102907781 149
814 3300025908 Ga0207643_10626496 Ga0207643_106264961 149
815 3300025909 Ga0207705_10259019 Ga0207705_102590191 149
816 3300025909 Ga0207705_10373921 Ga0207705_103739211 149
817 3300025911 Ga0207654_10039611 Ga0207654_100396111 149
818 3300025911 Ga0207654_10045872 Ga0207654_100458723 149
819 3300025912 Ga0207707_10000754 Ga0207707_100007542 149
820 3300025912 Ga0207707_10191557 Ga0207707_101915573 149
821 3300025912 Ga0207707_10219014 Ga0207707_102190141 149
822 3300025912 Ga0207707_10530243 Ga0207707_105302432 149
823 3300025913 Ga0207695_10000062 Ga0207695_10000062154 149
824 3300025913 Ga0207695_10050638 Ga0207695_100506382 149
825 3300025914 Ga0207671_10001897 Ga0207671_1000189715 149
826 3300025914 Ga0207671_10051511 Ga0207671_100515112 149
827 3300025914 Ga0207671_10060968 Ga0207671_100609682 149
828 3300025915 Ga0207693_10159079 Ga0207693_101590791 149
829 3300025915 Ga0207693_10591358 Ga0207693_105913582 149
830 3300025915 Ga0207693_11166919 Ga0207693_111669191 149
831 3300025916 Ga0207663_10705132 Ga0207663_107051322 149
832 3300025916 Ga0207663_10922191 Ga0207663_109221911 149
833 3300025917 Ga0207660_10043144 Ga0207660_100431442 149
834 3300025917 Ga0207660_10048371 Ga0207660_100483711 149
835 3300025917 Ga0207660_10163794 Ga0207660_101637941 149
836 3300025918 Ga0207662_10135318 Ga0207662_101353182 149
837 3300025918 Ga0207662_10627391 Ga0207662_106273911 149
838 3300025918 Ga0207662_10734437 Ga0207662_107344371 149
839 3300025919 Ga0207657_10003905 Ga0207657_100039057 149
840 3300025919 Ga0207657_10258482 Ga0207657_102584822 149
841 3300025919 Ga0207657_10357412 Ga0207657_103574122 149
842 3300025919 Ga0207657_11210963 Ga0207657_112109631 149
843 3300025920 Ga0207649_10072579 Ga0207649_100725793 149
844 3300025920 Ga0207649_10121305 Ga0207649_101213051 149
845 3300025921 Ga0207652_10005840 Ga0207652_100058404 149
846 3300025921 Ga0207652_10029294 Ga0207652_100292944 149
847 3300025921 Ga0207652_10193719 Ga0207652_101937192 149
848 3300025921 Ga0207652_10333981 Ga0207652_103339812 149
849 3300025921 Ga0207652_10558527 Ga0207652_105585271 149
850 3300025921 Ga0207652_11396455 Ga0207652_113964551 149
851 3300025922 Ga0207646_11222457 Ga0207646_112224571 149
852 3300025923 Ga0207681_10391042 Ga0207681_103910422 149
853 3300025923 Ga0207681_10570152 Ga0207681_105701522 149
854 3300025923 Ga0207681_10920387 Ga0207681_109203871 149
855 3300025924 Ga0207694_10273712 Ga0207694_102737123 149
856 3300025924 Ga0207694_10350128 Ga0207694_103501282 149
857 3300025924 Ga0207694_11438027 Ga0207694_114380271 149
858 3300025925 Ga0207650_10195427 Ga0207650_101954272 149
859 3300025925 Ga0207650_10701976 Ga0207650_107019761 149
860 3300025925 Ga0207650_10744973 Ga0207650_107449731 149
861 3300025926 Ga0207659_10070799 Ga0207659_100707992 149
862 3300025926 Ga0207659_10350653 Ga0207659_103506532 149
863 3300025926 Ga0207659_10611148 Ga0207659_106111482 149
864 3300025926 Ga0207659_10616588 Ga0207659_106165882 149
865 3300025926 Ga0207659_10941915 Ga0207659_109419151 149
866 3300025927 Ga0207687_10010386 Ga0207687_100103865 149
867 3300025927 Ga0207687_10021894 Ga0207687_100218942 149
868 3300025927 Ga0207687_10151887 Ga0207687_101518873 149
869 3300025927 Ga0207687_10322087 Ga0207687_103220872 149
870 3300025927 Ga0207687_10330403 Ga0207687_103304032 149
871 3300025927 Ga0207687_11412429 Ga0207687_114124292 149
872 3300025928 Ga0207700_10447055 Ga0207700_104470552 149
873 3300025929 Ga0207664_10582856 Ga0207664_105828561 149
874 3300025929 Ga0207664_11406083 Ga0207664_114060831 149
875 3300025931 Ga0207644_10051283 Ga0207644_100512834 149
876 3300025931 Ga0207644_10089423 Ga0207644_100894232 149
877 3300025931 Ga0207644_10292458 Ga0207644_102924582 149
878 3300025931 Ga0207644_10373385 Ga0207644_103733852 149
879 3300025931 Ga0207644_10409760 Ga0207644_104097601 149
880 3300025931 Ga0207644_10607914 Ga0207644_106079142 149
881 3300025931 Ga0207644_11153061 Ga0207644_111530611 149
882 3300025932 Ga0207690_10225060 Ga0207690_102250602 149
883 3300025932 Ga0207690_10464249 Ga0207690_104642492 149
884 3300025932 Ga0207690_10648931 Ga0207690_106489312 149
885 3300025932 Ga0207690_10984603 Ga0207690_109846031 149
886 3300025932 Ga0207690_11113027 Ga0207690_111130271 149
887 3300025933 Ga0207706_10034566 Ga0207706_100345665 149
888 3300025933 Ga0207706_10177295 Ga0207706_101772952 149
889 3300025933 Ga0207706_10255486 Ga0207706_102554862 149
890 3300025933 Ga0207706_11191986 Ga0207706_111919861 149
891 3300025934 Ga0207686_10070784 Ga0207686_100707843 149
892 3300025934 Ga0207686_10339537 Ga0207686_103395372 149
893 3300025934 Ga0207686_10379580 Ga0207686_103795803 149
894 3300025935 Ga0207709_10075840 Ga0207709_100758402 149
895 3300025935 Ga0207709_10456047 Ga0207709_104560472 149
896 3300025935 Ga0207709_10552107 Ga0207709_105521072 149
897 3300025935 Ga0207709_10815073 Ga0207709_108150732 149
898 3300025935 Ga0207709_10877478 Ga0207709_108774782 149
899 3300025936 Ga0207670_10796620 Ga0207670_107966202 149
900 3300025937 Ga0207669_10006478 Ga0207669_100064785 149
901 3300025937 Ga0207669_10028974 Ga0207669_100289742 149
902 3300025937 Ga0207669_10110785 Ga0207669_101107853 149
903 3300025938 Ga0207704_10390159 Ga0207704_103901592 149
904 3300025938 Ga0207704_10943309 Ga0207704_109433091 149
905 3300025939 Ga0207665_10203125 Ga0207665_102031252 149
906 3300025940 Ga0207691_10005845 Ga0207691_100058455 149
907 3300025940 Ga0207691_10390768 Ga0207691_103907682 149
908 3300025940 Ga0207691_10634759 Ga0207691_106347592 149
909 3300025940 Ga0207691_10756413 Ga0207691_107564131 149
910 3300025940 Ga0207691_11593870 Ga0207691_115938701 149
911 3300025941 Ga0207711_10050250 Ga0207711_100502504 149
912 3300025941 Ga0207711_10184988 Ga0207711_101849882 149
913 3300025941 Ga0207711_10441642 Ga0207711_104416422 149
914 3300025941 Ga0207711_10614434 Ga0207711_106144342 149
915 3300025942 Ga0207689_10048255 Ga0207689_100482552 149
916 3300025942 Ga0207689_10281584 Ga0207689_102815842 149
917 3300025942 Ga0207689_10426439 Ga0207689_104264391 149
918 3300025944 Ga0207661_10003055 Ga0207661_1000305512 149
919 3300025944 Ga0207661_11351331 Ga0207661_113513311 149
920 3300025945 Ga0207679_10140634 Ga0207679_101406343 149
921 3300025945 Ga0207679_10324455 Ga0207679_103244553 149
922 3300025945 Ga0207679_10525044 Ga0207679_105250442 149
923 3300025949 Ga0207667_10037813 Ga0207667_100378134 149
924 3300025949 Ga0207667_10082010 Ga0207667_100820103 149
925 3300025949 Ga0207667_10439076 Ga0207667_104390762 149
926 3300025960 Ga0207651_10320090 Ga0207651_103200902 149
927 3300025960 Ga0207651_10488967 Ga0207651_104889672 149
928 3300025961 Ga0207712_10271398 Ga0207712_102713983 149
929 3300025961 Ga0207712_10656339 Ga0207712_106563391 149
930 3300025961 Ga0207712_10675421 Ga0207712_106754212 149
931 3300025961 Ga0207712_11087175 Ga0207712_110871752 149
932 3300025972 Ga0207668_10035749 Ga0207668_100357492 149
933 3300025972 Ga0207668_10279303 Ga0207668_102793032 149
934 3300025972 Ga0207668_10313641 Ga0207668_103136412 149
935 3300025972 Ga0207668_10627425 Ga0207668_106274251 149
936 3300025972 Ga0207668_10807630 Ga0207668_108076301 149
937 3300025981 Ga0207640_10090881 Ga0207640_100908812 149
938 3300025981 Ga0207640_10337633 Ga0207640_103376331 149
939 3300025981 Ga0207640_10510928 Ga0207640_105109281 149
940 3300025981 Ga0207640_10903981 Ga0207640_109039811 149
941 3300025986 Ga0207658_10134571 Ga0207658_101345712 149
942 3300025986 Ga0207658_10196013 Ga0207658_101960133 149
943 3300025986 Ga0207658_10232830 Ga0207658_102328302 149
944 3300025986 Ga0207658_10699199 Ga0207658_106991992 149
945 3300026023 Ga0207677_10010248 Ga0207677_100102486 149
946 3300026023 Ga0207677_10272560 Ga0207677_102725603 149
947 3300026023 Ga0207677_10322327 Ga0207677_103223272 149
948 3300026023 Ga0207677_11636900 Ga0207677_116369001 149
949 3300026035 Ga0207703_10012005 Ga0207703_100120054 149
950 3300026035 Ga0207703_10045747 Ga0207703_100457474 149
951 3300026035 Ga0207703_10444883 Ga0207703_104448832 149
952 3300026035 Ga0207703_10633035 Ga0207703_106330352 149
953 3300026035 Ga0207703_10780517 Ga0207703_107805172 149
954 3300026041 Ga0207639_10059133 Ga0207639_100591333 149
955 3300026041 Ga0207639_10149925 Ga0207639_101499252 149
956 3300026041 Ga0207639_10306699 Ga0207639_103066991 149
957 3300026041 Ga0207639_10981045 Ga0207639_109810451 149
958 3300026041 Ga0207639_11449589 Ga0207639_114495891 149
959 3300026067 Ga0207678_10005024 Ga0207678_100050244 149
960 3300026067 Ga0207678_10081977 Ga0207678_100819772 149
961 3300026067 Ga0207678_10162810 Ga0207678_101628102 149
962 3300026067 Ga0207678_10190588 Ga0207678_101905882 149
963 3300026067 Ga0207678_10220596 Ga0207678_102205962 149
964 3300026067 Ga0207678_10234728 Ga0207678_102347282 149
965 3300026067 Ga0207678_10245528 Ga0207678_102455282 149
966 3300026067 Ga0207678_10366915 Ga0207678_103669151 149
967 3300026067 Ga0207678_10372302 Ga0207678_103723021 149
968 3300026067 Ga0207678_10721338 Ga0207678_107213381 149
969 3300026075 Ga0207708_10115299 Ga0207708_101152992 149
970 3300026075 Ga0207708_10170152 Ga0207708_101701522 149
971 3300026078 Ga0207702_10427084 Ga0207702_104270842 149
972 3300026078 Ga0207702_10805980 Ga0207702_108059801 149
973 3300026088 Ga0207641_10202741 Ga0207641_102027412 149
