F495636
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1766 | 408 | 3532 | 113 |
Family's Representative Sequence
| Representative Sequence | 3300041486|Ga0451807_2680370|Ga0451807_2680370_558_914 |
| Length | 118 |
| Sequence | MNVTTATLGDVVVLQVNEPRLTYPILADFASAATNLIGSGQKKIVVDLTPVGYVDSATIGCLMDLYRQATSSGSALKLAGVQKRVETMLTMTGAHNFLEVHADQASALASFGVYPWRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 7 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 121 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 216 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 217 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 218 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 226 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 227 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 228 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 229 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 230 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 238 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 241 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 253 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 254 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 255 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 256 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 260 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 261 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 262 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 263 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 264 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 265 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 266 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 267 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 268 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 269 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 270 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 271 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 272 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 273 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 274 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 275 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 276 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 277 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 278 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 279 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 280 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 281 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 282 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 283 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 331 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 332 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 333 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 334 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 335 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 336 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 339 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 340 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 341 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 342 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 343 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 344 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 345 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 346 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 370 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 371 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 372 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 373 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 374 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 375 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 376 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 381 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 385 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 387 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 388 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 389 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 390 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 402 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 404 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 405 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 406 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 407 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.94 |
| Metatranscriptomes | 0.06 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.85 |
| Nodule | 0 |
| Rhizoplane | 2.77 |
| Rhizosphere | 96.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 22.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451807_2680370 | 3300041486 | Bacteria | 957 |
| 2 | ARcpr5yngRDRAFT_c013371 | 3300000043 | Unclassified | 690 |
| 3 | JGI24739J22299_10189834 | 3300001989 | Bacteria | 604 |
| 4 | JGI24750J21931_1005644 | 3300002070 | Bacteria | 1541 |
| 5 | JGI24745J21846_1045819 | 3300002073 | Bacteria | 548 |
| 6 | JGI24748J21848_1039180 | 3300002074 | Bacteria | 600 |
| 7 | JGI24749J21850_1022447 | 3300002076 | Unclassified | 895 |
| 8 | JGI24751J29686_10036310 | 3300002459 | Bacteria | 1021 |
| 9 | Ga0058863_11932409 | 3300004799 | Unclassified | 1332 |
| 10 | Ga0065704_10123446 | 3300005289 | Bacteria | 1733 |
| 11 | Ga0065704_10181414 | 3300005289 | Bacteria | 1235 |
| 12 | Ga0065704_10705596 | 3300005289 | Bacteria | 559 |
| 13 | Ga0065712_10022428 | 3300005290 | Bacteria | 1313 |
| 14 | Ga0065712_10051606 | 3300005290 | Unclassified | 745 |
| 15 | Ga0065712_10072906 | 3300005290 | Bacteria | 4571 |
| 16 | Ga0065712_10284836 | 3300005290 | Bacteria | 888 |
| 17 | Ga0065712_10307811 | 3300005290 | Unclassified | 849 |
| 18 | Ga0065712_10312330 | 3300005290 | Bacteria | 842 |
| 19 | Ga0065712_10358855 | 3300005290 | Bacteria | 777 |
| 20 | Ga0065712_10420257 | 3300005290 | Bacteria | 712 |
| 21 | Ga0065712_10587368 | 3300005290 | Bacteria | 597 |
| 22 | Ga0065712_10725601 | 3300005290 | Bacteria | 530 |
| 23 | Ga0065715_10097777 | 3300005293 | Bacteria | 3644 |
| 24 | Ga0065715_10191708 | 3300005293 | Unclassified | 1411 |
| 25 | Ga0065715_10370516 | 3300005293 | Bacteria | 922 |
| 26 | Ga0065715_10406936 | 3300005293 | Bacteria | 874 |
| 27 | Ga0065715_10497280 | 3300005293 | Bacteria | 770 |
| 28 | Ga0065715_10868974 | 3300005293 | Unclassified | 585 |
| 29 | Ga0065715_11158852 | 3300005293 | Unclassified | 507 |
| 30 | Ga0065707_10005876 | 3300005295 | Bacteria | 5306 |
| 31 | Ga0065707_10009901 | 3300005295 | Bacteria | 3233 |
| 32 | Ga0065707_10149926 | 3300005295 | Unclassified | 1670 |
| 33 | Ga0065707_10155199 | 3300005295 | Bacteria | 1616 |
| 34 | Ga0065707_10176388 | 3300005295 | Bacteria | 1448 |
| 35 | Ga0065707_10309646 | 3300005295 | Bacteria | 955 |
| 36 | Ga0065707_10456554 | 3300005295 | Bacteria | 795 |
| 37 | Ga0065707_10490249 | 3300005295 | Unclassified | 766 |
| 38 | Ga0070676_10055794 | 3300005328 | Bacteria | 2332 |
| 39 | Ga0070676_10366078 | 3300005328 | Bacteria | 995 |
| 40 | Ga0070676_10465465 | 3300005328 | Unclassified | 892 |
| 41 | Ga0070676_10636259 | 3300005328 | Bacteria | 773 |
| 42 | Ga0070676_10886955 | 3300005328 | Bacteria | 663 |
| 43 | Ga0070683_100083153 | 3300005329 | Bacteria | 2999 |
| 44 | Ga0070683_102261996 | 3300005329 | Unclassified | 522 |
| 45 | Ga0070690_100004426 | 3300005330 | Bacteria | 7799 |
| 46 | Ga0070690_100024878 | 3300005330 | Bacteria | 3685 |
| 47 | Ga0070690_100031293 | 3300005330 | Unclassified | 3314 |
| 48 | Ga0070690_100078050 | 3300005330 | Bacteria | 2163 |
| 49 | Ga0070690_100217284 | 3300005330 | Bacteria | 1338 |
| 50 | Ga0070690_100805614 | 3300005330 | Unclassified | 729 |
| 51 | Ga0070690_100947732 | 3300005330 | Unclassified | 676 |
| 52 | Ga0070670_100010332 | 3300005331 | Bacteria | 7967 |
| 53 | Ga0070670_100021798 | 3300005331 | Bacteria | 5510 |
| 54 | Ga0070670_100067562 | 3300005331 | Bacteria | 3067 |
| 55 | Ga0070670_100138925 | 3300005331 | Bacteria | 2101 |
| 56 | Ga0070670_100145557 | 3300005331 | Bacteria | 2050 |
| 57 | Ga0070670_100206851 | 3300005331 | Unclassified | 1706 |
| 58 | Ga0070670_100215657 | 3300005331 | Bacteria | 1669 |
| 59 | Ga0070670_100257732 | 3300005331 | Bacteria | 1520 |
| 60 | Ga0070670_100561449 | 3300005331 | Unclassified | 1019 |
| 61 | Ga0070670_100908009 | 3300005331 | Bacteria | 799 |
| 62 | Ga0070670_101035724 | 3300005331 | Unclassified | 747 |
| 63 | Ga0070677_10000884 | 3300005333 | Bacteria | 9865 |
| 64 | Ga0070677_10018427 | 3300005333 | Bacteria | 2514 |
| 65 | Ga0070677_10171655 | 3300005333 | Bacteria | 1025 |
| 66 | Ga0070677_10246799 | 3300005333 | Bacteria | 884 |
| 67 | Ga0070677_10333486 | 3300005333 | Bacteria | 781 |
| 68 | Ga0070677_10767286 | 3300005333 | Bacteria | 548 |
| 69 | Ga0068869_100001834 | 3300005334 | Bacteria | 12765 |
| 70 | Ga0068869_100016747 | 3300005334 | Bacteria | 4948 |
| 71 | Ga0068869_100035043 | 3300005334 | Bacteria | 3555 |
| 72 | Ga0068869_100074252 | 3300005334 | Bacteria | 2524 |
| 73 | Ga0068869_100112130 | 3300005334 | Bacteria | 2076 |
| 74 | Ga0068869_100195197 | 3300005334 | Bacteria | 1594 |
| 75 | Ga0068869_100419506 | 3300005334 | Bacteria | 1104 |
| 76 | Ga0068869_100610616 | 3300005334 | Bacteria | 922 |
| 77 | Ga0068869_100632074 | 3300005334 | Bacteria | 907 |
| 78 | Ga0068869_101006269 | 3300005334 | Bacteria | 726 |
| 79 | Ga0070666_10007259 | 3300005335 | Bacteria | 6834 |
| 80 | Ga0070666_10055453 | 3300005335 | Bacteria | 2675 |
| 81 | Ga0070666_10122016 | 3300005335 | Bacteria | 1808 |
| 82 | Ga0070680_100038026 | 3300005336 | Bacteria | 3891 |
| 83 | Ga0070680_100262987 | 3300005336 | Bacteria | 1460 |
| 84 | Ga0070680_100316919 | 3300005336 | Unclassified | 1323 |
| 85 | Ga0070680_100613790 | 3300005336 | Bacteria | 934 |
| 86 | Ga0070682_100074373 | 3300005337 | Bacteria | 2182 |
| 87 | Ga0070682_100399590 | 3300005337 | Unclassified | 1039 |
| 88 | Ga0070682_100479706 | 3300005337 | Bacteria | 959 |
| 89 | Ga0068868_100005344 | 3300005338 | Bacteria | 9017 |
| 90 | Ga0068868_100105464 | 3300005338 | Bacteria | 2285 |
| 91 | Ga0068868_100276025 | 3300005338 | Bacteria | 1421 |
| 92 | Ga0068868_100811086 | 3300005338 | Unclassified | 845 |
| 93 | Ga0068868_101236692 | 3300005338 | Bacteria | 692 |
| 94 | Ga0070660_101053646 | 3300005339 | Bacteria | 688 |
| 95 | Ga0070689_100018035 | 3300005340 | Bacteria | 5192 |
| 96 | Ga0070689_100053398 | 3300005340 | Bacteria | 3127 |
| 97 | Ga0070689_100163068 | 3300005340 | Unclassified | 1803 |
| 98 | Ga0070689_100383040 | 3300005340 | Bacteria | 1186 |
| 99 | Ga0070689_100757329 | 3300005340 | Bacteria | 851 |
| 100 | Ga0070689_100759053 | 3300005340 | Unclassified | 851 |
| 101 | Ga0070691_10060648 | 3300005341 | Bacteria | 1819 |
| 102 | Ga0070691_10616899 | 3300005341 | Bacteria | 642 |
| 103 | Ga0070691_10783735 | 3300005341 | Bacteria | 579 |
| 104 | Ga0070687_100008085 | 3300005343 | Bacteria | 4432 |
| 105 | Ga0070687_100028758 | 3300005343 | Bacteria | 2699 |
| 106 | Ga0070687_100047930 | 3300005343 | Bacteria | 2194 |
| 107 | Ga0070687_100187908 | 3300005343 | Bacteria | 1243 |
| 108 | Ga0070687_100507436 | 3300005343 | Bacteria | 813 |