974 3300026088 Ga0207641_11031056 Ga0207641_110310562 149
975 3300026089 Ga0207648_10589050 Ga0207648_105890502 149
976 3300026095 Ga0207676_10070319 Ga0207676_100703193 149
977 3300026095 Ga0207676_10108982 Ga0207676_101089822 149
978 3300026095 Ga0207676_10990238 Ga0207676_109902381 149
979 3300026116 Ga0207674_10066105 Ga0207674_100661052 149
980 3300026116 Ga0207674_10070326 Ga0207674_100703261 149
981 3300026116 Ga0207674_10329357 Ga0207674_103293571 149
982 3300026116 Ga0207674_10419592 Ga0207674_104195922 149
983 3300026116 Ga0207674_10712038 Ga0207674_107120381 149
984 3300026116 Ga0207674_10847657 Ga0207674_108476572 149
985 3300026118 Ga0207675_100028089 Ga0207675_1000280894 149
986 3300026118 Ga0207675_100034859 Ga0207675_1000348595 149
987 3300026118 Ga0207675_100091356 Ga0207675_1000913562 149
988 3300026118 Ga0207675_100827403 Ga0207675_1008274031 149
989 3300026121 Ga0207683_10003145 Ga0207683_100031455 149
990 3300026121 Ga0207683_10016895 Ga0207683_100168952 149
991 3300026121 Ga0207683_10065573 Ga0207683_100655734 149
992 3300026121 Ga0207683_10100910 Ga0207683_101009101 149
993 3300026121 Ga0207683_10236280 Ga0207683_102362801 149
994 3300026121 Ga0207683_10316422 Ga0207683_103164222 149
995 3300026121 Ga0207683_10316838 Ga0207683_103168382 149
996 3300026121 Ga0207683_10539136 Ga0207683_105391362 149
997 3300026142 Ga0207698_10054121 Ga0207698_100541213 149
998 3300026142 Ga0207698_10237666 Ga0207698_102376662 149
999 3300026142 Ga0207698_10595012 Ga0207698_105950122 149
1000 3300026142 Ga0207698_11205121 Ga0207698_112051212 149
1001 3300027296 Ga0209389_1000004 Ga0209389_1000004106 149
1002 3300027296 Ga0209389_1000023 Ga0209389_1000023104 149
1003 3300027357 Ga0209589_1000010 Ga0209589_100001055 149
1004 3300027361 Ga0209489_100011 Ga0209489_100011181 149
1005 3300027361 Ga0209489_100777 Ga0209489_10077748 149
1006 3300027363 Ga0209700_100013 Ga0209700_100013192 149
1007 3300027866 Ga0209813_10439730 Ga0209813_104397301 149
1008 3300028379 Ga0268266_10012387 Ga0268266_100123875 149
1009 3300028379 Ga0268266_10027174 Ga0268266_100271744 149
1010 3300028379 Ga0268266_10029034 Ga0268266_100290346 149
1011 3300028379 Ga0268266_10060413 Ga0268266_100604131 149
1012 3300028379 Ga0268266_10101020 Ga0268266_101010203 149
1013 3300028379 Ga0268266_10244955 Ga0268266_102449552 149
1014 3300028379 Ga0268266_10445290 Ga0268266_104452902 149
1015 3300028379 Ga0268266_10900505 Ga0268266_109005052 149
1016 3300028380 Ga0268265_10175616 Ga0268265_101756162 149
1017 3300028380 Ga0268265_11453198 Ga0268265_114531981 149
1018 3300028381 Ga0268264_10070546 Ga0268264_100705462 149
1019 3300028381 Ga0268264_10096546 Ga0268264_100965463 149
1020 3300028381 Ga0268264_10288185 Ga0268264_102881852 149
1021 3300028381 Ga0268264_10340486 Ga0268264_103404862 149
1022 3300028381 Ga0268264_10937683 Ga0268264_109376832 149
1023 3300028573 Ga0265334_10219126 Ga0265334_102191261 149
1024 3300028577 Ga0265318_10114355 Ga0265318_101143551 149
1025 3300028786 Ga0307517_10315997 Ga0307517_103159971 149
1026 3300028786 Ga0307517_10337442 Ga0307517_103374421 149
1027 3300028786 Ga0307517_10425343 Ga0307517_104253432 149
1028 3300028794 Ga0307515_10264895 Ga0307515_102648952 149
1029 3300030521 Ga0307511_10279278 Ga0307511_102792781 149
1030 3300031235 Ga0265330_10018939 Ga0265330_100189392 149
1031 3300031238 Ga0265332_10025346 Ga0265332_100253462 149
1032 3300031240 Ga0265320_10141408 Ga0265320_101414082 149
1033 3300031247 Ga0265340_10045752 Ga0265340_100457522 149
1034 3300031251 Ga0265327_10041483 Ga0265327_100414833 149
1035 3300031456 Ga0307513_10107304 Ga0307513_101073044 149
1036 3300031456 Ga0307513_10108360 Ga0307513_101083602 149
1037 3300031456 Ga0307513_10841998 Ga0307513_108419982 149
1038 3300031456 Ga0307513_10999689 Ga0307513_109996891 149
1039 3300031507 Ga0307509_10466932 Ga0307509_104669322 149
1040 3300031548 Ga0307408_100474506 Ga0307408_1004745061 149
1041 3300031548 Ga0307408_100834826 Ga0307408_1008348262 149
1042 3300031616 Ga0307508_10218752 Ga0307508_102187521 149
1043 3300031616 Ga0307508_10463055 Ga0307508_104630552 149
1044 3300031616 Ga0307508_10779389 Ga0307508_107793891 149
1045 3300031711 Ga0265314_10002834 Ga0265314_1000283417 149
1046 3300031711 Ga0265314_10085887 Ga0265314_100858873 149
1047 3300031712 Ga0265342_10388722 Ga0265342_103887222 149
1048 3300031730 Ga0307516_10090518 Ga0307516_100905182 149
1049 3300031824 Ga0307413_10056827 Ga0307413_100568272 149
1050 3300031824 Ga0307413_10336378 Ga0307413_103363782 149
1051 3300031852 Ga0307410_10366741 Ga0307410_103667412 149
1052 3300031852 Ga0307410_10453456 Ga0307410_104534561 149
1053 3300031903 Ga0307407_10130185 Ga0307407_101301851 149
1054 3300031903 Ga0307407_11064949 Ga0307407_110649491 149
1055 3300031911 Ga0307412_11102560 Ga0307412_111025601 149
1056 3300031995 Ga0307409_100936430 Ga0307409_1009364302 149
1057 3300032002 Ga0307416_100377265 Ga0307416_1003772652 149
1058 3300032002 Ga0307416_101033131 Ga0307416_1010331312 149
1059 3300032005 Ga0307411_10122442 Ga0307411_101224422 149
1060 3300032005 Ga0307411_10404440 Ga0307411_104044402 149
1061 3300033179 Ga0307507_10400362 Ga0307507_104003622 149
1062 3300033180 Ga0307510_10027691 Ga0307510_100276917 149
1063 3300033180 Ga0307510_10050413 Ga0307510_100504134 149
1064 3300033180 Ga0307510_10071369 Ga0307510_100713694 149
1065 3300033180 Ga0307510_10166074 Ga0307510_101660742 149
1066 3300033180 Ga0307510_10552723 Ga0307510_105527231 149
1067 3300033442 Ga0315911_1000010 Ga0315911_1000010271 149
1068 3300034817 Ga0373948_0149087 Ga0373948_0149087_110_559 149
1069 3300034817 Ga0373948_0210465 Ga0373948_0210465_23_472 149
1070 3300035083 Ga0373926_0135979 Ga0373926_0135979_44_493 149
1071 3300035086 Ga0373934_0018297 Ga0373934_0018297_1480_1932 149
1072 3300035089 Ga0373944_0014723 Ga0373944_0014723_38_487 149
1073 3300035111 Ga0373923_0000955 Ga0373923_0000955_1162_1614 149
1074 3300035111 Ga0373923_0021274 Ga0373923_0021274_23_472 149
1075 3300035113 Ga0373936_0069611 Ga0373936_0069611_653_1102 149
1076 3300035116 Ga0373945_0106673 Ga0373945_0106673_447_896 149
1077 3300035116 Ga0373945_0369810 Ga0373945_0369810_50_499 149
1078 3300035117 Ga0373953_0000357 Ga0373953_0000357_2951_3403 149
1079 3300035118 Ga0373954_0000156 Ga0373954_0000156_13909_14361 149
1080 3300035118 Ga0373954_0019571 Ga0373954_0019571_624_1073 149
1081 3300035119 Ga0373956_0000252 Ga0373956_0000252_5025_5477 149
1082 3300035120 Ga0373957_0000344 Ga0373957_0000344_5864_6316 149
1083 3300035170 Ga0373943_0019168 Ga0373943_0019168_325_774 149
1084 3300035171 Ga0373946_0009713 Ga0373946_0009713_1395_1844 149
1085 3300035171 Ga0373946_0318842 Ga0373946_0318842_142_591 149
1086 3300035172 Ga0373955_0000229 Ga0373955_0000229_15440_15892 149
1087 3300035172 Ga0373955_0110994 Ga0373955_0110994_251_700 149
1088 3300035410 Ga0373924_0000488 Ga0373924_0000488_6142_6594 149
1089 3300035410 Ga0373924_0013574 Ga0373924_0013574_2190_2639 149
1090 3300035691 Ga0373931_0003537 Ga0373931_0003537_5568_6017 149
1091 3300035691 Ga0373931_1050708 Ga0373931_1050708_49_498 149
1092 3300035692 Ga0373935_0727666 Ga0373935_0727666_196_645 149
1093 3300035692 Ga0373935_0833672 Ga0373935_0833672_216_665 149
1094 3300035695 Ga0373927_0340136 Ga0373927_0340136_520_969 149
1095 3300035695 Ga0373927_0431051 Ga0373927_0431051_100_549 149
1096 3300035724 Ga0373933_0000628 Ga0373933_0000628_14199_14651 149
1097 3300035724 Ga0373933_0563627 Ga0373933_0563627_165_614 149
1098 3300035725 Ga0373947_0014655 Ga0373947_0014655_1212_1661 149
1099 3300036401 Ga0373937_0001337 Ga0373937_0001337_2104_2556 149
1100 3300036401 Ga0373937_0234160 Ga0373937_0234160_879_1328 149
1101 3300036401 Ga0373937_0266048 Ga0373937_0266048_831_1280 149
1102 3300037068 Ga0373925_0040808 Ga0373925_0040808_1798_2247 149
1103 3300037068 Ga0373925_0137551 Ga0373925_0137551_149_598 149
1104 3300037068 Ga0373925_0907524 Ga0373925_0907524_127_576 149
1105 3300037068 Ga0373925_0938093 Ga0373925_0938093_72_521 149
1106 3300037312 Ga0395899_0109507 Ga0395899_0109507_1162_1611 149
1107 3300037312 Ga0395899_0315229 Ga0395899_0315229_464_913 149
1108 3300037418 Ga0395900_0033149 Ga0395900_0033149_2437_2886 149
1109 3300037418 Ga0395900_0360038 Ga0395900_0360038_774_1223 149
1110 3300037466 Ga0395898_0003786 Ga0395898_0003786_304_753 149
1111 3300037466 Ga0395898_0015935 Ga0395898_0015935_6273_6722 149
1112 3300037466 Ga0395898_0134436 Ga0395898_0134436_273_722 149
1113 3300037471 Ga0395905_0048221 Ga0395905_0048221_1376_1825 149
1114 3300037471 Ga0395905_0363338 Ga0395905_0363338_359_808 149
1115 3300038443 Ga0395901_0059357 Ga0395901_0059357_1033_1482 149
1116 3300038443 Ga0395901_0233871 Ga0395901_0233871_1022_1471 149
1117 3300038443 Ga0395901_0553309 Ga0395901_0553309_117_566 149
1118 3300039437 Ga0436365_0350765 Ga0436365_0350765_290_739 149
1119 3300039437 Ga0436365_0488039 Ga0436365_0488039_58_507 149
1120 3300039437 Ga0436365_0714504 Ga0436365_0714504_191_640 149
1121 3300039437 Ga0436365_1475101 Ga0436365_1475101_608_1057 149
1122 3300039437 Ga0436365_1782951 Ga0436365_1782951_804_1253 149
1123 3300039438 Ga0436360_0553077 Ga0436360_0553077_669_1121 149
1124 3300039450 Ga0436363_0227726 Ga0436363_0227726_138_587 149
1125 3300041413 Ga0439465_0148926 Ga0439465_0148926_158_607 149
1126 3300041451 Ga0451791_0856061 Ga0451791_0856061_95_544 149