| 109 | Ga0070687_100621441 | 3300005343 | Bacteria | 745 |
| 110 | Ga0070661_100003293 | 3300005344 | Bacteria | 11147 |
| 111 | Ga0070661_100065094 | 3300005344 | Unclassified | 2678 |
| 112 | Ga0070661_100299993 | 3300005344 | Unclassified | 1250 |
| 113 | Ga0070661_100441860 | 3300005344 | Bacteria | 1034 |
| 114 | Ga0070661_101061208 | 3300005344 | Bacteria | 674 |
| 115 | Ga0070661_101556266 | 3300005344 | Bacteria | 558 |
| 116 | Ga0070692_10032075 | 3300005345 | Bacteria | 2639 |
| 117 | Ga0070692_10174014 | 3300005345 | Unclassified | 1243 |
| 118 | Ga0070692_10360788 | 3300005345 | Unclassified | 906 |
| 119 | Ga0070692_11045566 | 3300005345 | Unclassified | 574 |
| 120 | Ga0070668_100016902 | 3300005347 | Bacteria | 5457 |
| 121 | Ga0070668_100020560 | 3300005347 | Bacteria | 4983 |
| 122 | Ga0070668_100114614 | 3300005347 | Bacteria | 2148 |
| 123 | Ga0070668_100518597 | 3300005347 | Bacteria | 1034 |
| 124 | Ga0070668_100936212 | 3300005347 | Bacteria | 776 |
| 125 | Ga0070668_102128561 | 3300005347 | Unclassified | 518 |
| 126 | Ga0070669_100006473 | 3300005353 | Bacteria | 8431 |
| 127 | Ga0070669_100075588 | 3300005353 | Bacteria | 2498 |
| 128 | Ga0070669_100106995 | 3300005353 | Bacteria | 2118 |
| 129 | Ga0070669_100234238 | 3300005353 | Bacteria | 1456 |
| 130 | Ga0070669_100436878 | 3300005353 | Bacteria | 1076 |
| 131 | Ga0070669_100829868 | 3300005353 | Bacteria | 787 |
| 132 | Ga0070669_101016108 | 3300005353 | Bacteria | 712 |
| 133 | Ga0070675_100002608 | 3300005354 | Bacteria | 13528 |
| 134 | Ga0070675_100032679 | 3300005354 | Bacteria | 4212 |
| 135 | Ga0070675_100076918 | 3300005354 | Bacteria | 2777 |
| 136 | Ga0070675_100113663 | 3300005354 | Bacteria | 2293 |
| 137 | Ga0070675_100132260 | 3300005354 | Unclassified | 2127 |
| 138 | Ga0070675_100191156 | 3300005354 | Bacteria | 1774 |
| 139 | Ga0070675_100195388 | 3300005354 | Bacteria | 1755 |
| 140 | Ga0070675_100240873 | 3300005354 | Bacteria | 1580 |
| 141 | Ga0070675_100292474 | 3300005354 | Bacteria | 1434 |
| 142 | Ga0070675_100569030 | 3300005354 | Bacteria | 1026 |
| 143 | Ga0070675_100783741 | 3300005354 | Bacteria | 871 |
| 144 | Ga0070675_100816705 | 3300005354 | Bacteria | 853 |
| 145 | Ga0070675_101188934 | 3300005354 | Unclassified | 702 |
| 146 | Ga0070675_101211555 | 3300005354 | Bacteria | 695 |
| 147 | Ga0070675_101618484 | 3300005354 | Bacteria | 597 |
| 148 | Ga0070671_100040632 | 3300005355 | Bacteria | 3864 |
| 149 | Ga0070671_100136584 | 3300005355 | Bacteria | 2067 |
| 150 | Ga0070671_100184331 | 3300005355 | Unclassified | 1768 |
| 151 | Ga0070671_100265156 | 3300005355 | Bacteria | 1460 |
| 152 | Ga0070671_100775060 | 3300005355 | Archaea | 834 |
| 153 | Ga0070674_100203861 | 3300005356 | Unclassified | 1529 |
| 154 | Ga0070674_100385609 | 3300005356 | Bacteria | 1141 |
| 155 | Ga0070674_100454843 | 3300005356 | Unclassified | 1057 |
| 156 | Ga0070674_100524896 | 3300005356 | Unclassified | 990 |
| 157 | Ga0070674_100863699 | 3300005356 | Unclassified | 786 |
| 158 | Ga0070674_101237510 | 3300005356 | Bacteria | 664 |
| 159 | Ga0070674_101484658 | 3300005356 | Bacteria | 609 |
| 160 | Ga0070674_101719120 | 3300005356 | Bacteria | 568 |
| 161 | Ga0070673_100007144 | 3300005364 | Bacteria | 7334 |
| 162 | Ga0070673_100046488 | 3300005364 | Bacteria | 3372 |
| 163 | Ga0070673_100123040 | 3300005364 | Bacteria | 2167 |
| 164 | Ga0070673_100129990 | 3300005364 | Bacteria | 2111 |
| 165 | Ga0070673_100173104 | 3300005364 | Unclassified | 1844 |
| 166 | Ga0070673_100252368 | 3300005364 | Unclassified | 1538 |
| 167 | Ga0070673_100397622 | 3300005364 | Unclassified | 1231 |
| 168 | Ga0070673_100464947 | 3300005364 | Bacteria | 1140 |
| 169 | Ga0070673_100506564 | 3300005364 | Bacteria | 1092 |
| 170 | Ga0070673_100865848 | 3300005364 | Bacteria | 837 |
| 171 | Ga0070673_100875310 | 3300005364 | Bacteria | 832 |
| 172 | Ga0070673_101385688 | 3300005364 | Bacteria | 661 |
| 173 | Ga0070688_100013286 | 3300005365 | Bacteria | 4638 |
| 174 | Ga0070688_100031261 | 3300005365 | Bacteria | 3202 |
| 175 | Ga0070688_100044774 | 3300005365 | Bacteria | 2731 |
| 176 | Ga0070688_100102851 | 3300005365 | Unclassified | 1886 |
| 177 | Ga0070688_100120357 | 3300005365 | Bacteria | 1757 |
| 178 | Ga0070688_100142136 | 3300005365 | Unclassified | 1632 |
| 179 | Ga0070688_100186678 | 3300005365 | Bacteria | 1441 |
| 180 | Ga0070688_100760263 | 3300005365 | Bacteria | 755 |
| 181 | Ga0070688_101223791 | 3300005365 | Bacteria | 604 |
| 182 | Ga0070659_100114324 | 3300005366 | Unclassified | 2180 |
| 183 | Ga0070659_100135095 | 3300005366 | Bacteria | 2005 |
| 184 | Ga0070659_100357828 | 3300005366 | Bacteria | 1226 |
| 185 | Ga0070659_100470646 | 3300005366 | Bacteria | 1068 |
| 186 | Ga0070659_100997148 | 3300005366 | Bacteria | 735 |
| 187 | Ga0070659_101211509 | 3300005366 | Bacteria | 668 |
| 188 | Ga0070667_100182205 | 3300005367 | Bacteria | 1858 |
| 189 | Ga0070667_100270530 | 3300005367 | Bacteria | 1523 |
| 190 | Ga0070667_100272075 | 3300005367 | Bacteria | 1519 |
| 191 | Ga0070667_100707800 | 3300005367 | Unclassified | 932 |
| 192 | Ga0070667_101857765 | 3300005367 | Archaea | 567 |
| 193 | Ga0070703_10016665 | 3300005406 | Bacteria | 2110 |
| 194 | Ga0070703_10203076 | 3300005406 | Unclassified | 779 |
| 195 | Ga0070703_10280877 | 3300005406 | Unclassified | 687 |
| 196 | Ga0070713_100848750 | 3300005436 | Bacteria | 877 |
| 197 | Ga0070701_10009628 | 3300005438 | Bacteria | 4239 |
| 198 | Ga0070701_10045217 | 3300005438 | Bacteria | 2258 |
| 199 | Ga0070701_10082718 | 3300005438 | Bacteria | 1742 |
| 200 | Ga0070701_10083747 | 3300005438 | Unclassified | 1732 |
| 201 | Ga0070701_10186172 | 3300005438 | Bacteria | 1219 |
| 202 | Ga0070701_10521090 | 3300005438 | Unclassified | 775 |
| 203 | Ga0070701_10587751 | 3300005438 | Bacteria | 736 |
| 204 | Ga0070705_100000353 | 3300005440 | Bacteria | 27139 |
| 205 | Ga0070705_100008965 | 3300005440 | Bacteria | 4963 |
| 206 | Ga0070705_100029016 | 3300005440 | Unclassified | 3037 |
| 207 | Ga0070705_100079069 | 3300005440 | Unclassified | 2013 |
| 208 | Ga0070705_100144556 | 3300005440 | Bacteria | 1570 |
| 209 | Ga0070705_100791174 | 3300005440 | Bacteria | 754 |
| 210 | Ga0070705_100930933 | 3300005440 | Unclassified | 701 |
| 211 | Ga0070705_101050257 | 3300005440 | Bacteria | 664 |
| 212 | Ga0070700_100032037 | 3300005441 | Bacteria | 3156 |
| 213 | Ga0070700_100098789 | 3300005441 | Unclassified | 1919 |
| 214 | Ga0070700_100218161 | 3300005441 | Bacteria | 1350 |
| 215 | Ga0070700_100393770 | 3300005441 | Bacteria | 1040 |
| 216 | Ga0070700_100506595 | 3300005441 | Unclassified | 930 |
| 217 | Ga0070700_100684244 | 3300005441 | Bacteria | 813 |
| 218 | Ga0070700_100733301 | 3300005441 | Unclassified | 789 |
| 219 | Ga0070700_101044979 | 3300005441 | Bacteria | 674 |
| 220 | Ga0070700_101107382 | 3300005441 | Unclassified | 657 |
| 221 | Ga0070700_101202054 | 3300005441 | Unclassified | 633 |
| 222 | Ga0070700_101325164 | 3300005441 | Unclassified | 606 |
| 223 | Ga0070694_100001728 | 3300005444 | Bacteria | 12875 |
| 224 | Ga0070694_100008513 | 3300005444 | Bacteria | 6276 |
| 225 | Ga0070694_100010015 | 3300005444 | Bacteria | 5829 |
| 226 | Ga0070694_100082599 | 3300005444 | Bacteria | 2238 |
| 227 | Ga0070694_100375284 | 3300005444 | Unclassified | 1108 |
| 228 | Ga0070694_100820701 | 3300005444 | Unclassified | 764 |
| 229 | Ga0070708_100071937 | 3300005445 | Bacteria | 3115 |
| 230 | Ga0070708_100135240 | 3300005445 | Bacteria | 2283 |
| 231 | Ga0070708_100305645 | 3300005445 | Bacteria | 1498 |
| 232 | Ga0070708_100675580 | 3300005445 | Bacteria | 973 |
| 233 | Ga0070708_100708629 | 3300005445 | Unclassified | 947 |
| 234 | Ga0070663_100084753 | 3300005455 | Bacteria | 2337 |
| 235 | Ga0070663_100737867 | 3300005455 | Unclassified | 840 |
| 236 | Ga0070663_100855807 | 3300005455 | Unclassified | 783 |
| 237 | Ga0070663_101759492 | 3300005455 | Unclassified | 555 |
| 238 | Ga0070678_100041874 | 3300005456 | Bacteria | 3251 |
| 239 | Ga0070678_100065613 | 3300005456 | Bacteria | 2696 |
| 240 | Ga0070678_100099831 | 3300005456 | Bacteria | 2247 |
| 241 | Ga0070678_100106736 | 3300005456 | Bacteria | 2183 |
| 242 | Ga0070678_100219733 | 3300005456 | Unclassified | 1579 |
| 243 | Ga0070678_101533113 | 3300005456 | Unclassified | 624 |
| 244 | Ga0070678_101602946 | 3300005456 | Unclassified | 611 |
| 245 | Ga0070678_101644769 | 3300005456 | Unclassified | 603 |
| 246 | Ga0070678_102209454 | 3300005456 | Unclassified | 522 |
| 247 | Ga0070662_100006426 | 3300005457 | Bacteria | 7575 |
| 248 | Ga0070662_100019273 | 3300005457 | Unclassified | 4630 |
| 249 | Ga0070662_100046389 | 3300005457 | Bacteria | 3122 |
| 250 | Ga0070662_100125965 | 3300005457 | Bacteria | 1969 |
| 251 | Ga0070662_100710678 | 3300005457 | Unclassified | 851 |
| 252 | Ga0070681_10002446 | 3300005458 | Bacteria | 17007 |
| 253 | Ga0070681_10217991 | 3300005458 | Bacteria | 1824 |
| 254 | Ga0070681_10735226 | 3300005458 | Bacteria | 903 |
| 255 | Ga0068867_100019216 | 3300005459 | Unclassified | 4868 |
| 256 | Ga0068867_100063872 | 3300005459 | Bacteria | 2737 |
| 257 | Ga0068867_100129518 | 3300005459 | Bacteria | 1959 |
| 258 | Ga0068867_100435637 | 3300005459 | Bacteria | 1114 |
| 259 | Ga0068867_100759648 | 3300005459 | Unclassified | 861 |
| 260 | Ga0070685_10015733 | 3300005466 | Bacteria | 4021 |
| 261 | Ga0070685_10031142 | 3300005466 | Bacteria | 2978 |
| 262 | Ga0070685_10050188 | 3300005466 | Bacteria | 2410 |
| 263 | Ga0070685_10203579 | 3300005466 | Unclassified | 1288 |
| 264 | Ga0070685_10399757 | 3300005466 | Bacteria | 951 |
| 265 | Ga0070685_10440110 | 3300005466 | Unclassified | 911 |
| 266 | Ga0070685_10534829 | 3300005466 | Unclassified | 834 |
| 267 | Ga0070706_100169304 | 3300005467 | Bacteria | 2040 |
| 268 | Ga0070706_100555807 | 3300005467 | Bacteria | 1067 |
| 269 | Ga0070706_101801291 | 3300005467 | Bacteria | 556 |
| 270 | Ga0070707_100201317 | 3300005468 | Unclassified | 1941 |
| 271 | Ga0070707_100289816 | 3300005468 | Bacteria | 1590 |
| 272 | Ga0070707_101337589 | 3300005468 | Bacteria | 683 |
| 273 | Ga0070707_101439161 | 3300005468 | Bacteria | 656 |
| 274 | Ga0070707_101627374 | 3300005468 | Archaea | 613 |
| 275 | Ga0070698_100005270 | 3300005471 | Bacteria | 14146 |
| 276 | Ga0070698_100029738 | 3300005471 | Bacteria | 5669 |
| 277 | Ga0070698_100100980 | 3300005471 | Bacteria | 2857 |
| 278 | Ga0070698_100153539 | 3300005471 | Bacteria | 2248 |
| 279 | Ga0070698_100583610 | 3300005471 | Bacteria | 1058 |
| 280 | Ga0070698_100623961 | 3300005471 | Bacteria | 1019 |
| 281 | Ga0070698_100976120 | 3300005471 | Bacteria | 794 |
| 282 | Ga0070698_101260595 | 3300005471 | Bacteria | 689 |
| 283 | Ga0070698_101566007 | 3300005471 | Bacteria | 611 |
| 284 | Ga0070699_100003285 | 3300005518 | Bacteria | 14297 |
| 285 | Ga0070699_100007386 | 3300005518 | Bacteria | 9569 |
| 286 | Ga0070699_100022796 | 3300005518 | Bacteria | 5396 |
| 287 | Ga0070699_100525976 | 3300005518 | Bacteria | 1075 |
| 288 | Ga0070699_100629527 | 3300005518 | Unclassified | 979 |
| 289 | Ga0070679_100597545 | 3300005530 | Unclassified | 1047 |
| 290 | Ga0070679_101518941 | 3300005530 | Bacteria | 617 |
| 291 | Ga0070684_100099393 | 3300005535 | Unclassified | 2597 |