1127 3300041456 Ga0451795_0835100 Ga0451795_0835100_43_492 149
1128 3300041458 Ga0451798_0527849 Ga0451798_0527849_75_524 149
1129 3300041459 Ga0451800_1247451 Ga0451800_1247451_145_594 149
1130 3300041486 Ga0451807_0027761 Ga0451807_0027761_105_554 149
1131 3300041491 Ga0451833_0052533 Ga0451833_0052533_71_520 149
1132 3300041491 Ga0451833_1385877 Ga0451833_1385877_414_863 149
1133 3300041492 Ga0451835_0439563 Ga0451835_0439563_133_582 149
1134 3300041503 Ga0451847_0468734 Ga0451847_0468734_328_777 149
1135 3300041505 Ga0451849_0164067 Ga0451849_0164067_37_486 149
1136 3300041511 Ga0451855_1457165 Ga0451855_1457165_25_474 149
1137 3300041512 Ga0451853_3206365 Ga0451853_3206365_221_670 149
1138 3300041997 Ga0439431_0121816 Ga0439431_0121816_187_636 149
1139 3300042005 Ga0439448_0287128 Ga0439448_0287128_35_484 149
1140 3300042012 Ga0439455_0133576 Ga0439455_0133576_66_515 149
1141 3300042157 Ga0439458_0058281 Ga0439458_0058281_286_735 149
1142 3300042439 Ga0439464_0143287 Ga0439464_0143287_256_720 149
1143 3300044656 Ga0466969_0049764 Ga0466969_0049764_384_833 149
1144 3300044658 Ga0466972_0000998 Ga0466972_0000998_12192_12641 149
1145 3300044683 Ga0466965_0071991 Ga0466965_0071991_402_851 149
1146 3300044684 Ga0466966_0000551 Ga0466966_0000551_19757_20206 149
1147 3300044693 Ga0466961_0000020 Ga0466961_0000020_53320_53769 149
1148 3300044693 Ga0466961_0201182 Ga0466961_0201182_617_1066 149
1149 3300044694 Ga0466963_0127317 Ga0466963_0127317_825_1274 149
1150 3300044706 Ga0466964_0022484 Ga0466964_0022484_1927_2376 149
1151 3300044706 Ga0466964_0045822 Ga0466964_0045822_850_1299 149
1152 3300044735 Ga0466968_0018330 Ga0466968_0018330_512_961 149
1153 3300044901 Ga0466960_0018738 Ga0466960_0018738_404_853 149
1154 3300044901 Ga0466960_0035273 Ga0466960_0035273_744_1193 149
1155 3300044901 Ga0466960_0157633 Ga0466960_0157633_327_776 149
1156 3300044901 Ga0466960_0222530 Ga0466960_0222530_412_861 149
1157 3300045049 Ga0466959_0135055 Ga0466959_0135055_1216_1665 149
1158 3300045836 Ga0466958_0047710 Ga0466958_0047710_1695_2144 149
1159 3300045976 Ga0466967_0049530 Ga0466967_0049530_3182_3631 149
1160 3300045976 Ga0466967_0384955 Ga0466967_0384955_886_1335 149
1161 3300045976 Ga0466967_0863173 Ga0466967_0863173_234_683 149
1162 3300046452 Ga0495617_027271 Ga0495617_027271_430_879 149
1163 3300046454 Ga0495592_0003818 Ga0495592_0003818_5348_5800 149
1164 3300046454 Ga0495592_0026973 Ga0495592_0026973_312_761 149
1165 3300046454 Ga0495592_0078412 Ga0495592_0078412_209_658 149
1166 3300046454 Ga0495592_0777290 Ga0495592_0777290_44_493 149
1167 3300046455 Ga0495603_0007836 Ga0495603_0007836_1322_1771 149
1168 3300046455 Ga0495603_0088424 Ga0495603_0088424_346_795 149
1169 3300046455 Ga0495603_0353566 Ga0495603_0353566_152_601 149
1170 3300046455 Ga0495603_0539916 Ga0495603_0539916_44_493 149
1171 3300046457 Ga0495590_0098438 Ga0495590_0098438_204_653 149
1172 3300046457 Ga0495590_0108269 Ga0495590_0108269_343_792 149
1173 3300046459 Ga0495629_0001098 Ga0495629_0001098_14273_14725 149
1174 3300046459 Ga0495629_0002258 Ga0495629_0002258_11764_12213 149
1175 3300046459 Ga0495629_0526638 Ga0495629_0526638_185_634 149
1176 3300046459 Ga0495629_0952121 Ga0495629_0952121_17_466 149
1177 3300046460 Ga0495638_0004483 Ga0495638_0004483_4647_5096 149
1178 3300046460 Ga0495638_0037446 Ga0495638_0037446_297_746 149
1179 3300046460 Ga0495638_0110489 Ga0495638_0110489_820_1281 149
1180 3300046460 Ga0495638_0220113 Ga0495638_0220113_487_948 149
1181 3300046460 Ga0495638_0221466 Ga0495638_0221466_246_695 149
1182 3300046460 Ga0495638_0322130 Ga0495638_0322130_290_748 149
1183 3300046460 Ga0495638_0448805 Ga0495638_0448805_188_637 149
1184 3300046461 Ga0495641_0289181 Ga0495641_0289181_239_688 149
1185 3300046461 Ga0495641_0577651 Ga0495641_0577651_41_490 149
1186 3300046462 Ga0495651_0002766 Ga0495651_0002766_10143_10595 149
1187 3300046462 Ga0495651_0026823 Ga0495651_0026823_1264_1713 149
1188 3300046462 Ga0495651_0144905 Ga0495651_0144905_814_1263 149
1189 3300046463 Ga0495653_0000562 Ga0495653_0000562_6746_7198 149
1190 3300046463 Ga0495653_0710019 Ga0495653_0710019_76_525 149
1191 3300046463 Ga0495653_0758354 Ga0495653_0758354_41_490 149
1192 3300046471 Ga0495650_0078899 Ga0495650_0078899_590_1039 149
1193 3300046471 Ga0495650_0163114 Ga0495650_0163114_259_708 149
1194 3300046471 Ga0495650_0329557 Ga0495650_0329557_19_468 149
1195 3300046472 Ga0495580_0059649 Ga0495580_0059649_2190_2639 149
1196 3300046473 Ga0495582_0031742 Ga0495582_0031742_1742_2191 149
1197 3300046473 Ga0495582_0124821 Ga0495582_0124821_565_1014 149
1198 3300046473 Ga0495582_0606980 Ga0495582_0606980_21_470 149
1199 3300046474 Ga0495605_0107267 Ga0495605_0107267_464_913 149
1200 3300046474 Ga0495605_0124937 Ga0495605_0124937_431_901 149
1201 3300046474 Ga0495605_0296553 Ga0495605_0296553_189_638 149
1202 3300046475 Ga0495639_0005522 Ga0495639_0005522_2069_2518 149
1203 3300046475 Ga0495639_0287282 Ga0495639_0287282_72_521 149
1204 3300046476 Ga0495662_0351016 Ga0495662_0351016_26_475 149
1205 3300046477 Ga0495664_0045364 Ga0495664_0045364_1047_1496 149
1206 3300046477 Ga0495664_0064925 Ga0495664_0064925_325_774 149
1207 3300046477 Ga0495664_0346055 Ga0495664_0346055_267_716 149
1208 3300046477 Ga0495664_0473968 Ga0495664_0473968_40_489 149
1209 3300046491 Ga0495584_0095822 Ga0495584_0095822_319_768 149
1210 3300046491 Ga0495584_0108738 Ga0495584_0108738_416_865 149
1211 3300046491 Ga0495584_0600267 Ga0495584_0600267_95_544 149
1212 3300046492 Ga0495585_0012463 Ga0495585_0012463_4394_4843 149
1213 3300046492 Ga0495585_0030579 Ga0495585_0030579_1988_2437 149
1214 3300046492 Ga0495585_0100946 Ga0495585_0100946_522_971 149
1215 3300046499 Ga0495594_0150020 Ga0495594_0150020_807_1256 149
1216 3300046499 Ga0495594_0288174 Ga0495594_0288174_392_925 149
1217 3300046501 Ga0495607_0157633 Ga0495607_0157633_227_676 149
1218 3300046501 Ga0495607_0169951 Ga0495607_0169951_173_622 149
1219 3300046501 Ga0495607_0340206 Ga0495607_0340206_196_645 149
1220 3300046506 Ga0495583_0095646 Ga0495583_0095646_318_767 149
1221 3300046506 Ga0495583_0117913 Ga0495583_0117913_153_614 149
1222 3300046506 Ga0495583_0249626 Ga0495583_0249626_174_623 149
1223 3300046506 Ga0495583_0259105 Ga0495583_0259105_213_662 149
1224 3300046507 Ga0495606_0023943 Ga0495606_0023943_2269_2718 149
1225 3300046507 Ga0495606_0047831 Ga0495606_0047831_300_749 149
1226 3300046507 Ga0495606_0100654 Ga0495606_0100654_710_1159 149
1227 3300046507 Ga0495606_0166745 Ga0495606_0166745_85_534 149
1228 3300046507 Ga0495606_0357107 Ga0495606_0357107_102_563 149
1229 3300046511 Ga0495608_0005591 Ga0495608_0005591_3014_3466 149
1230 3300046511 Ga0495608_0098774 Ga0495608_0098774_875_1324 149
1231 3300046511 Ga0495608_0132774 Ga0495608_0132774_681_1130 149
1232 3300046511 Ga0495608_0162907 Ga0495608_0162907_366_815 149
1233 3300046512 Ga0495610_0035063 Ga0495610_0035063_223_672 149
1234 3300046512 Ga0495610_0067501 Ga0495610_0067501_831_1280 149
1235 3300046512 Ga0495610_0219535 Ga0495610_0219535_266_727 149
1236 3300046513 Ga0495616_0219405 Ga0495616_0219405_266_727 149
1237 3300046513 Ga0495616_0254434 Ga0495616_0254434_215_664 149
1238 3300046513 Ga0495616_0416327 Ga0495616_0416327_83_532 149
1239 3300046513 Ga0495616_0423651 Ga0495616_0423651_30_479 149
1240 3300046514 Ga0495618_0008913 Ga0495618_0008913_4621_5073 149
1241 3300046514 Ga0495618_0024236 Ga0495618_0024236_2613_3062 149
1242 3300046514 Ga0495618_0647008 Ga0495618_0647008_158_607 149
1243 3300046515 Ga0495620_0085144 Ga0495620_0085144_809_1258 149
1244 3300046515 Ga0495620_0143201 Ga0495620_0143201_322_771 149
1245 3300046515 Ga0495620_0234790 Ga0495620_0234790_30_479 149
1246 3300046516 Ga0495628_0011937 Ga0495628_0011937_3444_3896 149
1247 3300046516 Ga0495628_0063195 Ga0495628_0063195_1688_2137 149
1248 3300046516 Ga0495628_0202189 Ga0495628_0202189_129_578 149
1249 3300046517 Ga0495630_0007480 Ga0495630_0007480_4549_4998 149
1250 3300046517 Ga0495630_0272757 Ga0495630_0272757_390_839 149
1251 3300046518 Ga0495631_0287003 Ga0495631_0287003_62_523 149
1252 3300046519 Ga0495632_0044408 Ga0495632_0044408_598_1047 149
1253 3300046519 Ga0495632_0112610 Ga0495632_0112610_387_836 149
1254 3300046519 Ga0495632_0268345 Ga0495632_0268345_145_594 149
1255 3300046519 Ga0495632_0402733 Ga0495632_0402733_26_475 149
1256 3300046522 Ga0495643_0183760 Ga0495643_0183760_360_809 149
1257 3300046522 Ga0495643_0196523 Ga0495643_0196523_69_518 149
1258 3300046523 Ga0495644_0090747 Ga0495644_0090747_274_723 149
1259 3300046523 Ga0495644_0150411 Ga0495644_0150411_221_670 149
1260 3300046523 Ga0495644_0325423 Ga0495644_0325423_106_555 149
1261 3300046524 Ga0495648_0001038 Ga0495648_0001038_13348_13797 149
1262 3300046524 Ga0495648_0051219 Ga0495648_0051219_952_1401 149
1263 3300046524 Ga0495648_0057693 Ga0495648_0057693_1589_2038 149
1264 3300046524 Ga0495648_0151294 Ga0495648_0151294_238_687 149
1265 3300046524 Ga0495648_0241622 Ga0495648_0241622_169_618 149
1266 3300046524 Ga0495648_0325792 Ga0495648_0325792_62_511 149
1267 3300046526 Ga0495666_0100113 Ga0495666_0100113_877_1326 149
1268 3300046529 Ga0495652_0008672 Ga0495652_0008672_1916_2365 149
1269 3300046529 Ga0495652_0026299 Ga0495652_0026299_4608_5057 149
1270 3300046529 Ga0495652_0032344 Ga0495652_0032344_1110_1562 149