| 292 | Ga0070684_100175655 | 3300005535 | Bacteria | 1947 |
| 293 | Ga0070684_100748943 | 3300005535 | Bacteria | 912 |
| 294 | Ga0070684_101215353 | 3300005535 | Unclassified | 709 |
| 295 | Ga0070697_100084866 | 3300005536 | Bacteria | 2612 |
| 296 | Ga0070697_100313326 | 3300005536 | Bacteria | 1350 |
| 297 | Ga0070697_101935200 | 3300005536 | Bacteria | 528 |
| 298 | Ga0068853_101085069 | 3300005539 | Bacteria | 772 |
| 299 | Ga0070672_100006955 | 3300005543 | Bacteria | 7650 |
| 300 | Ga0070672_100009505 | 3300005543 | Bacteria | 6707 |
| 301 | Ga0070672_100043637 | 3300005543 | Bacteria | 3459 |
| 302 | Ga0070672_100043840 | 3300005543 | Bacteria | 3452 |
| 303 | Ga0070672_100061587 | 3300005543 | Unclassified | 2959 |
| 304 | Ga0070672_100621509 | 3300005543 | Archaea | 942 |
| 305 | Ga0070672_100977589 | 3300005543 | Unclassified | 749 |
| 306 | Ga0070672_101023322 | 3300005543 | Bacteria | 732 |
| 307 | Ga0070672_101504782 | 3300005543 | Bacteria | 603 |
| 308 | Ga0070686_100006474 | 3300005544 | Bacteria | 6512 |
| 309 | Ga0070686_100045869 | 3300005544 | Bacteria | 2754 |
| 310 | Ga0070686_100345857 | 3300005544 | Unclassified | 1116 |
| 311 | Ga0070686_100375750 | 3300005544 | Unclassified | 1074 |
| 312 | Ga0070686_100627161 | 3300005544 | Unclassified | 850 |
| 313 | Ga0070686_101071031 | 3300005544 | Bacteria | 664 |
| 314 | Ga0070686_101165057 | 3300005544 | Bacteria | 639 |
| 315 | Ga0070695_100003268 | 3300005545 | Bacteria | 9468 |
| 316 | Ga0070695_100020676 | 3300005545 | Bacteria | 4020 |
| 317 | Ga0070695_100060865 | 3300005545 | Bacteria | 2447 |
| 318 | Ga0070695_100306956 | 3300005545 | Unclassified | 1175 |
| 319 | Ga0070696_100000751 | 3300005546 | Bacteria | 20742 |
| 320 | Ga0070696_100013141 | 3300005546 | Bacteria | 5554 |
| 321 | Ga0070696_100039033 | 3300005546 | Bacteria | 3279 |
| 322 | Ga0070696_100120202 | 3300005546 | Unclassified | 1901 |
| 323 | Ga0070696_100172919 | 3300005546 | Bacteria | 1598 |
| 324 | Ga0070696_100406628 | 3300005546 | Bacteria | 1066 |
| 325 | Ga0070696_100673499 | 3300005546 | Bacteria | 841 |
| 326 | Ga0070696_101002298 | 3300005546 | Bacteria | 698 |
| 327 | Ga0070696_101005789 | 3300005546 | Bacteria | 697 |
| 328 | Ga0070693_100032579 | 3300005547 | Bacteria | 2867 |
| 329 | Ga0070665_100090893 | 3300005548 | Bacteria | 3059 |
| 330 | Ga0070665_100252021 | 3300005548 | Bacteria | 1766 |
| 331 | Ga0070665_101023731 | 3300005548 | Bacteria | 838 |
| 332 | Ga0070665_101691191 | 3300005548 | Bacteria | 640 |
| 333 | Ga0070704_100002185 | 3300005549 | Bacteria | 10894 |
| 334 | Ga0070704_100014281 | 3300005549 | Bacteria | 4957 |
| 335 | Ga0070704_100047016 | 3300005549 | Bacteria | 3014 |
| 336 | Ga0070704_100073926 | 3300005549 | Bacteria | 2484 |
| 337 | Ga0070704_100075821 | 3300005549 | Bacteria | 2458 |
| 338 | Ga0070704_100115315 | 3300005549 | Bacteria | 2052 |
| 339 | Ga0070704_100175061 | 3300005549 | Bacteria | 1711 |
| 340 | Ga0070704_100223686 | 3300005549 | Unclassified | 1531 |
| 341 | Ga0070704_100354916 | 3300005549 | Unclassified | 1239 |
| 342 | Ga0070704_100717534 | 3300005549 | Unclassified | 888 |
| 343 | Ga0070704_101547348 | 3300005549 | Bacteria | 611 |
| 344 | Ga0068855_100621950 | 3300005563 | Bacteria | 1163 |
| 345 | Ga0070664_100018194 | 3300005564 | Bacteria | 5767 |
| 346 | Ga0070664_100039531 | 3300005564 | Bacteria | 3975 |
| 347 | Ga0070664_100053084 | 3300005564 | Bacteria | 3434 |
| 348 | Ga0070664_100175999 | 3300005564 | Bacteria | 1900 |
| 349 | Ga0070664_100272927 | 3300005564 | Bacteria | 1524 |
| 350 | Ga0070664_100363263 | 3300005564 | Bacteria | 1319 |
| 351 | Ga0070664_100476796 | 3300005564 | Bacteria | 1148 |
| 352 | Ga0070664_100591079 | 3300005564 | Bacteria | 1029 |
| 353 | Ga0070664_100722184 | 3300005564 | Bacteria | 929 |
| 354 | Ga0070664_101082640 | 3300005564 | Bacteria | 755 |
| 355 | Ga0070664_101381278 | 3300005564 | Unclassified | 666 |
| 356 | Ga0068857_100202629 | 3300005577 | Bacteria | 1809 |
| 357 | Ga0068857_100326042 | 3300005577 | Bacteria | 1419 |
| 358 | Ga0068857_100544462 | 3300005577 | Bacteria | 1093 |
| 359 | Ga0068857_101196268 | 3300005577 | Bacteria | 736 |
| 360 | Ga0068854_100058261 | 3300005578 | Bacteria | 2787 |
| 361 | Ga0068856_100182009 | 3300005614 | Unclassified | 2115 |
| 362 | Ga0070702_100057017 | 3300005615 | Bacteria | 2258 |
| 363 | Ga0070702_100696521 | 3300005615 | Bacteria | 774 |
| 364 | Ga0070702_101201197 | 3300005615 | Bacteria | 611 |
| 365 | Ga0068852_100025184 | 3300005616 | Bacteria | 4817 |
| 366 | Ga0068852_100051784 | 3300005616 | Bacteria | 3526 |
| 367 | Ga0068852_100582464 | 3300005616 | Unclassified | 1122 |
| 368 | Ga0068852_100761046 | 3300005616 | Unclassified | 981 |
| 369 | Ga0068859_100006095 | 3300005617 | Bacteria | 12245 |
| 370 | Ga0068859_100039000 | 3300005617 | Bacteria | 4764 |
| 371 | Ga0068859_100045758 | 3300005617 | Bacteria | 4396 |
| 372 | Ga0068859_100089189 | 3300005617 | Bacteria | 3134 |
| 373 | Ga0068859_100117279 | 3300005617 | Unclassified | 2727 |
| 374 | Ga0068859_100186560 | 3300005617 | Bacteria | 2157 |
| 375 | Ga0068859_100549484 | 3300005617 | Bacteria | 1249 |
| 376 | Ga0068859_100813849 | 3300005617 | Unclassified | 1021 |
| 377 | Ga0068859_100816269 | 3300005617 | Bacteria | 1020 |
| 378 | Ga0068859_101009129 | 3300005617 | Bacteria | 914 |
| 379 | Ga0068859_101535945 | 3300005617 | Unclassified | 735 |
| 380 | Ga0068859_101572149 | 3300005617 | Bacteria | 726 |
| 381 | Ga0068859_101673644 | 3300005617 | Unclassified | 703 |
| 382 | Ga0068864_100047439 | 3300005618 | Bacteria | 3689 |
| 383 | Ga0068864_100102782 | 3300005618 | Bacteria | 2536 |
| 384 | Ga0068864_100197663 | 3300005618 | Bacteria | 1846 |
| 385 | Ga0068864_100305474 | 3300005618 | Bacteria | 1490 |
| 386 | Ga0068864_100356891 | 3300005618 | Bacteria | 1381 |
| 387 | Ga0068864_100618902 | 3300005618 | Unclassified | 1052 |
| 388 | Ga0068864_100765314 | 3300005618 | Bacteria | 947 |
| 389 | Ga0068864_100930031 | 3300005618 | Bacteria | 860 |
| 390 | Ga0068864_102178903 | 3300005618 | Bacteria | 561 |
| 391 | Ga0068864_102451046 | 3300005618 | Bacteria | 528 |
| 392 | Ga0068866_10011566 | 3300005718 | Bacteria | 3823 |
| 393 | Ga0068866_10559458 | 3300005718 | Bacteria | 766 |
| 394 | Ga0068866_11035447 | 3300005718 | Bacteria | 585 |
| 395 | Ga0068861_100012791 | 3300005719 | Bacteria | 5860 |
| 396 | Ga0068861_100032640 | 3300005719 | Bacteria | 3834 |
| 397 | Ga0068861_100359379 | 3300005719 | Bacteria | 1280 |
| 398 | Ga0068861_100487645 | 3300005719 | Bacteria | 1112 |
| 399 | Ga0068861_100646235 | 3300005719 | Unclassified | 977 |
| 400 | Ga0068861_100946562 | 3300005719 | Unclassified | 819 |
| 401 | Ga0068861_102032757 | 3300005719 | Unclassified | 574 |
| 402 | Ga0068851_10130199 | 3300005834 | Unclassified | 1360 |
| 403 | Ga0068870_10013998 | 3300005840 | Bacteria | 3780 |
| 404 | Ga0068870_10018525 | 3300005840 | Bacteria | 3364 |
| 405 | Ga0068870_10080772 | 3300005840 | Bacteria | 1797 |
| 406 | Ga0068870_10396623 | 3300005840 | Unclassified | 897 |
| 407 | Ga0068870_10477245 | 3300005840 | Unclassified | 827 |
| 408 | Ga0068870_10544109 | 3300005840 | Unclassified | 781 |
| 409 | Ga0068870_10590487 | 3300005840 | Bacteria | 753 |
| 410 | Ga0068870_10955347 | 3300005840 | Bacteria | 609 |
| 411 | Ga0068870_11361482 | 3300005840 | Bacteria | 519 |
| 412 | Ga0068863_100002899 | 3300005841 | Bacteria | 16989 |
| 413 | Ga0068863_100025702 | 3300005841 | Bacteria | 5615 |
| 414 | Ga0068863_100046141 | 3300005841 | Bacteria | 4136 |
| 415 | Ga0068863_100124010 | 3300005841 | Unclassified | 2465 |
| 416 | Ga0068863_101007924 | 3300005841 | Bacteria | 836 |
| 417 | Ga0068858_100007484 | 3300005842 | Bacteria | 10556 |
| 418 | Ga0068858_100018524 | 3300005842 | Bacteria | 6518 |
| 419 | Ga0068858_100052461 | 3300005842 | Bacteria | 3773 |
| 420 | Ga0068858_100192947 | 3300005842 | Bacteria | 1925 |
| 421 | Ga0068858_100641104 | 3300005842 | Bacteria | 1032 |
| 422 | Ga0068858_101377077 | 3300005842 | Unclassified | 695 |
| 423 | Ga0068860_100014383 | 3300005843 | Bacteria | 7755 |
| 424 | Ga0068860_100038249 | 3300005843 | Bacteria | 4590 |
| 425 | Ga0068860_100059770 | 3300005843 | Bacteria | 3623 |
| 426 | Ga0068860_100185323 | 3300005843 | Bacteria | 2012 |
| 427 | Ga0068860_100623832 | 3300005843 | Unclassified | 1085 |
| 428 | Ga0068860_101003170 | 3300005843 | Bacteria | 853 |
| 429 | Ga0068860_101200032 | 3300005843 | Unclassified | 779 |
| 430 | Ga0068862_100002073 | 3300005844 | Bacteria | 18094 |
| 431 | Ga0068862_100008919 | 3300005844 | Bacteria | 8304 |
| 432 | Ga0068862_100025434 | 3300005844 | Bacteria | 4971 |
| 433 | Ga0068862_100111241 | 3300005844 | Bacteria | 2404 |
| 434 | Ga0068862_100186842 | 3300005844 | Unclassified | 1862 |
| 435 | Ga0068862_100704301 | 3300005844 | Unclassified | 979 |
| 436 | Ga0068862_100705369 | 3300005844 | Bacteria | 978 |
| 437 | Ga0068862_100922615 | 3300005844 | Unclassified | 860 |
| 438 | Ga0068862_101052701 | 3300005844 | Bacteria | 807 |
| 439 | Ga0068862_101221321 | 3300005844 | Bacteria | 751 |
| 440 | Ga0081538_10151793 | 3300005981 | Unclassified | 1047 |
| 441 | Ga0081539_10000291 | 3300005985 | Bacteria | 113769 |
| 442 | Ga0081539_10000295 | 3300005985 | Bacteria | 112740 |
| 443 | Ga0081539_10006823 | 3300005985 | Bacteria | 10691 |
| 444 | Ga0081539_10079711 | 3300005985 | Unclassified | 1724 |
| 445 | Ga0070717_10631548 | 3300006028 | Bacteria | 972 |
| 446 | Ga0075368_10016927 | 3300006042 | Bacteria | 2722 |
| 447 | Ga0075363_100212204 | 3300006048 | Bacteria | 1108 |
| 448 | Ga0075364_11206725 | 3300006051 | Unclassified | 513 |
| 449 | Ga0070716_100271392 | 3300006173 | Bacteria | 1166 |
| 450 | Ga0070712_100606567 | 3300006175 | Bacteria | 927 |
| 451 | Ga0075367_10008193 | 3300006178 | Bacteria | 5401 |
| 452 | Ga0075367_10703668 | 3300006178 | Bacteria | 643 |
| 453 | Ga0075427_10026819 | 3300006194 | Unclassified | 934 |
| 454 | Ga0075366_10018803 | 3300006195 | Bacteria | 3993 |
| 455 | Ga0075366_10590950 | 3300006195 | Bacteria | 688 |
| 456 | Ga0097621_100439385 | 3300006237 | Unclassified | 1174 |
| 457 | Ga0097621_100800049 | 3300006237 | Bacteria | 873 |
| 458 | Ga0097621_100910532 | 3300006237 | Bacteria | 819 |
| 459 | Ga0068871_100159793 | 3300006358 | Bacteria | 1927 |
| 460 | Ga0068871_100233077 | 3300006358 | Bacteria | 1598 |
| 461 | Ga0068871_100310837 | 3300006358 | Bacteria | 1385 |
| 462 | Ga0068871_101051709 | 3300006358 | Bacteria | 760 |
| 463 | Ga0068871_101120908 | 3300006358 | Bacteria | 736 |
| 464 | Ga0068871_101368067 | 3300006358 | Unclassified | 667 |
| 465 | Ga0068871_101643937 | 3300006358 | Unclassified | 608 |
| 466 | Ga0075428_100001205 | 3300006844 | Bacteria | 27639 |
| 467 | Ga0075428_100011446 | 3300006844 | Bacteria | 9867 |
| 468 | Ga0075428_100012226 | 3300006844 | Bacteria | 9545 |
| 469 | Ga0075428_100021842 | 3300006844 | Bacteria | 7087 |
| 470 | Ga0075428_100030863 | 3300006844 | Bacteria | 5926 |
| 471 | Ga0075428_100042724 | 3300006844 | Bacteria | 4984 |
| 472 | Ga0075428_100113028 | 3300006844 | Bacteria | 2958 |
| 473 | Ga0075428_100315122 | 3300006844 | Unclassified | 1681 |
| 474 | Ga0075428_100523099 | 3300006844 | Bacteria | 1269 |
| 475 | Ga0075428_101279983 | 3300006844 | Unclassified | 772 |
| 476 | Ga0075428_102510936 | 3300006844 | Unclassified | 528 |
| 477 | Ga0075430_100063682 | 3300006846 | Bacteria | 3097 |
| 478 | Ga0075430_100089047 | 3300006846 | Bacteria | 2582 |
| 479 | Ga0075430_100127878 | 3300006846 | Bacteria | 2118 |
| 480 | Ga0075430_100188316 | 3300006846 | Bacteria | 1715 |
| 481 | Ga0075430_100193055 | 3300006846 | Bacteria | 1692 |
| 482 | Ga0075430_100206542 | 3300006846 | Bacteria | 1630 |
| 483 | Ga0075430_100212369 | 3300006846 | Unclassified | 1605 |
| 484 | Ga0075430_100251135 | 3300006846 | Unclassified | 1465 |
| 485 | Ga0075430_100290736 | 3300006846 | Bacteria | 1352 |
| 486 | Ga0075430_100327315 | 3300006846 | Unclassified | 1267 |
| 487 | Ga0075430_100441278 | 3300006846 | Bacteria | 1074 |
| 488 | Ga0075430_100460028 | 3300006846 | Bacteria | 1050 |
| 489 | Ga0075430_100688712 | 3300006846 | Unclassified | 842 |
| 490 | Ga0075431_100005109 | 3300006847 | Bacteria | 12909 |
| 491 | Ga0075431_100010681 | 3300006847 | Bacteria | 9226 |
| 492 | Ga0075431_100018733 | 3300006847 | Bacteria | 7053 |
| 493 | Ga0075431_100053307 | 3300006847 | Bacteria | 4170 |
| 494 | Ga0075431_100068317 | 3300006847 | Bacteria | 3667 |
| 495 | Ga0075431_100102439 | 3300006847 | Bacteria | 2954 |
| 496 | Ga0075431_100183629 | 3300006847 | Bacteria | 2146 |
| 497 | Ga0075431_100428397 | 3300006847 | Unclassified | 1321 |
| 498 | Ga0075431_100484231 | 3300006847 | Bacteria | 1230 |
| 499 | Ga0075431_100579921 | 3300006847 | Bacteria | 1107 |
| 500 | Ga0075431_100661215 | 3300006847 | Bacteria | 1025 |
| 501 | Ga0075431_100671892 | 3300006847 | Unclassified | 1015 |
| 502 | Ga0075431_100747466 | 3300006847 | Unclassified | 953 |
| 503 | Ga0075431_100850090 | 3300006847 | Bacteria | 884 |
| 504 | Ga0075431_101075246 | 3300006847 | Bacteria | 770 |
| 505 | Ga0075433_10001675 | 3300006852 | Bacteria | 16487 |
| 506 | Ga0075433_10001688 | 3300006852 | Bacteria | 16445 |
| 507 | Ga0075433_10018246 | 3300006852 | Bacteria | 5828 |
| 508 | Ga0075433_10042019 | 3300006852 | Bacteria | 3965 |
| 509 | Ga0075433_10050964 | 3300006852 | Unclassified | 3604 |
| 510 | Ga0075433_10055219 | 3300006852 | Bacteria | 3467 |
| 511 | Ga0075433_10069629 | 3300006852 | Bacteria | 3090 |
| 512 | Ga0075433_10129709 | 3300006852 | Bacteria | 2240 |
| 513 | Ga0075433_10243939 | 3300006852 | Bacteria | 1595 |
| 514 | Ga0075433_10348333 | 3300006852 | Unclassified | 1309 |
| 515 | Ga0075433_10526575 | 3300006852 | Unclassified | 1040 |
| 516 | Ga0075433_10605558 | 3300006852 | Bacteria | 962 |
| 517 | Ga0075433_11064861 | 3300006852 | Unclassified | 704 |
| 518 | Ga0075434_100002545 | 3300006871 | Bacteria | 16085 |
| 519 | Ga0075434_100005218 | 3300006871 | Bacteria | 11802 |
| 520 | Ga0075434_100028400 | 3300006871 | Bacteria | 5496 |
| 521 | Ga0075434_100033741 | 3300006871 | Bacteria | 5052 |
| 522 | Ga0075434_100035306 | 3300006871 | Bacteria | 4942 |
| 523 | Ga0075434_100064826 | 3300006871 | Unclassified | 3638 |
| 524 | Ga0075434_100158188 | 3300006871 | Bacteria | 2285 |
| 525 | Ga0075434_100228243 | 3300006871 | Unclassified | 1881 |
| 526 | Ga0075434_100474284 | 3300006871 | Unclassified | 1272 |
| 527 | Ga0075434_100718790 | 3300006871 | Unclassified | 1016 |
| 528 | Ga0075434_101250246 | 3300006871 | Unclassified | 754 |
| 529 | Ga0075434_101515317 | 3300006871 | Bacteria | 680 |
| 530 | Ga0075434_101584952 | 3300006871 | Bacteria | 663 |
| 531 | Ga0075429_100005715 | 3300006880 | Bacteria | 10730 |
| 532 | Ga0075429_100023129 | 3300006880 | Bacteria | 5389 |
| 533 | Ga0075429_100025834 | 3300006880 | Bacteria | 5099 |
| 534 | Ga0075429_100051940 | 3300006880 | Bacteria | 3566 |
| 535 | Ga0075429_100073043 | 3300006880 | Bacteria | 2987 |
| 536 | Ga0075429_100117682 | 3300006880 | Bacteria | 2322 |
| 537 | Ga0075429_100205088 | 3300006880 | Unclassified | 1727 |
| 538 | Ga0075429_100422501 | 3300006880 | Unclassified | 1167 |
| 539 | Ga0075429_100629963 | 3300006880 | Unclassified | 939 |
| 540 | Ga0075429_101239515 | 3300006880 | Bacteria | 651 |
| 541 | Ga0068865_100053704 | 3300006881 | Unclassified | 2796 |
| 542 | Ga0068865_100202386 | 3300006881 | Bacteria | 1542 |
| 543 | Ga0068865_100295905 | 3300006881 | Bacteria | 1294 |
| 544 | Ga0068865_100377330 | 3300006881 | Bacteria | 1155 |
| 545 | Ga0068865_100442578 | 3300006881 | Bacteria | 1073 |
| 546 | Ga0068865_100561968 | 3300006881 | Bacteria | 959 |
| 547 | Ga0068865_100576935 | 3300006881 | Bacteria | 948 |
| 548 | Ga0068865_100718063 | 3300006881 | Unclassified | 855 |
| 549 | Ga0068865_100976064 | 3300006881 | Bacteria | 741 |
| 550 | Ga0068865_101741953 | 3300006881 | Unclassified | 562 |
| 551 | Ga0075436_100733731 | 3300006914 | Unclassified | 733 |
| 552 | Ga0097620_100006095 | 3300006931 | Bacteria | 12245 |
| 553 | Ga0097620_100039000 | 3300006931 | Bacteria | 4764 |
| 554 | Ga0097620_100045760 | 3300006931 | Bacteria | 4396 |
| 555 | Ga0097620_100089193 | 3300006931 | Bacteria | 3134 |
| 556 | Ga0097620_100117285 | 3300006931 | Unclassified | 2727 |
| 557 | Ga0097620_100186561 | 3300006931 | Bacteria | 2157 |
| 558 | Ga0097620_100549460 | 3300006931 | Bacteria | 1249 |
| 559 | Ga0097620_100813782 | 3300006931 | Unclassified | 1021 |
| 560 | Ga0097620_100816270 | 3300006931 | Bacteria | 1020 |
| 561 | Ga0097620_101009298 | 3300006931 | Bacteria | 914 |
| 562 | Ga0097620_101536739 | 3300006931 | Unclassified | 735 |
| 563 | Ga0097620_101572300 | 3300006931 | Bacteria | 726 |
| 564 | Ga0097620_101673356 | 3300006931 | Unclassified | 703 |
| 565 | Ga0075435_100002880 | 3300007076 | Bacteria | 11534 |
| 566 | Ga0075435_100010137 | 3300007076 | Bacteria | 6882 |
| 567 | Ga0075435_100058881 | 3300007076 | Bacteria | 3112 |
| 568 | Ga0075435_100065154 | 3300007076 | Bacteria | 2961 |
| 569 | Ga0075435_100178693 | 3300007076 | Bacteria | 1793 |
| 570 | Ga0075435_100371504 | 3300007076 | Unclassified | 1228 |
| 571 | Ga0075435_100479813 | 3300007076 | Bacteria | 1074 |
| 572 | Ga0075435_100917712 | 3300007076 | Bacteria | 764 |
| 573 | Ga0105244_10271737 | 3300009036 | Bacteria | 787 |
| 574 | Ga0111539_10000542 | 3300009094 | Bacteria | 48084 |
| 575 | Ga0111539_10018201 | 3300009094 | Bacteria | 8703 |
| 576 | Ga0111539_10022938 | 3300009094 | Bacteria | 7663 |
| 577 | Ga0111539_10029838 | 3300009094 | Bacteria | 6635 |
| 578 | Ga0111539_10055826 | 3300009094 | Bacteria | 4695 |
| 579 | Ga0111539_10103964 | 3300009094 | Bacteria | 3333 |
| 580 | Ga0111539_10197442 | 3300009094 | Bacteria | 2347 |
| 581 | Ga0111539_10197900 | 3300009094 | Bacteria | 2344 |
| 582 | Ga0111539_10216760 | 3300009094 | Bacteria | 2229 |
| 583 | Ga0111539_10229720 | 3300009094 | Bacteria | 2160 |
| 584 | Ga0111539_10255737 | 3300009094 | Bacteria | 2039 |
| 585 | Ga0111539_10619556 | 3300009094 | Bacteria | 1260 |
| 586 | Ga0111539_10739421 | 3300009094 | Bacteria | 1145 |
| 587 | Ga0111539_11007936 | 3300009094 | Bacteria | 968 |
| 588 | Ga0111539_12361096 | 3300009094 | Bacteria | 617 |
| 589 | Ga0111539_12542578 | 3300009094 | Unclassified | 594 |
| 590 | Ga0105245_10116409 | 3300009098 | Bacteria | 2492 |
| 591 | Ga0105247_11742608 | 3300009101 | Unclassified | 516 |
| 592 | Ga0114129_10001659 | 3300009147 | Bacteria | 30298 |
| 593 | Ga0114129_10002530 | 3300009147 | Bacteria | 25397 |
| 594 | Ga0114129_10003888 | 3300009147 | Bacteria | 21072 |
| 595 | Ga0114129_10007226 | 3300009147 | Bacteria | 15811 |
| 596 | Ga0114129_10016436 | 3300009147 | Bacteria | 10531 |
| 597 | Ga0114129_10033249 | 3300009147 | Bacteria | 7288 |
| 598 | Ga0114129_10086038 | 3300009147 | Bacteria | 4360 |
| 599 | Ga0114129_10116266 | 3300009147 | Bacteria | 3686 |
| 600 | Ga0114129_10223067 | 3300009147 | Bacteria | 2542 |
| 601 | Ga0114129_10296290 | 3300009147 | Unclassified | 2157 |
| 602 | Ga0114129_10305021 | 3300009147 | Bacteria | 2121 |
| 603 | Ga0114129_10394086 | 3300009147 | Bacteria | 1826 |
| 604 | Ga0114129_10484547 | 3300009147 | Bacteria | 1618 |
| 605 | Ga0114129_10540513 | 3300009147 | Bacteria | 1517 |
| 606 | Ga0114129_10800058 | 3300009147 | Unclassified | 1203 |
| 607 | Ga0114129_11401400 | 3300009147 | Bacteria | 862 |
| 608 | Ga0114129_11829108 | 3300009147 | Unclassified | 738 |
| 609 | Ga0114129_12217607 | 3300009147 | Unclassified | 661 |
| 610 | Ga0114129_12794571 | 3300009147 | Unclassified | 580 |
| 611 | Ga0105243_10050813 | 3300009148 | Bacteria | 3277 |
| 612 | Ga0105243_10093757 | 3300009148 | Bacteria | 2478 |
| 613 | Ga0105243_10158402 | 3300009148 | Bacteria | 1950 |
| 614 | Ga0105243_10740098 | 3300009148 | Bacteria | 963 |
| 615 | Ga0105243_11607989 | 3300009148 | Bacteria | 676 |
| 616 | Ga0105243_11969344 | 3300009148 | Unclassified | 618 |
| 617 | Ga0105243_12028349 | 3300009148 | Bacteria | 610 |
| 618 | Ga0105241_10327782 | 3300009174 | Unclassified | 1322 |
| 619 | Ga0105242_10065331 | 3300009176 | Bacteria | 3001 |
| 620 | Ga0105242_10244483 | 3300009176 | Bacteria | 1615 |
| 621 | Ga0105242_11084179 | 3300009176 | Bacteria | 814 |
| 622 | Ga0105242_12831945 | 3300009176 | Bacteria | 535 |
| 623 | Ga0105242_12833620 | 3300009176 | Unclassified | 535 |
| 624 | Ga0105248_10016814 | 3300009177 | Bacteria | 8052 |
| 625 | Ga0105248_10051872 | 3300009177 | Bacteria | 4603 |
| 626 | Ga0105248_10199006 | 3300009177 | Bacteria | 2257 |
| 627 | Ga0105248_10346905 | 3300009177 | Bacteria | 1671 |
| 628 | Ga0105248_10350036 | 3300009177 | Bacteria | 1663 |
| 629 | Ga0105248_10396219 | 3300009177 | Bacteria | 1555 |
| 630 | Ga0105248_10499315 | 3300009177 | Bacteria | 1372 |
| 631 | Ga0105248_10977960 | 3300009177 | Bacteria | 956 |
| 632 | Ga0105248_12605035 | 3300009177 | Unclassified | 576 |
| 633 | Ga0105238_10700108 | 3300009551 | Bacteria | 1025 |
| 634 | Ga0105249_10000672 | 3300009553 | Bacteria | 31059 |
| 635 | Ga0105249_10001821 | 3300009553 | Bacteria | 18542 |
| 636 | Ga0105249_10018156 | 3300009553 | Bacteria | 6253 |
| 637 | Ga0105249_10118253 | 3300009553 | Bacteria | 2515 |
| 638 | Ga0105249_10157278 | 3300009553 | Bacteria | 2193 |
| 639 | Ga0105249_10252825 | 3300009553 | Bacteria | 1748 |
| 640 | Ga0105249_10946030 | 3300009553 | Unclassified | 929 |
| 641 | Ga0105249_11171369 | 3300009553 | Unclassified | 839 |
| 642 | Ga0105249_11230770 | 3300009553 | Unclassified | 820 |
| 643 | Ga0105249_11285126 | 3300009553 | Unclassified | 803 |
| 644 | Ga0105249_12553917 | 3300009553 | Bacteria | 583 |
| 645 | Ga0105239_10799423 | 3300010375 | Unclassified | 1081 |
| 646 | Ga0105246_10364554 | 3300011119 | Bacteria | 1188 |
| 647 | Ga0105246_10681296 | 3300011119 | Bacteria | 899 |
| 648 | Ga0157321_1003202 | 3300012487 | Bacteria | 962 |
| 649 | Ga0157313_1032810 | 3300012503 | Bacteria | 599 |
| 650 | Ga0157373_10850033 | 3300013100 | Unclassified | 675 |
| 651 | Ga0157374_10185254 | 3300013296 | Unclassified | 2035 |
| 652 | Ga0157374_11254284 | 3300013296 | Bacteria | 763 |
| 653 | Ga0157378_10137274 | 3300013297 | Bacteria | 2268 |
| 654 | Ga0157378_10158732 | 3300013297 | Bacteria | 2113 |
| 655 | Ga0157378_10513867 | 3300013297 | Bacteria | 1198 |
| 656 | Ga0163162_10007803 | 3300013306 | Bacteria | 10433 |
| 657 | Ga0163162_10033381 | 3300013306 | Bacteria | 5114 |
| 658 | Ga0163162_10087199 | 3300013306 | Unclassified | 3199 |
| 659 | Ga0163162_12395422 | 3300013306 | Unclassified | 607 |