1271 3300046529 Ga0495652_0147759 Ga0495652_0147759_1378_1827 149
1272 3300046530 Ga0495654_0127169 Ga0495654_0127169_419_880 149
1273 3300046530 Ga0495654_0132792 Ga0495654_0132792_243_692 149
1274 3300046530 Ga0495654_0341496 Ga0495654_0341496_61_510 149
1275 3300046531 Ga0495665_0097042 Ga0495665_0097042_136_585 149
1276 3300046531 Ga0495665_0100779 Ga0495665_0100779_403_852 149
1277 3300046533 Ga0495640_0013143 Ga0495640_0013143_4595_5047 149
1278 3300046533 Ga0495640_0026031 Ga0495640_0026031_2821_3270 149
1279 3300046533 Ga0495640_0029945 Ga0495640_0029945_3187_3636 149
1280 3300046535 Ga0495586_0428462 Ga0495586_0428462_204_653 149
1281 3300046535 Ga0495586_0880338 Ga0495586_0880338_49_498 149
1282 3300046536 Ga0495587_0003932 Ga0495587_0003932_6399_6851 149
1283 3300046536 Ga0495587_0725404 Ga0495587_0725404_34_483 149
1284 3300046537 Ga0495598_0020638 Ga0495598_0020638_550_1074 149
1285 3300046537 Ga0495598_0051329 Ga0495598_0051329_159_608 149
1286 3300046537 Ga0495598_0088094 Ga0495598_0088094_65_514 149
1287 3300046538 Ga0495609_0096278 Ga0495609_0096278_586_1035 149
1288 3300046538 Ga0495609_0213858 Ga0495609_0213858_84_533 149
1289 3300046538 Ga0495609_0273470 Ga0495609_0273470_52_501 149
1290 3300046538 Ga0495609_0304751 Ga0495609_0304751_23_472 149
1291 3300046539 Ga0495621_0013157 Ga0495621_0013157_85_534 149
1292 3300046539 Ga0495621_0033997 Ga0495621_0033997_627_1076 149
1293 3300046539 Ga0495621_0527581 Ga0495621_0527581_12_461 149
1294 3300046542 Ga0495597_0013096 Ga0495597_0013096_3175_3624 149
1295 3300046542 Ga0495597_0194201 Ga0495597_0194201_40_489 149
1296 3300046543 Ga0495645_0086399 Ga0495645_0086399_1237_1689 149
1297 3300046543 Ga0495645_0130007 Ga0495645_0130007_1022_1471 149
1298 3300046543 Ga0495645_0241215 Ga0495645_0241215_551_1000 149
1299 3300046557 Ga0495622_0001657 Ga0495622_0001657_2038_2487 149
1300 3300046557 Ga0495622_0035703 Ga0495622_0035703_1482_1931 149
1301 3300046557 Ga0495622_0078296 Ga0495622_0078296_561_1022 149
1302 3300046557 Ga0495622_0329488 Ga0495622_0329488_124_573 149
1303 3300046557 Ga0495622_0422520 Ga0495622_0422520_47_496 149
1304 3300046558 Ga0495633_0163362 Ga0495633_0163362_410_859 149
1305 3300046558 Ga0495633_0349937 Ga0495633_0349937_141_590 149
1306 3300046559 Ga0495667_0001588 Ga0495667_0001588_7520_7972 149
1307 3300046559 Ga0495667_0029808 Ga0495667_0029808_2711_3160 149
1308 3300046559 Ga0495667_0034368 Ga0495667_0034368_2784_3233 149
1309 3300046559 Ga0495667_0398470 Ga0495667_0398470_165_614 149
1310 3300046615 Ga0495656_0011088 Ga0495656_0011088_442_891 149
1311 3300046615 Ga0495656_0069986 Ga0495656_0069986_941_1465 149
1312 3300046615 Ga0495656_0120824 Ga0495656_0120824_132_581 149
1313 3300046615 Ga0495656_0149617 Ga0495656_0149617_216_665 149
1314 3300046615 Ga0495656_0278044 Ga0495656_0278044_331_780 149
1315 3300046616 Ga0495668_0090246 Ga0495668_0090246_486_944 149
1316 3300046616 Ga0495668_0111608 Ga0495668_0111608_799_1248 149
1317 3300046616 Ga0495668_0276874 Ga0495668_0276874_125_574 149
1318 3300046616 Ga0495668_0441184 Ga0495668_0441184_166_615 149
1319 3300046616 Ga0495668_0509948 Ga0495668_0509948_142_591 149
1320 3300046642 Ga0495634_0002373 Ga0495634_0002373_1128_1580 149
1321 3300046642 Ga0495634_0006397 Ga0495634_0006397_5739_6188 149
1322 3300046642 Ga0495634_0883147 Ga0495634_0883147_19_468 149
1323 3300046648 Ga0495611_0087276 Ga0495611_0087276_531_980 149
1324 3300046648 Ga0495611_0163188 Ga0495611_0163188_242_691 149
1325 3300046648 Ga0495611_0170791 Ga0495611_0170791_350_799 149
1326 3300046648 Ga0495611_0200653 Ga0495611_0200653_401_862 149
1327 3300046648 Ga0495611_0335740 Ga0495611_0335740_138_587 149
1328 3300046648 Ga0495611_0350887 Ga0495611_0350887_190_639 149
1329 3300046660 Ga0495625_0035691 Ga0495625_0035691_379_828 149
1330 3300046660 Ga0495625_0086733 Ga0495625_0086733_146_595 149
1331 3300046660 Ga0495625_0149756 Ga0495625_0149756_151_612 149
1332 3300046660 Ga0495625_0231837 Ga0495625_0231837_387_836 149
1333 3300046660 Ga0495625_0363792 Ga0495625_0363792_394_843 149
1334 3300046660 Ga0495625_0415194 Ga0495625_0415194_194_643 149
1335 3300046663 Ga0495635_0000346 Ga0495635_0000346_4898_5350 149
1336 3300046663 Ga0495635_0001380 Ga0495635_0001380_10171_10620 149
1337 3300046663 Ga0495635_0119709 Ga0495635_0119709_184_633 149
1338 3300046663 Ga0495635_0269841 Ga0495635_0269841_390_839 149
1339 3300046664 Ga0495659_0024844 Ga0495659_0024844_564_1013 149
1340 3300046664 Ga0495659_0092874 Ga0495659_0092874_564_1013 149
1341 3300046665 Ga0495661_0189773 Ga0495661_0189773_127_576 149
1342 3300046665 Ga0495661_0211192 Ga0495661_0211192_487_948 149
1343 3300046665 Ga0495661_0287916 Ga0495661_0287916_53_502 149
1344 3300046665 Ga0495661_0294470 Ga0495661_0294470_13_462 149
1345 3300046665 Ga0495661_0386476 Ga0495661_0386476_176_625 149
1346 3300046674 Ga0495588_0007097 Ga0495588_0007097_2446_2895 149
1347 3300046674 Ga0495588_0199828 Ga0495588_0199828_542_991 149
1348 3300046674 Ga0495588_0559621 Ga0495588_0559621_27_560 149
1349 3300046674 Ga0495588_0658749 Ga0495588_0658749_47_508 149
1350 3300046675 Ga0495657_0010298 Ga0495657_0010298_3014_3466 149
1351 3300046675 Ga0495657_0011353 Ga0495657_0011353_1595_2044 149
1352 3300046675 Ga0495657_0034813 Ga0495657_0034813_27_476 149
1353 3300046675 Ga0495657_0337918 Ga0495657_0337918_182_631 149
1354 3300046678 Ga0495599_0000522 Ga0495599_0000522_6409_6861 149
1355 3300046678 Ga0495599_0046395 Ga0495599_0046395_785_1234 149
1356 3300046678 Ga0495599_0092868 Ga0495599_0092868_1096_1545 149
1357 3300046678 Ga0495599_0139647 Ga0495599_0139647_87_536 149
1358 3300046679 Ga0495623_0005412 Ga0495623_0005412_2088_2540 149
1359 3300046679 Ga0495623_0091055 Ga0495623_0091055_765_1214 149
1360 3300046680 Ga0495646_0000537 Ga0495646_0000537_7478_7930 149
1361 3300046681 Ga0495647_0051142 Ga0495647_0051142_155_604 149
1362 3300046683 Ga0495658_0017128 Ga0495658_0017128_3106_3555 149
1363 3300046684 Ga0495669_0003415 Ga0495669_0003415_2410_2859 149
1364 3300046684 Ga0495669_0048084 Ga0495669_0048084_576_1025 149
1365 3300046684 Ga0495669_0263510 Ga0495669_0263510_83_532 149
1366 3300046684 Ga0495669_0453859 Ga0495669_0453859_71_520 149
1367 3300046689 Ga0495613_0027437 Ga0495613_0027437_1101_1550 149
1368 3300046689 Ga0495613_0047407 Ga0495613_0047407_2423_2875 149
1369 3300046689 Ga0495613_0256867 Ga0495613_0256867_146_595 149
1370 3300046690 Ga0495624_0004020 Ga0495624_0004020_244_693 149
1371 3300046690 Ga0495624_0108267 Ga0495624_0108267_259_708 149
1372 3300046690 Ga0495624_0198871 Ga0495624_0198871_753_1202 149
1373 3300046690 Ga0495624_0234435 Ga0495624_0234435_152_601 149
1374 3300046690 Ga0495624_0393044 Ga0495624_0393044_246_695 149
1375 3300046691 Ga0495670_0000757 Ga0495670_0000757_7910_8371 149
1376 3300046691 Ga0495670_0026769 Ga0495670_0026769_2233_2682 149
1377 3300046692 Ga0495671_0117840 Ga0495671_0117840_323_772 149
1378 3300046692 Ga0495671_0127622 Ga0495671_0127622_731_1180 149
1379 3300046692 Ga0495671_0222292 Ga0495671_0222292_364_813 149
1380 3300046692 Ga0495671_0249479 Ga0495671_0249479_211_744 149
1381 3300046692 Ga0495671_0440731 Ga0495671_0440731_140_589 149
1382 3300046694 Ga0495649_0022922 Ga0495649_0022922_1658_2107 149
1383 3300046694 Ga0495649_0213505 Ga0495649_0213505_216_665 149
1384 3300046694 Ga0495649_0375921 Ga0495649_0375921_146_595 149
1385 3300046694 Ga0495649_0390316 Ga0495649_0390316_49_498 149
1386 3300046694 Ga0495649_0521523 Ga0495649_0521523_64_513 149
1387 3300046794 Ga0495589_0101402 Ga0495589_0101402_650_1099 149
1388 3300046794 Ga0495589_0235451 Ga0495589_0235451_173_622 149
1389 3300046794 Ga0495589_0333251 Ga0495589_0333251_123_572 149
1390 3300046809 Ga0495600_0000398 Ga0495600_0000398_933_1385 149
1391 3300046809 Ga0495600_0008503 Ga0495600_0008503_5513_5962 149
1392 3300046809 Ga0495600_0024296 Ga0495600_0024296_2993_3442 149
1393 3300046809 Ga0495600_0147695 Ga0495600_0147695_110_559 149
1394 3300046809 Ga0495600_0219559 Ga0495600_0219559_106_555 149
1395 3300046809 Ga0495600_0320235 Ga0495600_0320235_213_662 149
1396 3300046809 Ga0495600_0417361 Ga0495600_0417361_335_784 149
1397 3300047315 Ga0495581_0051626 Ga0495581_0051626_44_493 149
1398 3300047315 Ga0495581_0187432 Ga0495581_0187432_380_829 149
1399 3300047317 Ga0495604_0004007 Ga0495604_0004007_7688_8140 149
1400 3300047317 Ga0495604_0005171 Ga0495604_0005171_6912_7361 149
1401 3300047317 Ga0495604_0007540 Ga0495604_0007540_6914_7363 149
1402 3300047317 Ga0495604_0034557 Ga0495604_0034557_1970_2419 149
1403 3300047317 Ga0495604_0443734 Ga0495604_0443734_242_691 149
1404 3300047318 Ga0495636_0011599 Ga0495636_0011599_77_526 149
1405 3300047318 Ga0495636_0467951 Ga0495636_0467951_75_524 149
1406 3300047319 Ga0495674_0004134 Ga0495674_0004134_7081_7533 149
1407 3300047319 Ga0495674_0006731 Ga0495674_0006731_6571_7020 149
1408 3300047319 Ga0495674_0076952 Ga0495674_0076952_238_687 149
1409 3300047320 Ga0495672_0165212 Ga0495672_0165212_584_1033 149
1410 3300047320 Ga0495672_0333381 Ga0495672_0333381_219_668 149
1411 3300047321 Ga0495676_0025537 Ga0495676_0025537_4273_4722 149
1412 3300047321 Ga0495676_0034955 Ga0495676_0034955_2097_2546 149
1413 3300047321 Ga0495676_0117815 Ga0495676_0117815_604_1053 149
1414 3300047322 Ga0495680_0002197 Ga0495680_0002197_9839_10291 149
1415 3300047322 Ga0495680_0006139 Ga0495680_0006139_6939_7388 149