| 660 | Ga0157372_10077056 | 3300013307 | Bacteria | 3765 |
| 661 | Ga0157375_10011615 | 3300013308 | Bacteria | 7781 |
| 662 | Ga0157375_10015562 | 3300013308 | Bacteria | 6813 |
| 663 | Ga0157375_10166603 | 3300013308 | Bacteria | 2348 |
| 664 | Ga0157375_10320781 | 3300013308 | Bacteria | 1714 |
| 665 | Ga0157375_10397378 | 3300013308 | Unclassified | 1545 |
| 666 | Ga0157375_10422420 | 3300013308 | Bacteria | 1499 |
| 667 | Ga0157375_11005624 | 3300013308 | Unclassified | 973 |
| 668 | Ga0163163_10000005 | 3300014325 | Bacteria | 369548 |
| 669 | Ga0163163_10098812 | 3300014325 | Bacteria | 2940 |
| 670 | Ga0163163_10247540 | 3300014325 | Bacteria | 1833 |
| 671 | Ga0163163_10569774 | 3300014325 | Bacteria | 1195 |
| 672 | Ga0163163_11206194 | 3300014325 | Unclassified | 819 |
| 673 | Ga0163163_11691809 | 3300014325 | Unclassified | 693 |
| 674 | Ga0163163_12133385 | 3300014325 | Bacteria | 620 |
| 675 | Ga0157380_10067669 | 3300014326 | Bacteria | 2877 |
| 676 | Ga0157380_10166625 | 3300014326 | Bacteria | 1921 |
| 677 | Ga0157380_10196563 | 3300014326 | Bacteria | 1785 |
| 678 | Ga0157380_10236903 | 3300014326 | Bacteria | 1643 |
| 679 | Ga0157380_10252800 | 3300014326 | Bacteria | 1596 |
| 680 | Ga0157380_10311064 | 3300014326 | Unclassified | 1456 |
| 681 | Ga0157380_10412115 | 3300014326 | Bacteria | 1286 |
| 682 | Ga0157380_10437948 | 3300014326 | Unclassified | 1252 |
| 683 | Ga0157380_10458235 | 3300014326 | Bacteria | 1227 |
| 684 | Ga0157380_10539319 | 3300014326 | Bacteria | 1142 |
| 685 | Ga0157380_10631087 | 3300014326 | Bacteria | 1065 |
| 686 | Ga0157380_10663926 | 3300014326 | Bacteria | 1042 |
| 687 | Ga0157380_10843307 | 3300014326 | Unclassified | 937 |
| 688 | Ga0157377_10042179 | 3300014745 | Bacteria | 2534 |
| 689 | Ga0157377_10044023 | 3300014745 | Bacteria | 2487 |
| 690 | Ga0157377_10096840 | 3300014745 | Bacteria | 1751 |
| 691 | Ga0157377_10117014 | 3300014745 | Bacteria | 1610 |
| 692 | Ga0157377_10171699 | 3300014745 | Bacteria | 1357 |
| 693 | Ga0157377_10449125 | 3300014745 | Bacteria | 889 |
| 694 | Ga0157379_10013361 | 3300014968 | Bacteria | 7190 |
| 695 | Ga0157379_10392981 | 3300014968 | Bacteria | 1274 |
| 696 | Ga0157379_11528393 | 3300014968 | Bacteria | 650 |
| 697 | Ga0157376_10051020 | 3300014969 | Bacteria | 3435 |
| 698 | Ga0157376_10083020 | 3300014969 | Bacteria | 2755 |
| 699 | Ga0157376_10362594 | 3300014969 | Bacteria | 1390 |
| 700 | Ga0157376_10415068 | 3300014969 | Bacteria | 1305 |
| 701 | Ga0157376_10475218 | 3300014969 | Bacteria | 1224 |
| 702 | Ga0157376_10844177 | 3300014969 | Bacteria | 931 |
| 703 | Ga0182007_10407725 | 3300015262 | Bacteria | 519 |
| 704 | Ga0163161_10114895 | 3300017792 | Bacteria | 2017 |
| 705 | Ga0163161_10488411 | 3300017792 | Unclassified | 1001 |
| 706 | Ga0207666_1006342 | 3300025271 | Bacteria | 1532 |
| 707 | Ga0207673_1001644 | 3300025290 | Bacteria | 2469 |
| 708 | Ga0207697_10000027 | 3300025315 | Bacteria | 51720 |
| 709 | Ga0207697_10027070 | 3300025315 | Bacteria | 2345 |
| 710 | Ga0207697_10046882 | 3300025315 | Bacteria | 1781 |
| 711 | Ga0207697_10140340 | 3300025315 | Bacteria | 1048 |
| 712 | Ga0207697_10306687 | 3300025315 | Unclassified | 704 |
| 713 | Ga0207656_10133562 | 3300025321 | Unclassified | 1164 |
| 714 | Ga0207653_10040120 | 3300025885 | Bacteria | 1534 |
| 715 | Ga0207653_10213155 | 3300025885 | Unclassified | 731 |
| 716 | Ga0207682_10004644 | 3300025893 | Bacteria | 5708 |
| 717 | Ga0207682_10008666 | 3300025893 | Bacteria | 4021 |
| 718 | Ga0207682_10016389 | 3300025893 | Bacteria | 2890 |
| 719 | Ga0207682_10243992 | 3300025893 | Bacteria | 835 |
| 720 | Ga0207682_10250462 | 3300025893 | Bacteria | 824 |
| 721 | Ga0207682_10256282 | 3300025893 | Bacteria | 815 |
| 722 | Ga0207682_10317813 | 3300025893 | Unclassified | 731 |
| 723 | Ga0207682_10345322 | 3300025893 | Bacteria | 701 |
| 724 | Ga0207642_10061947 | 3300025899 | Bacteria | 1742 |
| 725 | Ga0207642_10258510 | 3300025899 | Bacteria | 992 |
| 726 | Ga0207688_10000041 | 3300025901 | Bacteria | 44495 |
| 727 | Ga0207688_10028006 | 3300025901 | Bacteria | 3100 |
| 728 | Ga0207688_10134788 | 3300025901 | Unclassified | 1449 |
| 729 | Ga0207688_10237014 | 3300025901 | Unclassified | 1103 |
| 730 | Ga0207688_10796349 | 3300025901 | Bacteria | 599 |
| 731 | Ga0207688_10917629 | 3300025901 | Unclassified | 554 |
| 732 | Ga0207680_10020405 | 3300025903 | Bacteria | 3566 |
| 733 | Ga0207680_10023926 | 3300025903 | Bacteria | 3343 |
| 734 | Ga0207680_10293039 | 3300025903 | Bacteria | 1133 |
| 735 | Ga0207647_10025156 | 3300025904 | Bacteria | 3918 |
| 736 | Ga0207647_10370539 | 3300025904 | Bacteria | 809 |
| 737 | Ga0207645_10000227 | 3300025907 | Bacteria | 46640 |
| 738 | Ga0207645_10002713 | 3300025907 | Bacteria | 13791 |
| 739 | Ga0207645_10205039 | 3300025907 | Bacteria | 1298 |
| 740 | Ga0207645_10307239 | 3300025907 | Bacteria | 1056 |
| 741 | Ga0207645_10327622 | 3300025907 | Bacteria | 1022 |
| 742 | Ga0207645_11235142 | 3300025907 | Bacteria | 501 |
| 743 | Ga0207643_10005161 | 3300025908 | Bacteria | 6986 |
| 744 | Ga0207643_10023237 | 3300025908 | Bacteria | 3418 |
| 745 | Ga0207643_10038219 | 3300025908 | Bacteria | 2696 |
| 746 | Ga0207643_10092900 | 3300025908 | Bacteria | 1761 |
| 747 | Ga0207643_10195992 | 3300025908 | Unclassified | 1228 |
| 748 | Ga0207643_10234962 | 3300025908 | Bacteria | 1125 |
| 749 | Ga0207643_10411311 | 3300025908 | Bacteria | 856 |
| 750 | Ga0207643_10793075 | 3300025908 | Bacteria | 614 |
| 751 | Ga0207643_10919221 | 3300025908 | Bacteria | 567 |
| 752 | Ga0207643_10935585 | 3300025908 | Unclassified | 561 |
| 753 | Ga0207684_10095825 | 3300025910 | Bacteria | 2532 |
| 754 | Ga0207684_10220997 | 3300025910 | Bacteria | 1635 |
| 755 | Ga0207684_10518557 | 3300025910 | Bacteria | 1021 |
| 756 | Ga0207684_10920302 | 3300025910 | Unclassified | 734 |
| 757 | Ga0207684_11023530 | 3300025910 | Unclassified | 690 |
| 758 | Ga0207654_10158211 | 3300025911 | Bacteria | 1461 |
| 759 | Ga0207707_10030021 | 3300025912 | Bacteria | 4753 |
| 760 | Ga0207693_10032205 | 3300025915 | Bacteria | 4138 |
| 761 | Ga0207693_10741698 | 3300025915 | Bacteria | 759 |
| 762 | Ga0207660_10166418 | 3300025917 | Unclassified | 1704 |
| 763 | Ga0207660_10184365 | 3300025917 | Bacteria | 1623 |
| 764 | Ga0207660_10384042 | 3300025917 | Bacteria | 1129 |
| 765 | Ga0207660_10451738 | 3300025917 | Bacteria | 1039 |
| 766 | Ga0207660_11460858 | 3300025917 | Bacteria | 553 |
| 767 | Ga0207662_10003200 | 3300025918 | Bacteria | 8383 |
| 768 | Ga0207662_10030980 | 3300025918 | Bacteria | 3107 |
| 769 | Ga0207662_10156944 | 3300025918 | Bacteria | 1451 |
| 770 | Ga0207662_10160812 | 3300025918 | Bacteria | 1435 |
| 771 | Ga0207662_10194251 | 3300025918 | Bacteria | 1311 |
| 772 | Ga0207662_10237935 | 3300025918 | Bacteria | 1191 |
| 773 | Ga0207662_10470489 | 3300025918 | Unclassified | 862 |
| 774 | Ga0207657_10295678 | 3300025919 | Bacteria | 1283 |
| 775 | Ga0207657_10798209 | 3300025919 | Unclassified | 730 |
| 776 | Ga0207649_10018539 | 3300025920 | Bacteria | 3961 |
| 777 | Ga0207649_10157926 | 3300025920 | Bacteria | 1569 |
| 778 | Ga0207649_10601098 | 3300025920 | Bacteria | 846 |
| 779 | Ga0207649_10639142 | 3300025920 | Bacteria | 821 |
| 780 | Ga0207652_10189796 | 3300025921 | Bacteria | 1848 |
| 781 | Ga0207646_10120102 | 3300025922 | Unclassified | 2361 |
| 782 | Ga0207646_10166324 | 3300025922 | Bacteria | 1991 |
| 783 | Ga0207646_10288753 | 3300025922 | Bacteria | 1482 |
| 784 | Ga0207646_10390394 | 3300025922 | Bacteria | 1257 |
| 785 | Ga0207646_11755045 | 3300025922 | Bacteria | 532 |
| 786 | Ga0207681_10003610 | 3300025923 | Bacteria | 9630 |
| 787 | Ga0207681_10010850 | 3300025923 | Bacteria | 5597 |
| 788 | Ga0207681_10153791 | 3300025923 | Bacteria | 1727 |
| 789 | Ga0207681_10253884 | 3300025923 | Unclassified | 1374 |
| 790 | Ga0207681_10390341 | 3300025923 | Bacteria | 1122 |
| 791 | Ga0207681_10534268 | 3300025923 | Bacteria | 963 |
| 792 | Ga0207681_10958236 | 3300025923 | Bacteria | 717 |
| 793 | Ga0207681_11087563 | 3300025923 | Unclassified | 671 |
| 794 | Ga0207681_11486801 | 3300025923 | Bacteria | 568 |
| 795 | Ga0207694_11386903 | 3300025924 | Bacteria | 594 |
| 796 | Ga0207650_10028707 | 3300025925 | Bacteria | 3992 |
| 797 | Ga0207650_10060265 | 3300025925 | Bacteria | 2832 |
| 798 | Ga0207650_10141949 | 3300025925 | Bacteria | 1889 |
| 799 | Ga0207650_10194492 | 3300025925 | Bacteria | 1622 |
| 800 | Ga0207650_10216404 | 3300025925 | Bacteria | 1540 |
| 801 | Ga0207650_10221723 | 3300025925 | Bacteria | 1522 |
| 802 | Ga0207650_10536255 | 3300025925 | Unclassified | 980 |
| 803 | Ga0207650_10624260 | 3300025925 | Unclassified | 907 |
| 804 | Ga0207650_10983689 | 3300025925 | Unclassified | 717 |
| 805 | Ga0207650_11133404 | 3300025925 | Bacteria | 666 |
| 806 | Ga0207650_11268438 | 3300025925 | Bacteria | 627 |
| 807 | Ga0207659_10010993 | 3300025926 | Bacteria | 5702 |
| 808 | Ga0207659_10043481 | 3300025926 | Bacteria | 3155 |
| 809 | Ga0207659_10067577 | 3300025926 | Unclassified | 2596 |
| 810 | Ga0207659_10147189 | 3300025926 | Bacteria | 1835 |
| 811 | Ga0207659_10153099 | 3300025926 | Unclassified | 1802 |
| 812 | Ga0207659_10381905 | 3300025926 | Bacteria | 1175 |
| 813 | Ga0207659_10424576 | 3300025926 | Unclassified | 1115 |
| 814 | Ga0207659_10425176 | 3300025926 | Bacteria | 1115 |
| 815 | Ga0207659_10461407 | 3300025926 | Unclassified | 1071 |
| 816 | Ga0207659_10502597 | 3300025926 | Bacteria | 1026 |
| 817 | Ga0207659_10503555 | 3300025926 | Bacteria | 1025 |
| 818 | Ga0207659_10607906 | 3300025926 | Unclassified | 932 |
| 819 | Ga0207659_10868420 | 3300025926 | Unclassified | 775 |
| 820 | Ga0207659_11014355 | 3300025926 | Bacteria | 714 |
| 821 | Ga0207659_11087766 | 3300025926 | Bacteria | 688 |
| 822 | Ga0207659_11088966 | 3300025926 | Bacteria | 687 |
| 823 | Ga0207687_10405824 | 3300025927 | Unclassified | 1122 |
| 824 | Ga0207687_10822312 | 3300025927 | Unclassified | 793 |
| 825 | Ga0207687_10996575 | 3300025927 | Bacteria | 718 |
| 826 | Ga0207700_10005256 | 3300025928 | Bacteria | 7717 |
| 827 | Ga0207644_10018034 | 3300025931 | Bacteria | 4771 |
| 828 | Ga0207644_10452454 | 3300025931 | Bacteria | 1055 |
| 829 | Ga0207644_10630925 | 3300025931 | Bacteria | 891 |
| 830 | Ga0207644_11208531 | 3300025931 | Bacteria | 635 |
| 831 | Ga0207690_10046001 | 3300025932 | Bacteria | 2887 |
| 832 | Ga0207690_10121160 | 3300025932 | Bacteria | 1900 |
| 833 | Ga0207690_10177085 | 3300025932 | Bacteria | 1603 |
| 834 | Ga0207690_10610160 | 3300025932 | Bacteria | 891 |
| 835 | Ga0207690_10799958 | 3300025932 | Bacteria | 779 |
| 836 | Ga0207690_11035729 | 3300025932 | Bacteria | 683 |
| 837 | Ga0207706_10005190 | 3300025933 | Bacteria | 12159 |
| 838 | Ga0207706_10044964 | 3300025933 | Unclassified | 3912 |
| 839 | Ga0207706_10156986 | 3300025933 | Bacteria | 2000 |
| 840 | Ga0207706_10756872 | 3300025933 | Bacteria | 827 |
| 841 | Ga0207706_11007593 | 3300025933 | Bacteria | 699 |
| 842 | Ga0207686_10251325 | 3300025934 | Bacteria | 1292 |
| 843 | Ga0207686_10254623 | 3300025934 | Unclassified | 1284 |
| 844 | Ga0207686_10284028 | 3300025934 | Bacteria | 1223 |
| 845 | Ga0207686_10737134 | 3300025934 | Bacteria | 786 |
| 846 | Ga0207709_10015105 | 3300025935 | Bacteria | 4278 |
| 847 | Ga0207709_10049606 | 3300025935 | Bacteria | 2563 |
| 848 | Ga0207709_11612661 | 3300025935 | Unclassified | 539 |
| 849 | Ga0207670_10032315 | 3300025936 | Bacteria | 3364 |
| 850 | Ga0207670_10139766 | 3300025936 | Bacteria | 1785 |
| 851 | Ga0207670_10155653 | 3300025936 | Unclassified | 1701 |
| 852 | Ga0207670_10182884 | 3300025936 | Bacteria | 1580 |
| 853 | Ga0207670_10830035 | 3300025936 | Unclassified | 771 |
| 854 | Ga0207670_11013481 | 3300025936 | Bacteria | 699 |
| 855 | Ga0207670_11910668 | 3300025936 | Unclassified | 505 |
| 856 | Ga0207669_10037520 | 3300025937 | Bacteria | 2781 |
| 857 | Ga0207669_10135020 | 3300025937 | Bacteria | 1702 |
| 858 | Ga0207669_10172455 | 3300025937 | Bacteria | 1541 |
| 859 | Ga0207669_10516967 | 3300025937 | Bacteria | 958 |
| 860 | Ga0207704_10057827 | 3300025938 | Bacteria | 2385 |
| 861 | Ga0207704_10085927 | 3300025938 | Unclassified | 2050 |
| 862 | Ga0207704_10092318 | 3300025938 | Bacteria | 1992 |
| 863 | Ga0207704_10173570 | 3300025938 | Unclassified | 1549 |
| 864 | Ga0207704_10447504 | 3300025938 | Unclassified | 1030 |
| 865 | Ga0207704_10984942 | 3300025938 | Bacteria | 712 |
| 866 | Ga0207665_10822309 | 3300025939 | Bacteria | 735 |
| 867 | Ga0207691_10000239 | 3300025940 | Bacteria | 53779 |
| 868 | Ga0207691_10036868 | 3300025940 | Bacteria | 4529 |
| 869 | Ga0207691_10043175 | 3300025940 | Bacteria | 4155 |
| 870 | Ga0207691_10046646 | 3300025940 | Bacteria | 3980 |
| 871 | Ga0207691_10051379 | 3300025940 | Bacteria | 3769 |
| 872 | Ga0207691_10295663 | 3300025940 | Bacteria | 1392 |
| 873 | Ga0207691_10360409 | 3300025940 | Bacteria | 1243 |
| 874 | Ga0207691_10869975 | 3300025940 | Archaea | 755 |
| 875 | Ga0207691_11609732 | 3300025940 | Bacteria | 528 |
| 876 | Ga0207711_10021329 | 3300025941 | Bacteria | 5412 |
| 877 | Ga0207711_10031939 | 3300025941 | Bacteria | 4449 |
| 878 | Ga0207711_10204662 | 3300025941 | Bacteria | 1802 |
| 879 | Ga0207711_10268590 | 3300025941 | Bacteria | 1569 |
| 880 | Ga0207711_10349380 | 3300025941 | Bacteria | 1369 |
| 881 | Ga0207711_10691829 | 3300025941 | Bacteria | 951 |
| 882 | Ga0207711_11193478 | 3300025941 | Unclassified | 702 |
| 883 | Ga0207711_12144345 | 3300025941 | Unclassified | 501 |
| 884 | Ga0207689_10003638 | 3300025942 | Bacteria | 14080 |
| 885 | Ga0207689_10014641 | 3300025942 | Bacteria | 6663 |
| 886 | Ga0207689_10029381 | 3300025942 | Bacteria | 4591 |
| 887 | Ga0207689_10035267 | 3300025942 | Bacteria | 4157 |
| 888 | Ga0207689_10084114 | 3300025942 | Bacteria | 2615 |
| 889 | Ga0207689_10133601 | 3300025942 | Bacteria | 2043 |
| 890 | Ga0207689_10336412 | 3300025942 | Bacteria | 1254 |
| 891 | Ga0207689_10723935 | 3300025942 | Bacteria | 839 |
| 892 | Ga0207661_11810926 | 3300025944 | Unclassified | 556 |
| 893 | Ga0207679_10026957 | 3300025945 | Bacteria | 3968 |
| 894 | Ga0207679_10056775 | 3300025945 | Unclassified | 2892 |
| 895 | Ga0207679_10061779 | 3300025945 | Bacteria | 2790 |
| 896 | Ga0207679_10237538 | 3300025945 | Bacteria | 1542 |
| 897 | Ga0207679_10240027 | 3300025945 | Bacteria | 1535 |
| 898 | Ga0207679_10359356 | 3300025945 | Bacteria | 1271 |
| 899 | Ga0207679_10429603 | 3300025945 | Bacteria | 1167 |
| 900 | Ga0207679_10905811 | 3300025945 | Bacteria | 807 |
| 901 | Ga0207679_11979131 | 3300025945 | Unclassified | 531 |
| 902 | Ga0207667_10511748 | 3300025949 | Bacteria | 1217 |
| 903 | Ga0207651_10047431 | 3300025960 | Bacteria | 2896 |
| 904 | Ga0207651_10065560 | 3300025960 | Unclassified | 2547 |
| 905 | Ga0207651_10156442 | 3300025960 | Bacteria | 1781 |
| 906 | Ga0207651_10274330 | 3300025960 | Bacteria | 1390 |
| 907 | Ga0207651_10331791 | 3300025960 | Unclassified | 1275 |
| 908 | Ga0207651_10513033 | 3300025960 | Unclassified | 1038 |
| 909 | Ga0207651_10540266 | 3300025960 | Bacteria | 1012 |
| 910 | Ga0207651_10677082 | 3300025960 | Unclassified | 907 |
| 911 | Ga0207651_10722213 | 3300025960 | Bacteria | 879 |
| 912 | Ga0207712_10020206 | 3300025961 | Bacteria | 4360 |
| 913 | Ga0207712_10025216 | 3300025961 | Bacteria | 3949 |
| 914 | Ga0207712_10087933 | 3300025961 | Bacteria | 2280 |
| 915 | Ga0207712_10131257 | 3300025961 | Unclassified | 1909 |
| 916 | Ga0207712_10347558 | 3300025961 | Bacteria | 1232 |
| 917 | Ga0207712_10447097 | 3300025961 | Unclassified | 1095 |
| 918 | Ga0207712_11092920 | 3300025961 | Unclassified | 710 |
| 919 | Ga0207712_11118843 | 3300025961 | Bacteria | 701 |
| 920 | Ga0207712_11773909 | 3300025961 | Unclassified | 553 |
| 921 | Ga0207668_10255299 | 3300025972 | Bacteria | 1426 |
| 922 | Ga0207668_10347608 | 3300025972 | Bacteria | 1239 |
| 923 | Ga0207668_10686280 | 3300025972 | Bacteria | 899 |
| 924 | Ga0207668_10824329 | 3300025972 | Bacteria | 822 |
| 925 | Ga0207668_11414219 | 3300025972 | Bacteria | 627 |
| 926 | Ga0207668_11543854 | 3300025972 | Bacteria | 599 |
| 927 | Ga0207640_10102475 | 3300025981 | Bacteria | 2010 |
| 928 | Ga0207640_10965696 | 3300025981 | Unclassified | 748 |
| 929 | Ga0207658_10069444 | 3300025986 | Bacteria | 2662 |
| 930 | Ga0207658_10191923 | 3300025986 | Bacteria | 1699 |
| 931 | Ga0207658_10219518 | 3300025986 | Bacteria | 1599 |
| 932 | Ga0207658_10432497 | 3300025986 | Bacteria | 1162 |
| 933 | Ga0207658_10590333 | 3300025986 | Unclassified | 997 |
| 934 | Ga0207677_10055612 | 3300026023 | Bacteria | 2707 |
| 935 | Ga0207677_10489755 | 3300026023 | Bacteria | 1061 |
| 936 | Ga0207677_10781184 | 3300026023 | Bacteria | 853 |
| 937 | Ga0207677_11029476 | 3300026023 | Bacteria | 748 |
| 938 | Ga0207677_11574095 | 3300026023 | Bacteria | 608 |
| 939 | Ga0207703_10009365 | 3300026035 | Bacteria | 7697 |
| 940 | Ga0207703_10041677 | 3300026035 | Bacteria | 3680 |
| 941 | Ga0207703_10109568 | 3300026035 | Bacteria | 2354 |
| 942 | Ga0207703_10141957 | 3300026035 | Bacteria | 2085 |
| 943 | Ga0207703_10825891 | 3300026035 | Bacteria | 886 |
| 944 | Ga0207639_10066993 | 3300026041 | Bacteria | 2793 |
| 945 | Ga0207678_10201267 | 3300026067 | Unclassified | 1703 |
| 946 | Ga0207678_10867584 | 3300026067 | Unclassified | 798 |
| 947 | Ga0207708_10008322 | 3300026075 | Bacteria | 7681 |
| 948 | Ga0207708_10035461 | 3300026075 | Bacteria | 3796 |
| 949 | Ga0207708_10112169 | 3300026075 | Bacteria | 2118 |
| 950 | Ga0207708_10148739 | 3300026075 | Bacteria | 1842 |
| 951 | Ga0207708_10262877 | 3300026075 | Bacteria | 1393 |
| 952 | Ga0207708_10639095 | 3300026075 | Unclassified | 905 |
| 953 | Ga0207708_10644522 | 3300026075 | Bacteria | 901 |
| 954 | Ga0207708_10803718 | 3300026075 | Bacteria | 810 |
| 955 | Ga0207708_10968341 | 3300026075 | Bacteria | 738 |
| 956 | Ga0207641_10053541 | 3300026088 | Unclassified | 3421 |
| 957 | Ga0207641_10148494 | 3300026088 | Bacteria | 2121 |
| 958 | Ga0207641_10216711 | 3300026088 | Bacteria | 1773 |
| 959 | Ga0207641_10388821 | 3300026088 | Bacteria | 1337 |
| 960 | Ga0207641_11899274 | 3300026088 | Bacteria | 597 |
| 961 | Ga0207641_12387757 | 3300026088 | Bacteria | 528 |
| 962 | Ga0207648_10005096 | 3300026089 | Bacteria | 13314 |
| 963 | Ga0207648_10009645 | 3300026089 | Bacteria | 9232 |
| 964 | Ga0207648_10051234 | 3300026089 | Bacteria | 3608 |
| 965 | Ga0207648_10102428 | 3300026089 | Bacteria | 2509 |
| 966 | Ga0207648_10178752 | 3300026089 | Unclassified | 1877 |
| 967 | Ga0207648_10270290 | 3300026089 | Bacteria | 1519 |
| 968 | Ga0207648_10516875 | 3300026089 | Archaea | 1094 |
| 969 | Ga0207648_10649501 | 3300026089 | Unclassified | 975 |
| 970 | Ga0207648_10740261 | 3300026089 | Unclassified | 913 |
| 971 | Ga0207648_11434418 | 3300026089 | Bacteria | 649 |
| 972 | Ga0207648_12071355 | 3300026089 | Unclassified | 530 |
| 973 | Ga0207676_10092775 | 3300026095 | Bacteria | 2484 |
| 974 | Ga0207676_10175669 | 3300026095 | Bacteria | 1870 |
| 975 | Ga0207676_10263626 | 3300026095 | Unclassified | 1557 |
| 976 | Ga0207676_10540002 | 3300026095 | Unclassified | 1112 |
| 977 | Ga0207676_11142258 | 3300026095 | Bacteria | 771 |
| 978 | Ga0207674_10107420 | 3300026116 | Bacteria | 2768 |
| 979 | Ga0207674_10108580 | 3300026116 | Bacteria | 2751 |
| 980 | Ga0207674_10131336 | 3300026116 | Bacteria | 2467 |
| 981 | Ga0207674_10158850 | 3300026116 | Bacteria | 2215 |
| 982 | Ga0207674_10323039 | 3300026116 | Bacteria | 1493 |
| 983 | Ga0207674_11064609 | 3300026116 | Bacteria | 778 |
| 984 | Ga0207675_100005724 | 3300026118 | Bacteria | 11891 |
| 985 | Ga0207675_100022564 | 3300026118 | Bacteria | 5860 |
| 986 | Ga0207675_100070901 | 3300026118 | Bacteria | 3257 |
| 987 | Ga0207675_100166549 | 3300026118 | Bacteria | 2105 |
| 988 | Ga0207675_100429742 | 3300026118 | Bacteria | 1305 |
| 989 | Ga0207675_100781734 | 3300026118 | Bacteria | 967 |
| 990 | Ga0207675_101457217 | 3300026118 | Bacteria | 705 |
| 991 | Ga0207675_101458169 | 3300026118 | Unclassified | 705 |
| 992 | Ga0207675_102190776 | 3300026118 | Bacteria | 568 |
| 993 | Ga0207683_10002140 | 3300026121 | Bacteria | 17343 |
| 994 | Ga0207683_10036397 | 3300026121 | Bacteria | 4286 |
| 995 | Ga0207683_10084807 | 3300026121 | Bacteria | 2816 |
| 996 | Ga0207683_10129472 | 3300026121 | Bacteria | 2269 |
| 997 | Ga0207683_10167894 | 3300026121 | Bacteria | 1986 |
| 998 | Ga0207683_10171952 | 3300026121 | Unclassified | 1962 |
| 999 | Ga0207683_10256952 | 3300026121 | Bacteria | 1595 |
| 1000 | Ga0207683_10438629 | 3300026121 | Unclassified | 1204 |
| 1001 | Ga0207683_10445439 | 3300026121 | Bacteria | 1194 |
| 1002 | Ga0207683_11183201 | 3300026121 | Bacteria | 709 |
| 1003 | Ga0207698_10215666 | 3300026142 | Bacteria | 1730 |
| 1004 | Ga0207698_10266732 | 3300026142 | Bacteria | 1576 |
| 1005 | Ga0207698_10401482 | 3300026142 | Bacteria | 1310 |
| 1006 | Ga0207698_10527512 | 3300026142 | Unclassified | 1153 |
| 1007 | Ga0207698_10565191 | 3300026142 | Bacteria | 1117 |
| 1008 | Ga0209973_1018226 | 3300027252 | Unclassified | 909 |
| 1009 | Ga0209969_1065712 | 3300027360 | Bacteria | 575 |
| 1010 | Ga0209996_1063244 | 3300027395 | Bacteria | 570 |
| 1011 | Ga0210000_1040959 | 3300027462 | Bacteria | 735 |
| 1012 | Ga0209968_1006266 | 3300027526 | Bacteria | 1791 |
| 1013 | Ga0209999_1031658 | 3300027543 | Bacteria | 982 |
| 1014 | Ga0209982_1025828 | 3300027552 | Bacteria | 914 |
| 1015 | Ga0209970_1014763 | 3300027614 | Bacteria | 1298 |
| 1016 | Ga0210002_1026697 | 3300027617 | Unclassified | 948 |
| 1017 | Ga0209983_1058324 | 3300027665 | Bacteria | 851 |
| 1018 | Ga0209998_10095070 | 3300027717 | Unclassified | 734 |
| 1019 | Ga0209813_10021164 | 3300027866 | Bacteria | 1826 |
| 1020 | Ga0209974_10057113 | 3300027876 | Bacteria | 1318 |
| 1021 | Ga0209974_10066894 | 3300027876 | Bacteria | 1221 |
| 1022 | Ga0207428_10000349 | 3300027907 | Bacteria | 59671 |
| 1023 | Ga0207428_10000712 | 3300027907 | Bacteria | 38459 |
| 1024 | Ga0207428_10003385 | 3300027907 | Bacteria | 15501 |
| 1025 | Ga0207428_10003621 | 3300027907 | Bacteria | 14905 |
| 1026 | Ga0207428_10005253 | 3300027907 | Bacteria | 12100 |
| 1027 | Ga0207428_10014253 | 3300027907 | Bacteria | 6916 |
| 1028 | Ga0207428_10020924 | 3300027907 | Bacteria | 5546 |
| 1029 | Ga0207428_10092864 | 3300027907 | Unclassified | 2342 |
| 1030 | Ga0207428_10149291 | 3300027907 | Bacteria | 1780 |
| 1031 | Ga0207428_10364693 | 3300027907 | Bacteria | 1061 |
| 1032 | Ga0207428_10436585 | 3300027907 | Bacteria | 955 |