1416 3300047322 Ga0495680_0770156 Ga0495680_0770156_155_604 149
1417 3300047323 Ga0495683_0167698 Ga0495683_0167698_315_764 149
1418 3300047443 Ga0495687_075687 Ga0495687_075687_61_510 149
1419 3300047444 Ga0495675_0001020 Ga0495675_0001020_9018_9470 149
1420 3300047444 Ga0495675_0087204 Ga0495675_0087204_1087_1536 149
1421 3300047445 Ga0495677_0128474 Ga0495677_0128474_262_711 149
1422 3300047469 Ga0495673_0083555 Ga0495673_0083555_624_1073 149
1423 3300047469 Ga0495673_0092356 Ga0495673_0092356_497_946 149
1424 3300047469 Ga0495673_0140598 Ga0495673_0140598_29_478 149
1425 3300047469 Ga0495673_0173904 Ga0495673_0173904_56_505 149
1426 3300047469 Ga0495673_0217501 Ga0495673_0217501_245_694 149
1427 3300047470 Ga0495681_0318410 Ga0495681_0318410_63_524 149
1428 3300047471 Ga0495684_0001669 Ga0495684_0001669_9839_10291 149
1429 3300047471 Ga0495684_0004704 Ga0495684_0004704_5558_6007 149
1430 3300047471 Ga0495684_0024356 Ga0495684_0024356_3297_3746 149
1431 3300047472 Ga0495686_0055110 Ga0495686_0055110_58_519 149
1432 3300047472 Ga0495686_0310311 Ga0495686_0310311_304_753 149
1433 3300047673 Ga0495593_0000190 Ga0495593_0000190_6647_7099 149
1434 3300047673 Ga0495593_0021782 Ga0495593_0021782_430_879 149
1435 3300047673 Ga0495593_0022440 Ga0495593_0022440_3032_3481 149
1436 3300048088 Ga0495602_0001719 Ga0495602_0001719_9169_9618 149
1437 3300048088 Ga0495602_0004841 Ga0495602_0004841_10698_11150 149
1438 3300048088 Ga0495602_0044617 Ga0495602_0044617_696_1145 149
1439 3300048090 Ga0495615_0003530 Ga0495615_0003530_1161_1685 149
1440 3300048091 Ga0495626_0212925 Ga0495626_0212925_173_622 149
1441 3300048903 Ga0496100_0065196 Ga0496100_0065196_1903_2352 149
1442 3300048903 Ga0496100_0362376 Ga0496100_0362376_223_672 149
1443 3300048903 Ga0496100_0932015 Ga0496100_0932015_142_591 149
1444 3300048904 Ga0496101_0018829 Ga0496101_0018829_1179_1628 149
1445 3300048904 Ga0496101_0205581 Ga0496101_0205581_996_1445 149
1446 3300048904 Ga0496101_0212782 Ga0496101_0212782_607_1056 149
1447 3300048904 Ga0496101_0334223 Ga0496101_0334223_625_1074 149
1448 3300048904 Ga0496101_0340419 Ga0496101_0340419_265_714 149
1449 3300048904 Ga0496101_0427283 Ga0496101_0427283_471_920 149
1450 3300048904 Ga0496101_0610706 Ga0496101_0610706_374_823 149
1451 3300048904 Ga0496101_1266611 Ga0496101_1266611_101_550 149
1452 3300048905 Ga0496102_0010809 Ga0496102_0010809_1162_1611 149
1453 3300048905 Ga0496102_0059740 Ga0496102_0059740_2293_2742 149
1454 3300048905 Ga0496102_0090008 Ga0496102_0090008_927_1376 149
1455 3300048905 Ga0496102_0108748 Ga0496102_0108748_16_465 149
1456 3300048905 Ga0496102_0347586 Ga0496102_0347586_497_946 149
1457 3300048905 Ga0496102_0458804 Ga0496102_0458804_402_851 149
1458 3300048905 Ga0496102_0641467 Ga0496102_0641467_381_830 149
1459 3300048905 Ga0496102_0701273 Ga0496102_0701273_197_646 149
1460 3300048905 Ga0496102_1361471 Ga0496102_1361471_166_615 149
1461 3300048906 Ga0496103_0006115 Ga0496103_0006115_2615_3064 149
1462 3300048906 Ga0496103_0083756 Ga0496103_0083756_1452_1901 149
1463 3300048906 Ga0496103_0157727 Ga0496103_0157727_650_1099 149
1464 3300048906 Ga0496103_0258809 Ga0496103_0258809_486_935 149
1465 3300048906 Ga0496103_0658467 Ga0496103_0658467_16_465 149
1466 3300048906 Ga0496103_0935536 Ga0496103_0935536_60_509 149
1467 3300048907 Ga0496104_0002128 Ga0496104_0002128_8380_8829 149
1468 3300048907 Ga0496104_0006775 Ga0496104_0006775_3082_3531 149
1469 3300048907 Ga0496104_0049600 Ga0496104_0049600_3031_3480 149
1470 3300048907 Ga0496104_0101083 Ga0496104_0101083_327_776 149
1471 3300048907 Ga0496104_0263757 Ga0496104_0263757_520_975 149
1472 3300048907 Ga0496104_0757248 Ga0496104_0757248_129_578 149
1473 3300048907 Ga0496104_0786942 Ga0496104_0786942_225_674 149
1474 3300048908 Ga0496105_0005208 Ga0496105_0005208_128_577 149
1475 3300048908 Ga0496105_0009083 Ga0496105_0009083_3019_3468 149
1476 3300048908 Ga0496105_0029203 Ga0496105_0029203_926_1375 149
1477 3300048908 Ga0496105_0111707 Ga0496105_0111707_1614_2063 149
1478 3300048908 Ga0496105_0171132 Ga0496105_0171132_1051_1500 149
1479 3300048908 Ga0496105_0205500 Ga0496105_0205500_829_1278 149
1480 3300048908 Ga0496105_0247020 Ga0496105_0247020_90_539 149
1481 3300048908 Ga0496105_0572776 Ga0496105_0572776_282_731 149
1482 3300048909 Ga0496106_0004764 Ga0496106_0004764_8442_8897 149
1483 3300048909 Ga0496106_0058382 Ga0496106_0058382_135_584 149
1484 3300048909 Ga0496106_0121811 Ga0496106_0121811_832_1281 149
1485 3300048909 Ga0496106_0133749 Ga0496106_0133749_964_1413 149
1486 3300048909 Ga0496106_0342849 Ga0496106_0342849_129_578 149
1487 3300048909 Ga0496106_0376869 Ga0496106_0376869_656_1117 149
1488 3300048909 Ga0496106_0911546 Ga0496106_0911546_220_669 149
1489 3300048910 Ga0496107_0001840 Ga0496107_0001840_5555_6004 149
1490 3300048910 Ga0496107_0008370 Ga0496107_0008370_2758_3207 149
1491 3300048910 Ga0496107_0026974 Ga0496107_0026974_1701_2150 149
1492 3300048910 Ga0496107_0129249 Ga0496107_0129249_153_608 149
1493 3300048910 Ga0496107_0320513 Ga0496107_0320513_69_518 149
1494 3300048910 Ga0496107_0602014 Ga0496107_0602014_134_583 149
1495 3300048911 Ga0496108_0001980 Ga0496108_0001980_1466_1921 149
1496 3300048911 Ga0496108_0024345 Ga0496108_0024345_2189_2638 149
1497 3300048911 Ga0496108_0054851 Ga0496108_0054851_1882_2331 149
1498 3300048911 Ga0496108_0062831 Ga0496108_0062831_2565_3014 149
1499 3300048911 Ga0496108_0325002 Ga0496108_0325002_432_881 149
1500 3300048912 Ga0496109_0015085 Ga0496109_0015085_1292_1747 149
1501 3300048912 Ga0496109_0029396 Ga0496109_0029396_3965_4414 149
1502 3300048912 Ga0496109_0031537 Ga0496109_0031537_1557_2006 149
1503 3300048912 Ga0496109_0317776 Ga0496109_0317776_341_790 149
1504 3300048912 Ga0496109_0593596 Ga0496109_0593596_136_585 149
1505 3300048913 Ga0496110_0006296 Ga0496110_0006296_6915_7364 149
1506 3300048913 Ga0496110_0020595 Ga0496110_0020595_676_1125 149
1507 3300048913 Ga0496110_0031676 Ga0496110_0031676_107_556 149
1508 3300048913 Ga0496110_0227924 Ga0496110_0227924_677_1126 149
1509 3300048913 Ga0496110_0312467 Ga0496110_0312467_384_833 149
1510 3300048913 Ga0496110_0318973 Ga0496110_0318973_176_625 149
1511 3300048913 Ga0496110_0349333 Ga0496110_0349333_489_938 149
1512 3300048913 Ga0496110_0796989 Ga0496110_0796989_299_748 149
1513 3300048914 Ga0496111_0240487 Ga0496111_0240487_40_489 149
1514 3300048914 Ga0496111_0281550 Ga0496111_0281550_591_1040 149
1515 3300048914 Ga0496111_0285343 Ga0496111_0285343_653_1102 149
1516 3300048914 Ga0496111_0289130 Ga0496111_0289130_442_891 149
1517 3300048914 Ga0496111_0305041 Ga0496111_0305041_712_1161 149
1518 3300048914 Ga0496111_0402074 Ga0496111_0402074_244_693 149
1519 3300048915 Ga0496112_0004485 Ga0496112_0004485_526_981 149
1520 3300048915 Ga0496112_0019812 Ga0496112_0019812_5720_6169 149
1521 3300048915 Ga0496112_0057366 Ga0496112_0057366_1299_1748 149
1522 3300048915 Ga0496112_0079729 Ga0496112_0079729_197_646 149
1523 3300048915 Ga0496112_0188187 Ga0496112_0188187_242_691 149
1524 3300048915 Ga0496112_0253295 Ga0496112_0253295_194_643 149
1525 3300048915 Ga0496112_0305707 Ga0496112_0305707_257_706 149
1526 3300048915 Ga0496112_0659880 Ga0496112_0659880_410_859 149
1527 3300048916 Ga0496113_0175413 Ga0496113_0175413_264_713 149
1528 3300048916 Ga0496113_0232226 Ga0496113_0232226_245_694 149
1529 3300048916 Ga0496113_0268418 Ga0496113_0268418_499_948 149
1530 3300048916 Ga0496113_0355584 Ga0496113_0355584_415_864 149
1531 3300048916 Ga0496113_0372887 Ga0496113_0372887_181_630 149
1532 3300048916 Ga0496113_0427384 Ga0496113_0427384_79_528 149
1533 3300048917 Ga0496114_0008932 Ga0496114_0008932_218_667 149
1534 3300048917 Ga0496114_0060493 Ga0496114_0060493_2669_3118 149
1535 3300048917 Ga0496114_0071900 Ga0496114_0071900_1503_1952 149
1536 3300048917 Ga0496114_0093078 Ga0496114_0093078_1982_2431 149
1537 3300048917 Ga0496114_0517443 Ga0496114_0517443_495_944 149
1538 3300048917 Ga0496114_0520904 Ga0496114_0520904_102_551 149
1539 3300048917 Ga0496114_0887600 Ga0496114_0887600_143_592 149
1540 3300048918 Ga0496115_0001528 Ga0496115_0001528_9308_9757 149
1541 3300048918 Ga0496115_0014005 Ga0496115_0014005_5566_6015 149
1542 3300048918 Ga0496115_0067015 Ga0496115_0067015_466_915 149
1543 3300048918 Ga0496115_0107934 Ga0496115_0107934_1162_1611 149
1544 3300048918 Ga0496115_0149426 Ga0496115_0149426_280_732 149
1545 3300048918 Ga0496115_0149762 Ga0496115_0149762_1110_1559 149
1546 3300048918 Ga0496115_0435765 Ga0496115_0435765_430_885 149
1547 3300048918 Ga0496115_0503641 Ga0496115_0503641_139_588 149
1548 3300048918 Ga0496115_0842098 Ga0496115_0842098_95_544 149
1549 3300048918 Ga0496115_1311962 Ga0496115_1311962_25_474 149
1550 3300048919 Ga0496116_0002360 Ga0496116_0002360_17636_18097 149
1551 3300048919 Ga0496116_0055335 Ga0496116_0055335_619_1068 149
1552 3300048920 Ga0496117_0024592 Ga0496117_0024592_2619_3080 149
1553 3300048920 Ga0496117_0055499 Ga0496117_0055499_490_951 149
1554 3300048920 Ga0496117_0069138 Ga0496117_0069138_1540_1989 149
1555 3300048920 Ga0496117_0098446 Ga0496117_0098446_759_1208 149
1556 3300048920 Ga0496117_0147648 Ga0496117_0147648_782_1231 149
1557 3300048920 Ga0496117_0247274 Ga0496117_0247274_310_759 149
1558 3300048920 Ga0496117_0319027 Ga0496117_0319027_162_611 149
1559 3300048920 Ga0496117_0353543 Ga0496117_0353543_119_568 149