| 1033 | Ga0207428_10518742 | 3300027907 | Bacteria | 864 |
| 1034 | Ga0207428_10590962 | 3300027907 | Unclassified | 800 |
| 1035 | Ga0207428_10692890 | 3300027907 | Bacteria | 729 |
| 1036 | Ga0268266_11071921 | 3300028379 | Bacteria | 780 |
| 1037 | Ga0268266_11283796 | 3300028379 | Bacteria | 707 |
| 1038 | Ga0268265_10001193 | 3300028380 | Bacteria | 22642 |
| 1039 | Ga0268265_10009264 | 3300028380 | Bacteria | 6654 |
| 1040 | Ga0268265_10019011 | 3300028380 | Bacteria | 4770 |
| 1041 | Ga0268265_10315492 | 3300028380 | Bacteria | 1413 |
| 1042 | Ga0268265_10361483 | 3300028380 | Bacteria | 1329 |
| 1043 | Ga0268265_10421163 | 3300028380 | Unclassified | 1240 |
| 1044 | Ga0268265_10447961 | 3300028380 | Bacteria | 1205 |
| 1045 | Ga0268265_10557341 | 3300028380 | Bacteria | 1089 |
| 1046 | Ga0268265_10850355 | 3300028380 | Bacteria | 893 |
| 1047 | Ga0268265_10990743 | 3300028380 | Bacteria | 830 |
| 1048 | Ga0268264_10041346 | 3300028381 | Bacteria | 3813 |
| 1049 | Ga0268264_10090200 | 3300028381 | Unclassified | 2641 |
| 1050 | Ga0268264_10321033 | 3300028381 | Unclassified | 1464 |
| 1051 | Ga0268264_10458881 | 3300028381 | Unclassified | 1236 |
| 1052 | Ga0268264_10591113 | 3300028381 | Bacteria | 1093 |
| 1053 | Ga0316178_1121891 | 3300030735 | Bacteria | 603 |
| 1054 | Ga0316178_1125099 | 3300030735 | Bacteria | 536 |
| 1055 | Ga0307408_100045422 | 3300031548 | Bacteria | 3137 |
| 1056 | Ga0307408_100078654 | 3300031548 | Bacteria | 2459 |
| 1057 | Ga0307408_100110251 | 3300031548 | Bacteria | 2113 |
| 1058 | Ga0307408_100327780 | 3300031548 | Bacteria | 1292 |
| 1059 | Ga0307408_100330602 | 3300031548 | Unclassified | 1287 |
| 1060 | Ga0307408_100535976 | 3300031548 | Bacteria | 1031 |
| 1061 | Ga0307408_100585827 | 3300031548 | Bacteria | 989 |
| 1062 | Ga0307408_100740419 | 3300031548 | Bacteria | 887 |
| 1063 | Ga0307408_100985467 | 3300031548 | Bacteria | 776 |
| 1064 | Ga0307405_10036153 | 3300031731 | Bacteria | 2956 |
| 1065 | Ga0307405_10103932 | 3300031731 | Bacteria | 1911 |
| 1066 | Ga0307405_10279159 | 3300031731 | Bacteria | 1256 |
| 1067 | Ga0307405_10433885 | 3300031731 | Bacteria | 1037 |
| 1068 | Ga0307405_10530239 | 3300031731 | Bacteria | 949 |
| 1069 | Ga0307413_10082909 | 3300031824 | Bacteria | 2061 |
| 1070 | Ga0307413_10212256 | 3300031824 | Unclassified | 1407 |
| 1071 | Ga0307413_10296776 | 3300031824 | Bacteria | 1224 |
| 1072 | Ga0307413_10556385 | 3300031824 | Unclassified | 931 |
| 1073 | Ga0307413_10771005 | 3300031824 | Bacteria | 806 |
| 1074 | Ga0307413_11568089 | 3300031824 | Bacteria | 584 |
| 1075 | Ga0307413_11854035 | 3300031824 | Unclassified | 541 |
| 1076 | Ga0307410_10033548 | 3300031852 | Bacteria | 3315 |
| 1077 | Ga0307410_10035916 | 3300031852 | Bacteria | 3223 |
| 1078 | Ga0307410_10127209 | 3300031852 | Bacteria | 1867 |
| 1079 | Ga0307410_10252476 | 3300031852 | Bacteria | 1372 |
| 1080 | Ga0307410_10451403 | 3300031852 | Unclassified | 1049 |
| 1081 | Ga0307410_10819182 | 3300031852 | Bacteria | 793 |
| 1082 | Ga0307406_10028273 | 3300031901 | Bacteria | 3387 |
| 1083 | Ga0307406_10032820 | 3300031901 | Bacteria | 3172 |
| 1084 | Ga0307406_10258929 | 3300031901 | Bacteria | 1315 |
| 1085 | Ga0307406_10306786 | 3300031901 | Bacteria | 1222 |
| 1086 | Ga0307406_10376173 | 3300031901 | Bacteria | 1118 |
| 1087 | Ga0307406_11163277 | 3300031901 | Bacteria | 668 |
| 1088 | Ga0307406_11404059 | 3300031901 | Unclassified | 612 |
| 1089 | Ga0307407_10009129 | 3300031903 | Bacteria | 4601 |
| 1090 | Ga0307407_10069122 | 3300031903 | Bacteria | 2095 |
| 1091 | Ga0307407_10437374 | 3300031903 | Bacteria | 946 |
| 1092 | Ga0307407_10746492 | 3300031903 | Unclassified | 741 |
| 1093 | Ga0307407_10818033 | 3300031903 | Bacteria | 710 |
| 1094 | Ga0307407_10976059 | 3300031903 | Bacteria | 654 |
| 1095 | Ga0307412_10021563 | 3300031911 | Bacteria | 3937 |
| 1096 | Ga0307412_10072599 | 3300031911 | Bacteria | 2352 |
| 1097 | Ga0307412_10248597 | 3300031911 | Bacteria | 1380 |
| 1098 | Ga0307412_10287603 | 3300031911 | Bacteria | 1293 |
| 1099 | Ga0307412_10325164 | 3300031911 | Unclassified | 1225 |
| 1100 | Ga0307412_10461052 | 3300031911 | Bacteria | 1049 |
| 1101 | Ga0307412_11031866 | 3300031911 | Unclassified | 728 |
| 1102 | Ga0307412_11168664 | 3300031911 | Archaea | 688 |
| 1103 | Ga0307412_12230138 | 3300031911 | Bacteria | 510 |
| 1104 | Ga0307409_100011203 | 3300031995 | Bacteria | 5636 |
| 1105 | Ga0307409_100022487 | 3300031995 | Bacteria | 4349 |
| 1106 | Ga0307409_100026651 | 3300031995 | Bacteria | 4080 |
| 1107 | Ga0307409_100098923 | 3300031995 | Bacteria | 2414 |
| 1108 | Ga0307409_100184355 | 3300031995 | Bacteria | 1851 |
| 1109 | Ga0307409_100207098 | 3300031995 | Bacteria | 1760 |
| 1110 | Ga0307409_101677757 | 3300031995 | Bacteria | 664 |
| 1111 | Ga0307409_102243049 | 3300031995 | Unclassified | 575 |
| 1112 | Ga0307416_100001674 | 3300032002 | Bacteria | 12248 |
| 1113 | Ga0307416_100009915 | 3300032002 | Bacteria | 6266 |
| 1114 | Ga0307416_100026805 | 3300032002 | Bacteria | 4254 |
| 1115 | Ga0307416_100056674 | 3300032002 | Bacteria | 3164 |
| 1116 | Ga0307416_100131865 | 3300032002 | Bacteria | 2251 |
| 1117 | Ga0307416_100153108 | 3300032002 | Bacteria | 2118 |
| 1118 | Ga0307416_100160503 | 3300032002 | Bacteria | 2077 |
| 1119 | Ga0307416_100620634 | 3300032002 | Unclassified | 1163 |
| 1120 | Ga0307416_101043049 | 3300032002 | Bacteria | 921 |
| 1121 | Ga0307416_101761539 | 3300032002 | Unclassified | 724 |
| 1122 | Ga0307416_102224680 | 3300032002 | Bacteria | 649 |
| 1123 | Ga0307416_102511534 | 3300032002 | Unclassified | 614 |
| 1124 | Ga0307414_10358836 | 3300032004 | Bacteria | 1253 |
| 1125 | Ga0307414_10674327 | 3300032004 | Bacteria | 934 |
| 1126 | Ga0307414_10959155 | 3300032004 | Unclassified | 786 |
| 1127 | Ga0307414_11053250 | 3300032004 | Bacteria | 750 |
| 1128 | Ga0307414_11675213 | 3300032004 | Bacteria | 593 |
| 1129 | Ga0307411_10012530 | 3300032005 | Bacteria | 4633 |
| 1130 | Ga0307411_10033406 | 3300032005 | Bacteria | 3191 |
| 1131 | Ga0307411_10045602 | 3300032005 | Bacteria | 2821 |
| 1132 | Ga0307411_10142666 | 3300032005 | Bacteria | 1768 |
| 1133 | Ga0307411_10272078 | 3300032005 | Unclassified | 1344 |
| 1134 | Ga0307411_10332286 | 3300032005 | Bacteria | 1232 |
| 1135 | Ga0307411_10401465 | 3300032005 | Unclassified | 1133 |
| 1136 | Ga0307411_10402475 | 3300032005 | Bacteria | 1132 |
| 1137 | Ga0307411_10480110 | 3300032005 | Bacteria | 1046 |
| 1138 | Ga0307411_10629031 | 3300032005 | Bacteria | 926 |
| 1139 | Ga0307411_10659286 | 3300032005 | Bacteria | 907 |
| 1140 | Ga0307411_10720879 | 3300032005 | Bacteria | 871 |
| 1141 | Ga0307411_11909683 | 3300032005 | Bacteria | 553 |
| 1142 | Ga0307415_100014778 | 3300032126 | Bacteria | 4602 |
| 1143 | Ga0307415_100044852 | 3300032126 | Bacteria | 2959 |
| 1144 | Ga0307415_100238149 | 3300032126 | Bacteria | 1470 |
| 1145 | Ga0307415_102053544 | 3300032126 | Bacteria | 557 |
| 1146 | Ga0373930_0056077 | 3300034816 | Bacteria | 870 |
| 1147 | Ga0373930_0143019 | 3300034816 | Bacteria | 595 |
| 1148 | Ga0373948_0096995 | 3300034817 | Unclassified | 690 |
| 1149 | Ga0373950_0140565 | 3300034818 | Bacteria | 546 |
| 1150 | Ga0373959_0008472 | 3300034820 | Bacteria | 1751 |
| 1151 | Ga0373938_0086091 | 3300034957 | Bacteria | 771 |
| 1152 | Ga0373938_0090990 | 3300034957 | Unclassified | 755 |
| 1153 | Ga0373928_0048271 | 3300035084 | Bacteria | 998 |
| 1154 | Ga0373934_0004468 | 3300035086 | Bacteria | 5165 |
| 1155 | Ga0373934_0277115 | 3300035086 | Bacteria | 694 |
| 1156 | Ga0373940_0119441 | 3300035088 | Bacteria | 816 |
| 1157 | Ga0373949_0016508 | 3300035090 | Bacteria | 1656 |
| 1158 | Ga0373949_0086483 | 3300035090 | Unclassified | 842 |
| 1159 | Ga0373951_0024736 | 3300035091 | Bacteria | 1392 |
| 1160 | Ga0373923_0337989 | 3300035111 | Bacteria | 717 |
| 1161 | Ga0373923_0590249 | 3300035111 | Unclassified | 546 |
| 1162 | Ga0373932_0006139 | 3300035112 | Bacteria | 2837 |
| 1163 | Ga0373939_0050966 | 3300035114 | Unclassified | 1285 |
| 1164 | Ga0373953_0046414 | 3300035117 | Bacteria | 1744 |
| 1165 | Ga0373956_0022440 | 3300035119 | Bacteria | 2701 |
| 1166 | Ga0373956_0615016 | 3300035119 | Bacteria | 519 |
| 1167 | Ga0373957_0044026 | 3300035120 | Bacteria | 1688 |
| 1168 | Ga0373943_0647648 | 3300035170 | Bacteria | 624 |
| 1169 | Ga0373946_0143261 | 3300035171 | Bacteria | 1109 |
| 1170 | Ga0373955_0008601 | 3300035172 | Bacteria | 4747 |
| 1171 | Ga0373961_0033334 | 3300035241 | Bacteria | 1450 |
| 1172 | Ga0373962_0010858 | 3300035242 | Bacteria | 2277 |
| 1173 | Ga0373962_0061456 | 3300035242 | Unclassified | 1104 |
| 1174 | Ga0373931_0010056 | 3300035691 | Bacteria | 4537 |
| 1175 | Ga0373935_0117923 | 3300035692 | Bacteria | 1770 |
| 1176 | Ga0373933_0004292 | 3300035724 | Bacteria | 7832 |
| 1177 | Ga0373947_0021292 | 3300035725 | Bacteria | 3752 |
| 1178 | Ga0373947_0186396 | 3300035725 | Bacteria | 1353 |
| 1179 | Ga0373937_0000636 | 3300036401 | Bacteria | 30772 |
| 1180 | Ga0373937_0026134 | 3300036401 | Bacteria | 5275 |
| 1181 | Ga0373937_0085337 | 3300036401 | Bacteria | 2922 |
| 1182 | Ga0373925_1046224 | 3300037068 | Archaea | 672 |
| 1183 | Ga0373925_1428439 | 3300037068 | Unclassified | 567 |
| 1184 | Ga0436365_0953110 | 3300039437 | Bacteria | 892 |
| 1185 | Ga0439439_0078764 | 3300041406 | Bacteria | 889 |
| 1186 | Ga0439439_0091287 | 3300041406 | Bacteria | 832 |
| 1187 | Ga0439447_144857 | 3300041407 | Bacteria | 546 |
| 1188 | Ga0439453_0002220 | 3300041408 | Bacteria | 2647 |
| 1189 | Ga0439453_0073614 | 3300041408 | Unclassified | 726 |
| 1190 | Ga0451800_1242213 | 3300041459 | Unclassified | 711 |
| 1191 | Ga0451802_1299424 | 3300041460 | Bacteria | 706 |
| 1192 | Ga0451804_0497166 | 3300041463 | Bacteria | 515 |
| 1193 | Ga0451807_2002591 | 3300041486 | Unclassified | 554 |
| 1194 | Ga0451839_1004516 | 3300041496 | Bacteria | 838 |
| 1195 | Ga0451853_2851514 | 3300041512 | Unclassified | 652 |
| 1196 | Ga0451853_3766231 | 3300041512 | Bacteria | 1004 |
| 1197 | Ga0439433_0034595 | 3300041999 | Bacteria | 1163 |
| 1198 | Ga0439433_0110546 | 3300041999 | Archaea | 687 |
| 1199 | Ga0439433_0197986 | 3300041999 | Unclassified | 530 |
| 1200 | Ga0439443_031403 | 3300042003 | Unclassified | 877 |
| 1201 | Ga0439449_0053239 | 3300042007 | Unclassified | 1496 |
| 1202 | Ga0439450_005909 | 3300042008 | Bacteria | 2177 |
| 1203 | Ga0439451_104283 | 3300042009 | Bacteria | 574 |
| 1204 | Ga0439454_013548 | 3300042011 | Bacteria | 1121 |
| 1205 | Ga0439455_0114671 | 3300042012 | Unclassified | 752 |
| 1206 | Ga0439462_0025023 | 3300042015 | Unclassified | 1570 |
| 1207 | Ga0450921_035558 | 3300042123 | Bacteria | 520 |
| 1208 | Ga0450923_017462 | 3300042125 | Unclassified | 1363 |
| 1209 | Ga0450923_159847 | 3300042125 | Bacteria | 548 |
| 1210 | Ga0450896_015177 | 3300042133 | Unclassified | 1102 |
| 1211 | Ga0450910_011732 | 3300042147 | Unclassified | 1260 |
| 1212 | Ga0439446_0003023 | 3300042156 | Bacteria | 4122 |
| 1213 | Ga0439446_0021022 | 3300042156 | Bacteria | 1842 |
| 1214 | Ga0439446_0084355 | 3300042156 | Bacteria | 987 |
| 1215 | Ga0439434_0054175 | 3300042435 | Bacteria | 1247 |
| 1216 | Ga0439434_0055441 | 3300042435 | Bacteria | 1234 |
| 1217 | Ga0439434_0062109 | 3300042435 | Bacteria | 1169 |