1560 3300048921 Ga0496118_0037036 Ga0496118_0037036_636_1085 149
1561 3300048921 Ga0496118_0108199 Ga0496118_0108199_626_1075 149
1562 3300048921 Ga0496118_0190023 Ga0496118_0190023_753_1214 149
1563 3300048921 Ga0496118_0254707 Ga0496118_0254707_103_552 149
1564 3300048921 Ga0496118_0431380 Ga0496118_0431380_137_586 149
1565 3300048921 Ga0496118_0505845 Ga0496118_0505845_39_500 149
1566 3300048921 Ga0496118_0559530 Ga0496118_0559530_65_514 149
1567 3300048922 Ga0496119_0044767 Ga0496119_0044767_797_1246 149
1568 3300048922 Ga0496119_0083600 Ga0496119_0083600_578_1027 149
1569 3300048922 Ga0496119_0177088 Ga0496119_0177088_213_662 149
1570 3300048922 Ga0496119_0293595 Ga0496119_0293595_150_599 149
1571 3300048922 Ga0496119_0566901 Ga0496119_0566901_25_486 149
1572 3300048923 Ga0496120_0021422 Ga0496120_0021422_3019_3468 149
1573 3300048923 Ga0496120_0026469 Ga0496120_0026469_1895_2344 149
1574 3300048924 Ga0496121_0004217 Ga0496121_0004217_18646_19107 149
1575 3300048924 Ga0496121_0024578 Ga0496121_0024578_2979_3428 149
1576 3300048924 Ga0496121_0026133 Ga0496121_0026133_224_673 149
1577 3300048924 Ga0496121_0042542 Ga0496121_0042542_2206_2655 149
1578 3300048924 Ga0496121_0059217 Ga0496121_0059217_1669_2118 149
1579 3300048924 Ga0496121_0146344 Ga0496121_0146344_736_1185 149
1580 3300048924 Ga0496121_0308783 Ga0496121_0308783_43_492 149
1581 3300048924 Ga0496121_0335526 Ga0496121_0335526_25_474 149
1582 3300048924 Ga0496121_0383863 Ga0496121_0383863_63_512 149
1583 3300048924 Ga0496121_0393818 Ga0496121_0393818_255_704 149
1584 3300048924 Ga0496121_0409651 Ga0496121_0409651_152_625 149
1585 3300048924 Ga0496121_0445241 Ga0496121_0445241_27_476 149
1586 3300048924 Ga0496121_0619446 Ga0496121_0619446_203_652 149
1587 3300048924 Ga0496121_0691491 Ga0496121_0691491_112_561 149
1588 3300048926 Ga0496123_0041651 Ga0496123_0041651_2451_2912 149
1589 3300048926 Ga0496123_0129019 Ga0496123_0129019_469_918 149
1590 3300048927 Ga0496124_0107574 Ga0496124_0107574_610_1059 149
1591 3300048927 Ga0496124_0131041 Ga0496124_0131041_1376_1825 149
1592 3300048927 Ga0496124_0282785 Ga0496124_0282785_709_1158 149
1593 3300048927 Ga0496124_0300355 Ga0496124_0300355_28_477 149
1594 3300048927 Ga0496124_0656285 Ga0496124_0656285_118_567 149
1595 3300048927 Ga0496124_0714667 Ga0496124_0714667_88_537 149
1596 3300048928 Ga0496125_0022040 Ga0496125_0022040_4012_4473 149
1597 3300048928 Ga0496125_0022335 Ga0496125_0022335_2784_3245 149
1598 3300048928 Ga0496125_0060254 Ga0496125_0060254_2082_2543 149
1599 3300048928 Ga0496125_0062839 Ga0496125_0062839_130_579 149
1600 3300048928 Ga0496125_0091796 Ga0496125_0091796_1152_1601 149
1601 3300048928 Ga0496125_0283924 Ga0496125_0283924_355_804 149
1602 3300048928 Ga0496125_0618190 Ga0496125_0618190_68_517 149
1603 3300048929 Ga0496126_0014622 Ga0496126_0014622_2947_3396 149
1604 3300048929 Ga0496126_0025409 Ga0496126_0025409_2049_2498 149
1605 3300048929 Ga0496126_0037954 Ga0496126_0037954_3133_3582 149
1606 3300048929 Ga0496126_0054823 Ga0496126_0054823_1116_1565 149
1607 3300048929 Ga0496126_0061444 Ga0496126_0061444_244_693 149
1608 3300048929 Ga0496126_0130622 Ga0496126_0130622_42_491 149
1609 3300048929 Ga0496126_0140303 Ga0496126_0140303_1267_1716 149
1610 3300048929 Ga0496126_0252266 Ga0496126_0252266_279_728 149
1611 3300048929 Ga0496126_0260491 Ga0496126_0260491_178_627 149
1612 3300048929 Ga0496126_0316920 Ga0496126_0316920_493_966 149
1613 3300048929 Ga0496126_0422499 Ga0496126_0422499_503_964 149
1614 3300048929 Ga0496126_1009061 Ga0496126_1009061_49_498 149
1615 3300048929 Ga0496126_1060356 Ga0496126_1060356_94_543 149
1616 3300049460 Ga0495682_0112000 Ga0495682_0112000_380_829 149
1617 3300049460 Ga0495682_0150374 Ga0495682_0150374_52_501 149
1618 3300049460 Ga0495682_0225797 Ga0495682_0225797_33_482 149
1619 3300049569 Ga0501032_0000076 Ga0501032_0000076_46304_46768 149
1620 3300049570 Ga0501033_0000093 Ga0501033_0000093_38476_38940 149
1621 3300049571 Ga0501034_0001640 Ga0501034_0001640_14723_15187 149
1622 3300049571 Ga0501034_0235039 Ga0501034_0235039_553_1002 149
1623 3300049571 Ga0501034_1162371 Ga0501034_1162371_44_493 149
1624 3300049572 Ga0501036_0000035 Ga0501036_0000035_41297_41761 149
1625 3300049573 Ga0501037_0000026 Ga0501037_0000026_37081_37545 149
1626 3300049574 Ga0501038_0000037 Ga0501038_0000037_46277_46741 149
1627 3300049575 Ga0501039_0000263 Ga0501039_0000263_8933_9397 149
1628 3300049579 Ga0501043_0000115 Ga0501043_0000115_28918_29382 149
1629 3300049580 Ga0501046_0000210 Ga0501046_0000210_28890_29354 149
1630 3300049581 Ga0501047_0000094 Ga0501047_0000094_23596_24060 149
1631 3300049581 Ga0501047_0045478 Ga0501047_0045478_2307_2759 149
1632 3300049582 Ga0501048_0012411 Ga0501048_0012411_492_956 149
1633 3300049582 Ga0501048_0125237 Ga0501048_0125237_339_791 149
1634 3300049583 Ga0501067_0026617 Ga0501067_0026617_1271_1735 149
1635 3300049583 Ga0501067_0140788 Ga0501067_0140788_627_1076 149
1636 3300049584 Ga0501068_0001034 Ga0501068_0001034_13531_13995 149
1637 3300049585 Ga0501069_0004848 Ga0501069_0004848_5702_6166 149
1638 3300049585 Ga0501069_0155153 Ga0501069_0155153_721_1170 149
1639 3300049586 Ga0501070_0000134 Ga0501070_0000134_23692_24156 149
1640 3300049586 Ga0501070_0053140 Ga0501070_0053140_901_1353 149
1641 3300049588 Ga0501072_0059293 Ga0501072_0059293_1710_2174 149
1642 3300049589 Ga0501073_0007576 Ga0501073_0007576_2563_3027 149
1643 3300049589 Ga0501073_0207705 Ga0501073_0207705_61_513 149
1644 3300049589 Ga0501073_0275856 Ga0501073_0275856_450_899 149
1645 3300049589 Ga0501073_1063235 Ga0501073_1063235_32_481 149
1646 3300049590 Ga0501074_0005960 Ga0501074_0005960_6286_6750 149
1647 3300049590 Ga0501074_0166763 Ga0501074_0166763_197_649 149
1648 3300049742 Ga0501080_0000076 Ga0501080_0000076_23357_23821 149
1649 3300049742 Ga0501080_0040484 Ga0501080_0040484_2694_3146 149
1650 3300049742 Ga0501080_0162213 Ga0501080_0162213_89_538 149
1651 3300049744 Ga0501083_0085514 Ga0501083_0085514_374_823 149
1652 3300049744 Ga0501083_0978690 Ga0501083_0978690_48_509 149
1653 3300049822 Ga0501035_0000533 Ga0501035_0000533_28918_29382 149
1654 3300049823 Ga0501044_0000507 Ga0501044_0000507_23358_23822 149
1655 3300049823 Ga0501044_0555403 Ga0501044_0555403_56_505 149
1656 3300050489 nmdc:mga03683_183258_c1 nmdc:mga03683_183258_c1_336_797 149
1657 3300050489 nmdc:mga03683_353232_c1 nmdc:mga03683_353232_c1_202_651 149
1658 3300050489 nmdc:mga03683_385757_c1 nmdc:mga03683_385757_c1_164_613 149
1659 3300050490 nmdc:mga03n38_222446_c1 nmdc:mga03n38_222446_c1_251_880 149
1660 3300050491 nmdc:mga00v17_157454_c1 nmdc:mga00v17_157454_c1_500_961 149
1661 3300050491 nmdc:mga00v17_23984_c1 nmdc:mga00v17_23984_c1_2215_2664 149
1662 3300050491 nmdc:mga00v17_332290_c1 nmdc:mga00v17_332290_c1_39_488 149
1663 3300050491 nmdc:mga00v17_337861_c1 nmdc:mga00v17_337861_c1_363_824 149
1664 3300050491 nmdc:mga00v17_928073_c1 nmdc:mga00v17_928073_c1_66_515 149
1665 3300050492 nmdc:mga0yw44_118957_c1 nmdc:mga0yw44_118957_c1_1047_1496 149
1666 3300050492 nmdc:mga0yw44_18253_c1 nmdc:mga0yw44_18253_c1_328_777 149
1667 3300050492 nmdc:mga0yw44_490286_c1 nmdc:mga0yw44_490286_c1_362_811 149
1668 3300050492 nmdc:mga0yw44_61539_c1 nmdc:mga0yw44_61539_c1_808_1257 149
1669 3300050492 nmdc:mga0yw44_69378_c1 nmdc:mga0yw44_69378_c1_449_910 149
1670 3300050493 nmdc:mga0k408_218381_c1 nmdc:mga0k408_218381_c1_372_821 149
1671 3300050493 nmdc:mga0k408_284606_c1 nmdc:mga0k408_284606_c1_467_916 149
1672 3300050493 nmdc:mga0k408_29471_c1 nmdc:mga0k408_29471_c1_686_1135 149
1673 3300050493 nmdc:mga0k408_663762_c1 nmdc:mga0k408_663762_c1_61_510 149
1674 3300050494 nmdc:mga06z11_172523_c1 nmdc:mga06z11_172523_c1_726_1175 149
1675 3300050494 nmdc:mga06z11_180910_c1 nmdc:mga06z11_180910_c1_176_625 149
1676 3300050494 nmdc:mga06z11_424049_c1 nmdc:mga06z11_424049_c1_99_548 149
1677 3300050494 nmdc:mga06z11_471066_c1 nmdc:mga06z11_471066_c1_268_717 149
1678 3300050495 nmdc:mga04h51_221672_c1 nmdc:mga04h51_221672_c1_268_717 149
1679 3300050495 nmdc:mga04h51_223004_c1 nmdc:mga04h51_223004_c1_100_549 149
1680 3300050496 nmdc:mga07m45_184829_c1 nmdc:mga07m45_184829_c1_632_1093 149
1681 3300050496 nmdc:mga07m45_204325_c1 nmdc:mga07m45_204325_c1_423_872 149
1682 3300050496 nmdc:mga07m45_218851_c1 nmdc:mga07m45_218851_c1_553_1002 149
1683 3300050496 nmdc:mga07m45_322869_c1 nmdc:mga07m45_322869_c1_44_505 149
1684 3300050496 nmdc:mga07m45_35536_c1 nmdc:mga07m45_35536_c1_2273_2722 149
1685 3300050496 nmdc:mga07m45_377597_c1 nmdc:mga07m45_377597_c1_112_561 149
1686 3300050496 nmdc:mga07m45_531301_c1 nmdc:mga07m45_531301_c1_202_651 149
1687 3300050496 nmdc:mga07m45_65834_c1 nmdc:mga07m45_65834_c1_1499_1948 149
1688 3300050496 nmdc:mga07m45_702870_c1 nmdc:mga07m45_702870_c1_40_489 149
1689 3300050496 nmdc:mga07m45_85017_c1 nmdc:mga07m45_85017_c1_442_891 149
1690 3300050507 nmdc:mga05p37_318829_c1 nmdc:mga05p37_318829_c1_594_1043 149
1691 3300050507 nmdc:mga05p37_974915_c1 nmdc:mga05p37_974915_c1_367_816 149
1692 3300050508 nmdc:mga09592_733831_c1 nmdc:mga09592_733831_c1_255_704 149
1693 3300050511 nmdc:mga08y16_1963255_c1 nmdc:mga08y16_1963255_c1_17_466 149
1694 3300050511 nmdc:mga08y16_862629_c1 nmdc:mga08y16_862629_c1_120_569 149
1695 3300050512 nmdc:mga0n895_14081_c1 nmdc:mga0n895_14081_c1_515_964 149
1696 3300050514 nmdc:mga08x19_920167_c1 nmdc:mga08x19_920167_c1_139_588 149
1697 3300050516 nmdc:mga0sz30_21570_c1 nmdc:mga0sz30_21570_c1_1030_1479 149
1698 3300050516 nmdc:mga0sz30_539945_c1 nmdc:mga0sz30_539945_c1_30_479 149
1699 3300050516 nmdc:mga0sz30_83531_c1 nmdc:mga0sz30_83531_c1_60_509 149
1700 3300053077 Ga0495601_0013705 Ga0495601_0013705_186_638 149
1701 3300053077 Ga0495601_0050280 Ga0495601_0050280_2163_2612 149
1702 3300053077 Ga0495601_0120675 Ga0495601_0120675_740_1189 149
1703 3300053077 Ga0495601_0285131 Ga0495601_0285131_52_501 149
1704 3300053077 Ga0495601_0477811 Ga0495601_0477811_282_731 149
1705 3300053078 Ga0495612_0023553 Ga0495612_0023553_968_1417 149
1706 3300053078 Ga0495612_0058623 Ga0495612_0058623_324_773 149
1707 3300053079 Ga0500610_0072351 Ga0500610_0072351_518_967 149
1708 3300053080 Ga0500635_0092661 Ga0500635_0092661_615_1064 149
1709 3300053083 Ga0495655_0052088 Ga0495655_0052088_58_507 149
1710 3300053083 Ga0495655_0058818 Ga0495655_0058818_396_845 149
1711 3300053083 Ga0495655_0136904 Ga0495655_0136904_218_667 149
1712 3300053083 Ga0495655_0181156 Ga0495655_0181156_203_652 149
1713 3300053084 Ga0495595_0000170 Ga0495595_0000170_7499_7951 149
1714 3300053084 Ga0495595_0167853 Ga0495595_0167853_397_846 149
1715 3300053084 Ga0495595_0242386 Ga0495595_0242386_119_568 149
1716 3300053085 Ga0495619_0000803 Ga0495619_0000803_9018_9470 149
1717 3300053085 Ga0495619_0006966 Ga0495619_0006966_4709_5158 149
1718 3300053085 Ga0495619_0192320 Ga0495619_0192320_725_1174 149
1719 3300053085 Ga0495619_0680058 Ga0495619_0680058_195_647 149
1720 3300053085 Ga0495619_0802659 Ga0495619_0802659_147_596 149
1721 3300053086 Ga0500578_0202710 Ga0500578_0202710_460_909 149
1722 3300053086 Ga0500578_0211384 Ga0500578_0211384_508_957 149
1723 3300053086 Ga0500578_0233959 Ga0500578_0233959_250_699 149
1724 3300053086 Ga0500578_0272475 Ga0500578_0272475_106_555 149
1725 3300053086 Ga0500578_0286372 Ga0500578_0286372_55_504 149
1726 3300053086 Ga0500578_0453092 Ga0500578_0453092_202_651 149
1727 3300053086 Ga0500578_0606971 Ga0500578_0606971_101_562 149
1728 3300053087 Ga0500643_000018 Ga0500643_000018_271288_271737 149
1729 3300053087 Ga0500643_054343 Ga0500643_054343_629_1090 149
1730 3300053088 Ga0500644_0071203 Ga0500644_0071203_791_1240 149
1731 3300053088 Ga0500644_0412800 Ga0500644_0412800_124_573 149
1732 3300053089 Ga0500581_038250 Ga0500581_038250_40_501 149
1733 3300053090 Ga0500646_0096244 Ga0500646_0096244_215_673 149
1734 3300053091 Ga0500647_0045892 Ga0500647_0045892_288_740 149
1735 3300053091 Ga0500647_0062219 Ga0500647_0062219_256_705 149
1736 3300053093 Ga0500651_0055493 Ga0500651_0055493_509_958 149
1737 3300053093 Ga0500651_0091172 Ga0500651_0091172_597_1058 149
1738 3300053093 Ga0500651_0126865 Ga0500651_0126865_716_1165 149
1739 3300053093 Ga0500651_0180309 Ga0500651_0180309_756_1205 149
1740 3300053093 Ga0500651_0293463 Ga0500651_0293463_228_689 149
1741 3300053093 Ga0500651_0590600 Ga0500651_0590600_134_583 149
1742 3300053094 Ga0500566_0000066 Ga0500566_0000066_44355_44816 149
1743 3300053094 Ga0500566_0264962 Ga0500566_0264962_321_770 149
1744 3300053095 Ga0500640_063827 Ga0500640_063827_460_909 149
1745 3300053096 Ga0500641_0085253 Ga0500641_0085253_618_1067 149
1746 3300053096 Ga0500641_0097248 Ga0500641_0097248_439_900 149
1747 3300053098 Ga0500650_0000287 Ga0500650_0000287_9925_10386 149
1748 3300053098 Ga0500650_0283182 Ga0500650_0283182_44_493 149
1749 3300053103 Ga0500555_003373 Ga0500555_003373_3058_3507 149
1750 3300053103 Ga0500555_128064 Ga0500555_128064_60_521 149
1751 3300053104 Ga0500556_0000058 Ga0500556_0000058_111856_112317 149
1752 3300053105 Ga0500557_000008 Ga0500557_000008_93457_93906 149
1753 3300053108 Ga0500562_001778 Ga0500562_001778_1813_2274 149
1754 3300053108 Ga0500562_012928 Ga0500562_012928_767_1216 149
1755 3300053108 Ga0500562_016626 Ga0500562_016626_1171_1620 149
1756 3300053108 Ga0500562_072939 Ga0500562_072939_382_840 149
1757 3300053109 Ga0500569_005296 Ga0500569_005296_1529_1978 149
1758 3300053109 Ga0500569_023221 Ga0500569_023221_255_704 149
1759 3300053109 Ga0500569_181696 Ga0500569_181696_186_647 149
1760 3300053116 Ga0500592_010653 Ga0500592_010653_819_1280 149
1761 3300053116 Ga0500592_025793 Ga0500592_025793_394_843 149
1762 3300053116 Ga0500592_032094 Ga0500592_032094_370_819 149
1763 3300053118 Ga0500594_0125961 Ga0500594_0125961_208_657 149
1764 3300053119 Ga0500595_000146 Ga0500595_000146_37317_37766 149
1765 3300053119 Ga0500595_016698 Ga0500595_016698_153_602 149
1766 3300053119 Ga0500595_021184 Ga0500595_021184_1241_1690 149
1767 3300053119 Ga0500595_035545 Ga0500595_035545_481_930 149
1768 3300053119 Ga0500595_044103 Ga0500595_044103_498_947 149
1769 3300053119 Ga0500595_108409 Ga0500595_108409_206_655 149
1770 3300053120 Ga0500597_078318 Ga0500597_078318_101_550 149
1771 3300053121 Ga0500607_254200 Ga0500607_254200_209_658 149
1772 3300053122 Ga0500608_078190 Ga0500608_078190_821_1270 149
1773 3300053122 Ga0500608_147819 Ga0500608_147819_60_521 149
1774 3300053126 Ga0500621_190292 Ga0500621_190292_145_603 149
1775 3300053128 Ga0500626_113230 Ga0500626_113230_451_900 149
1776 3300053130 Ga0500642_0000025 Ga0500642_0000025_2136_2597 149
1777 3300053130 Ga0500642_0000294 Ga0500642_0000294_4143_4592 149
1778 3300053130 Ga0500642_0006956 Ga0500642_0006956_2391_2840 149
1779 3300053130 Ga0500642_0284256 Ga0500642_0284256_235_684 149
1780 3300053130 Ga0500642_0365903 Ga0500642_0365903_53_502 149
1781 3300053131 Ga0500652_010275 Ga0500652_010275_784_1245 149
1782 3300053131 Ga0500652_273446 Ga0500652_273446_13_462 149
1783 3300053133 Ga0500655_047627 Ga0500655_047627_14_463 149
1784 3300053133 Ga0500655_084418 Ga0500655_084418_26_487 149
1785 3300053134 Ga0500658_0015391 Ga0500658_0015391_592_1053 149
1786 3300053134 Ga0500658_0145854 Ga0500658_0145854_200_649 149
1787 3300053136 Ga0500559_0001270 Ga0500559_0001270_8636_9097 149
1788 3300053136 Ga0500559_0209412 Ga0500559_0209412_177_626 149
1789 3300053136 Ga0500559_0374340 Ga0500559_0374340_178_627 149
1790 3300053139 Ga0500568_0000833 Ga0500568_0000833_20944_21405 149
1791 3300053139 Ga0500568_0018742 Ga0500568_0018742_1303_1752 149
1792 3300053139 Ga0500568_0077476 Ga0500568_0077476_776_1225 149
1793 3300053139 Ga0500568_0081189 Ga0500568_0081189_127_585 149
1794 3300053142 Ga0500577_0196826 Ga0500577_0196826_57_506 149
1795 3300053142 Ga0500577_0223639 Ga0500577_0223639_70_531 149
1796 3300053142 Ga0500577_0230969 Ga0500577_0230969_52_501 149
1797 3300053145 Ga0500586_008323 Ga0500586_008323_1960_2421 149
1798 3300053148 Ga0500590_134736 Ga0500590_134736_11_460 149
1799 3300053148 Ga0500590_268625 Ga0500590_268625_108_557 149
1800 3300053148 Ga0500590_284628 Ga0500590_284628_107_556 149
1801 3300053151 Ga0500604_0001603 Ga0500604_0001603_1412_1873 149
1802 3300053151 Ga0500604_0055233 Ga0500604_0055233_126_575 149
1803 3300053151 Ga0500604_0172857 Ga0500604_0172857_256_705 149
1804 3300053151 Ga0500604_0288003 Ga0500604_0288003_55_516 149
1805 3300053153 Ga0500616_0000031 Ga0500616_0000031_414367_414828 149
1806 3300053154 Ga0500619_036636 Ga0500619_036636_933_1382 149
1807 3300053156 Ga0500622_0000783 Ga0500622_0000783_6252_6713 149
1808 3300053156 Ga0500622_0006295 Ga0500622_0006295_871_1320 149
1809 3300053158 Ga0500627_0139073 Ga0500627_0139073_147_605 149
1810 3300053158 Ga0500627_0172235 Ga0500627_0172235_332_781 149
1811 3300053158 Ga0500627_0368277 Ga0500627_0368277_28_489 149
1812 3300053158 Ga0500627_0406239 Ga0500627_0406239_117_566 149
1813 3300053160 Ga0500633_0016500 Ga0500633_0016500_1610_2059 149
1814 3300053160 Ga0500633_0173307 Ga0500633_0173307_98_547 149
1815 3300053161 Ga0500634_0040764 Ga0500634_0040764_1432_1881 149
1816 3300053161 Ga0500634_0175751 Ga0500634_0175751_167_616 149
1817 3300053162 Ga0500638_071504 Ga0500638_071504_699_1148 149
1818 3300053162 Ga0500638_146932 Ga0500638_146932_62_511 149
1819 3300053162 Ga0500638_209792 Ga0500638_209792_150_599 149
1820 3300053177 Ga0500636_0000550 Ga0500636_0000550_17855_18304 149
1821 3300053177 Ga0500636_0000803 Ga0500636_0000803_11430_11891 149
1822 3300053177 Ga0500636_0063170 Ga0500636_0063170_1284_1736 149
1823 3300053177 Ga0500636_0159098 Ga0500636_0159098_634_1083 149
1824 3300053178 Ga0500637_0254581 Ga0500637_0254581_310_783 149
1825 3300053722 Ga0500649_157189 Ga0500649_157189_226_675 149
1826 3300053727 Ga0500611_015384 Ga0500611_015384_814_1275 149
1827 3300053727 Ga0500611_034709 Ga0500611_034709_114_572 149
1828 3300053727 Ga0500611_073330 Ga0500611_073330_10_459 149
1829 3300053729 Ga0500625_011535 Ga0500625_011535_1594_2043 149
1830 3300053730 Ga0500645_018190 Ga0500645_018190_1039_1488 149
1831 3300053730 Ga0500645_019058 Ga0500645_019058_320_769 149
1832 3300053730 Ga0500645_025642 Ga0500645_025642_1079_1540 149
1833 3300053731 Ga0500609_033219 Ga0500609_033219_44_493 149
1834 3300053736 Ga0500599_008514 Ga0500599_008514_381_830 149
1835 3300053737 Ga0500601_000062 Ga0500601_000062_16470_16919 149
1836 3300053737 Ga0500601_015101 Ga0500601_015101_62_511 149
1837 3300055283 Ga0500661_010169 Ga0500661_010169_122_586 149
1838 3300060344 Ga0587071_163124 Ga0587071_163124_54_503 149
1839 3300060353 Ga0501082_0293473 Ga0501082_0293473_155_619 149
1840 3300060353 Ga0501082_0347917 Ga0501082_0347917_63_512 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02311

AraC_binding

AraC-like ligand binding domain

95

175

0.87

PF05899

Cupin_3

EutQ-like cupin domain

95

159

0.87

PF00190

Cupin_1

Cupin

92

169

0.86

PF07883

Cupin_2

Cupin domain

97

166

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zvm-assembly1.cif.gz_A-2 thermococcus barophilus phosphomannose isomerase protein structure at 1.6 a 0.8593 53 148
7zvy-assembly1.cif.gz_G thermococcus kadokarensis phosphomannose isomerase 0.859 56 148
7zvy-assembly2.cif.gz_B thermococcus kadokarensis phosphomannose isomerase 0.8583 50 148
8hfb-assembly1.cif.gz_B evolved variant of quercetin 2,4-dioxygenase from bacillus subtilis 0.8545 56 137
5wse-assembly2.cif.gz_C crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.8505 55 137
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8988 57 149 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8558 56 137 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8473 52 138 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8429 56 137 2.60.120.10
2d40B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8414 64 137 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1L7AJM5-F1-model_v4 Cupin 0.9655 33 149
AF-H1SBP4-F1-model_v4 Cupin type-2 domain-containing protein 0.9582 48 149
AF-A0A1H4H3X3-F1-model_v4 Cupin domain-containing protein 0.9519 57 149
AF-A0A536YKB3-F1-model_v4 Cupin domain-containing protein 0.945 68 149
AF-A0A536YKB3-F1-model_v4 Cupin domain-containing protein 0.9341 68 149

Feature Viewer

pLDDT pTM Quality
92.42 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map