| 1218 | Ga0439434_0114700 | 3300042435 | Bacteria | 875 |
| 1219 | Ga0439434_0311933 | 3300042435 | Unclassified | 545 |
| 1220 | Ga0439435_0003643 | 3300042436 | Bacteria | 3229 |
| 1221 | Ga0439435_0011938 | 3300042436 | Bacteria | 2092 |
| 1222 | Ga0439435_0102358 | 3300042436 | Bacteria | 881 |
| 1223 | Ga0439435_0203733 | 3300042436 | Bacteria | 653 |
| 1224 | Ga0439435_0209413 | 3300042436 | Bacteria | 645 |
| 1225 | Ga0439464_0046054 | 3300042439 | Bacteria | 1253 |
| 1226 | Ga0439464_0167033 | 3300042439 | Bacteria | 693 |
| 1227 | Ga0439460_0043518 | 3300042461 | Bacteria | 1327 |
| 1228 | Ga0439460_0158880 | 3300042461 | Unclassified | 757 |
| 1229 | Ga0439460_0333968 | 3300042461 | Bacteria | 533 |
| 1230 | Ga0451577_0038896 | 3300042876 | Bacteria | 4276 |
| 1231 | Ga0451577_0533990 | 3300042876 | Bacteria | 1065 |
| 1232 | Ga0451577_1053720 | 3300042876 | Unclassified | 729 |
| 1233 | Ga0451577_1576744 | 3300042876 | Bacteria | 580 |
| 1234 | Ga0451577_1619139 | 3300042876 | Unclassified | 571 |
| 1235 | Ga0439440_0027927 | 3300042993 | Bacteria | 1314 |
| 1236 | Ga0439440_0099536 | 3300042993 | Unclassified | 790 |
| 1237 | Ga0439440_0166330 | 3300042993 | Bacteria | 639 |
| 1238 | Ga0453683_0091878 | 3300044673 | Bacteria | 1903 |
| 1239 | Ga0453683_0528129 | 3300044673 | Bacteria | 767 |
| 1240 | Ga0451576_0012634 | 3300045051 | Bacteria | 9481 |
| 1241 | Ga0451576_0031403 | 3300045051 | Bacteria | 5662 |
| 1242 | Ga0451576_0058861 | 3300045051 | Bacteria | 4012 |
| 1243 | Ga0451576_0259416 | 3300045051 | Bacteria | 1816 |
| 1244 | Ga0451576_0273634 | 3300045051 | Bacteria | 1765 |
| 1245 | Ga0451576_0323658 | 3300045051 | Bacteria | 1614 |
| 1246 | Ga0451576_0583309 | 3300045051 | Unclassified | 1175 |
| 1247 | Ga0451576_0618807 | 3300045051 | Bacteria | 1138 |
| 1248 | Ga0451576_0620486 | 3300045051 | Unclassified | 1136 |
| 1249 | Ga0451576_0970371 | 3300045051 | Bacteria | 891 |
| 1250 | Ga0466967_0595390 | 3300045976 | Bacteria | 1091 |
| 1251 | Ga0495592_0175793 | 3300046454 | Bacteria | 1462 |
| 1252 | Ga0495592_0214714 | 3300046454 | Bacteria | 1290 |
| 1253 | Ga0495592_0322870 | 3300046454 | Bacteria | 997 |
| 1254 | Ga0495603_0028716 | 3300046455 | Bacteria | 3356 |
| 1255 | Ga0495603_0203919 | 3300046455 | Bacteria | 1143 |
| 1256 | Ga0495603_0304534 | 3300046455 | Bacteria | 915 |
| 1257 | Ga0495591_095428 | 3300046458 | Bacteria | 742 |
| 1258 | Ga0495629_0010127 | 3300046459 | Bacteria | 6876 |
| 1259 | Ga0495629_0432018 | 3300046459 | Archaea | 893 |
| 1260 | Ga0495629_0566880 | 3300046459 | Bacteria | 761 |
| 1261 | Ga0495641_0411295 | 3300046461 | Bacteria | 614 |
| 1262 | Ga0495651_0086226 | 3300046462 | Bacteria | 2363 |
| 1263 | Ga0495653_0465696 | 3300046463 | Bacteria | 793 |
| 1264 | Ga0495580_0068165 | 3300046472 | Unclassified | 2488 |
| 1265 | Ga0495582_0102419 | 3300046473 | Bacteria | 1604 |
| 1266 | Ga0495639_0089871 | 3300046475 | Bacteria | 1440 |
| 1267 | Ga0495584_0006908 | 3300046491 | Bacteria | 5930 |
| 1268 | Ga0495594_0244993 | 3300046499 | Bacteria | 1021 |
| 1269 | Ga0495594_0579791 | 3300046499 | Bacteria | 636 |
| 1270 | Ga0495596_0248217 | 3300046500 | Bacteria | 691 |
| 1271 | Ga0495628_0282618 | 3300046516 | Bacteria | 1232 |
| 1272 | Ga0495628_0886300 | 3300046516 | Bacteria | 620 |
| 1273 | Ga0495630_0355794 | 3300046517 | Bacteria | 1121 |
| 1274 | Ga0495643_0002815 | 3300046522 | Bacteria | 13276 |
| 1275 | Ga0495644_0010822 | 3300046523 | Bacteria | 3515 |
| 1276 | Ga0495663_0045519 | 3300046525 | Bacteria | 1345 |
| 1277 | Ga0495663_0058320 | 3300046525 | Bacteria | 1210 |
| 1278 | Ga0495663_0184678 | 3300046525 | Bacteria | 723 |
| 1279 | Ga0495642_0020701 | 3300046528 | Unclassified | 2585 |
| 1280 | Ga0495642_0067859 | 3300046528 | Bacteria | 1488 |
| 1281 | Ga0495665_0218846 | 3300046531 | Bacteria | 985 |
| 1282 | Ga0495665_0234161 | 3300046531 | Bacteria | 948 |
| 1283 | Ga0495640_0476707 | 3300046533 | Unclassified | 760 |
| 1284 | Ga0495598_0007773 | 3300046537 | Bacteria | 2473 |
| 1285 | Ga0495598_0024579 | 3300046537 | Bacteria | 1635 |
| 1286 | Ga0495598_0036341 | 3300046537 | Bacteria | 1415 |
| 1287 | Ga0495598_0150546 | 3300046537 | Unclassified | 812 |
| 1288 | Ga0495609_0012011 | 3300046538 | Bacteria | 4112 |
| 1289 | Ga0495609_0042546 | 3300046538 | Bacteria | 2040 |
| 1290 | Ga0495621_0014062 | 3300046539 | Unclassified | 2527 |
| 1291 | Ga0495621_0027383 | 3300046539 | Bacteria | 1930 |
| 1292 | Ga0495621_0042478 | 3300046539 | Bacteria | 1600 |
| 1293 | Ga0495621_0095893 | 3300046539 | Bacteria | 1124 |
| 1294 | Ga0495621_0148753 | 3300046539 | Bacteria | 920 |
| 1295 | Ga0495621_0177310 | 3300046539 | Bacteria | 849 |
| 1296 | Ga0495621_0401471 | 3300046539 | Bacteria | 581 |
| 1297 | Ga0495645_0152782 | 3300046543 | Unclassified | 1602 |
| 1298 | Ga0495645_0700655 | 3300046543 | Bacteria | 615 |
| 1299 | Ga0495633_0042236 | 3300046558 | Bacteria | 2167 |
| 1300 | Ga0495633_0366956 | 3300046558 | Unclassified | 652 |
| 1301 | Ga0495656_0013094 | 3300046615 | Bacteria | 3077 |
| 1302 | Ga0495656_0174465 | 3300046615 | Bacteria | 1053 |
| 1303 | Ga0495656_0480620 | 3300046615 | Unclassified | 657 |
| 1304 | Ga0495634_0108588 | 3300046642 | Bacteria | 1786 |
| 1305 | Ga0495659_0004263 | 3300046664 | Bacteria | 4508 |
| 1306 | Ga0495659_0014786 | 3300046664 | Bacteria | 2559 |
| 1307 | Ga0495659_0024829 | 3300046664 | Bacteria | 2047 |
| 1308 | Ga0495659_0028143 | 3300046664 | Bacteria | 1943 |
| 1309 | Ga0495659_0035778 | 3300046664 | Bacteria | 1751 |
| 1310 | Ga0495659_0184986 | 3300046664 | Bacteria | 850 |
| 1311 | Ga0495588_0185482 | 3300046674 | Bacteria | 1099 |
| 1312 | Ga0495657_0228745 | 3300046675 | Bacteria | 1126 |
| 1313 | Ga0495599_0158825 | 3300046678 | Bacteria | 1398 |
| 1314 | Ga0495599_0301724 | 3300046678 | Unclassified | 967 |
| 1315 | Ga0495599_0393328 | 3300046678 | Bacteria | 826 |
| 1316 | Ga0495647_0193634 | 3300046681 | Bacteria | 889 |
| 1317 | Ga0495658_0022875 | 3300046683 | Bacteria | 3311 |
| 1318 | Ga0495658_0300792 | 3300046683 | Bacteria | 1015 |
| 1319 | Ga0495658_0340284 | 3300046683 | Bacteria | 953 |
| 1320 | Ga0495658_0624089 | 3300046683 | Bacteria | 690 |
| 1321 | Ga0495669_0072519 | 3300046684 | Bacteria | 1571 |
| 1322 | Ga0495669_0146586 | 3300046684 | Bacteria | 1116 |
| 1323 | Ga0495613_0114988 | 3300046689 | Unclassified | 1936 |
| 1324 | Ga0495613_0500522 | 3300046689 | Bacteria | 818 |
| 1325 | Ga0495670_0011708 | 3300046691 | Bacteria | 4318 |
| 1326 | Ga0495600_0309593 | 3300046809 | Unclassified | 995 |
| 1327 | Ga0495636_0009944 | 3300047318 | Bacteria | 3747 |
| 1328 | Ga0495636_0090396 | 3300047318 | Bacteria | 1329 |
| 1329 | Ga0495636_0509187 | 3300047318 | Unclassified | 583 |
| 1330 | Ga0495636_0634507 | 3300047318 | Unclassified | 524 |
| 1331 | Ga0495636_0674064 | 3300047318 | Bacteria | 509 |
| 1332 | Ga0495680_0134588 | 3300047322 | Bacteria | 1813 |
| 1333 | Ga0495680_0399604 | 3300047322 | Bacteria | 949 |
| 1334 | Ga0495677_0049108 | 3300047445 | Bacteria | 1550 |
| 1335 | Ga0495677_0118788 | 3300047445 | Bacteria | 1007 |
| 1336 | Ga0495685_031609 | 3300047447 | Bacteria | 1819 |
| 1337 | Ga0495681_0319422 | 3300047470 | Bacteria | 597 |
| 1338 | Ga0495684_0089234 | 3300047471 | Unclassified | 2336 |
| 1339 | Ga0495684_0460863 | 3300047471 | Unclassified | 881 |
| 1340 | Ga0495684_0505847 | 3300047471 | Bacteria | 830 |
| 1341 | Ga0495615_0316624 | 3300048090 | Bacteria | 509 |
| 1342 | Ga0496100_0121371 | 3300048903 | Bacteria | 1829 |
| 1343 | Ga0496101_0195879 | 3300048904 | Bacteria | 1561 |
| 1344 | Ga0496101_0679749 | 3300048904 | Bacteria | 813 |
| 1345 | Ga0496102_0206051 | 3300048905 | Bacteria | 1854 |
| 1346 | Ga0496102_0261172 | 3300048905 | Bacteria | 1633 |
| 1347 | Ga0496102_0269420 | 3300048905 | Bacteria | 1605 |
| 1348 | Ga0496102_0569143 | 3300048905 | Bacteria | 1056 |
| 1349 | Ga0496102_1671889 | 3300048905 | Unclassified | 555 |
| 1350 | Ga0496103_0095295 | 3300048906 | Bacteria | 1881 |
| 1351 | Ga0496103_0545996 | 3300048906 | Bacteria | 740 |
| 1352 | Ga0496104_0174331 | 3300048907 | Bacteria | 2061 |
| 1353 | Ga0496104_0460648 | 3300048907 | Bacteria | 1183 |
| 1354 | Ga0496104_0738223 | 3300048907 | Bacteria | 892 |
| 1355 | Ga0496104_0746304 | 3300048907 | Bacteria | 886 |
| 1356 | Ga0496104_0970935 | 3300048907 | Bacteria | 754 |
| 1357 | Ga0496105_0490804 | 3300048908 | Bacteria | 965 |
| 1358 | Ga0496105_0744554 | 3300048908 | Unclassified | 749 |
| 1359 | Ga0496106_0037675 | 3300048909 | Bacteria | 3618 |
| 1360 | Ga0496106_0127079 | 3300048909 | Bacteria | 1997 |
| 1361 | Ga0496106_0159753 | 3300048909 | Bacteria | 1782 |
| 1362 | Ga0496106_0956915 | 3300048909 | Bacteria | 675 |
| 1363 | Ga0496106_1354798 | 3300048909 | Bacteria | 551 |
| 1364 | Ga0496106_1368031 | 3300048909 | Unclassified | 548 |
| 1365 | Ga0496107_0060010 | 3300048910 | Bacteria | 2753 |
| 1366 | Ga0496108_0801139 | 3300048911 | Bacteria | 813 |
| 1367 | Ga0496108_0901811 | 3300048911 | Bacteria | 759 |
| 1368 | Ga0496108_1104027 | 3300048911 | Bacteria | 674 |
| 1369 | Ga0496109_0101586 | 3300048912 | Bacteria | 2669 |
| 1370 | Ga0496109_0297960 | 3300048912 | Bacteria | 1520 |
| 1371 | Ga0496109_0445681 | 3300048912 | Unclassified | 1223 |
| 1372 | Ga0496110_0122855 | 3300048913 | Bacteria | 2341 |
| 1373 | Ga0496110_0239227 | 3300048913 | Bacteria | 1652 |
| 1374 | Ga0496111_0080696 | 3300048914 | Bacteria | 2374 |
| 1375 | Ga0496112_0182869 | 3300048915 | Bacteria | 2060 |
| 1376 | Ga0496112_0188578 | 3300048915 | Bacteria | 2024 |
| 1377 | Ga0496112_0269256 | 3300048915 | Bacteria | 1652 |
| 1378 | Ga0496112_0354959 | 3300048915 | Bacteria | 1408 |
| 1379 | Ga0496112_0474935 | 3300048915 | Bacteria | 1187 |
| 1380 | Ga0496113_0048818 | 3300048916 | Bacteria | 3150 |
| 1381 | Ga0496113_0191155 | 3300048916 | Bacteria | 1625 |
| 1382 | Ga0496113_0736987 | 3300048916 | Bacteria | 785 |
| 1383 | Ga0496113_1322015 | 3300048916 | Bacteria | 560 |
| 1384 | Ga0496114_0055265 | 3300048917 | Bacteria | 3312 |
| 1385 | Ga0496114_0448148 | 3300048917 | Unclassified | 1143 |
| 1386 | Ga0501292_067102 | 3300049515 | Bacteria | 661 |
| 1387 | Ga0501298_045014 | 3300049521 | Bacteria | 902 |
| 1388 | Ga0501299_087856 | 3300049522 | Bacteria | 701 |
| 1389 | Ga0501031_0038545 | 3300049568 | Bacteria | 3119 |
| 1390 | Ga0501031_0141434 | 3300049568 | Unclassified | 1573 |
| 1391 | Ga0501031_0251274 | 3300049568 | Bacteria | 1149 |
| 1392 | Ga0501031_0448789 | 3300049568 | Bacteria | 833 |
| 1393 | Ga0501031_0601906 | 3300049568 | Bacteria | 707 |
| 1394 | Ga0501031_0723589 | 3300049568 | Unclassified | 639 |
| 1395 | Ga0501031_1003046 | 3300049568 | Unclassified | 534 |
| 1396 | Ga0501032_0384007 | 3300049569 | Bacteria | 903 |
| 1397 | Ga0501032_0493440 | 3300049569 | Bacteria | 783 |
| 1398 | Ga0501033_1029612 | 3300049570 | Unclassified | 549 |
| 1399 | Ga0501034_0015608 | 3300049571 | Bacteria | 7802 |
| 1400 | Ga0501036_0028391 | 3300049572 | Bacteria | 4729 |
| 1401 | Ga0501036_0061087 | 3300049572 | Bacteria | 3192 |
| 1402 | Ga0501036_0061802 | 3300049572 | Bacteria | 3173 |
| 1403 | Ga0501036_0110384 | 3300049572 | Bacteria | 2324 |
| 1404 | Ga0501036_0171280 | 3300049572 | Bacteria | 1829 |
| 1405 | Ga0501036_0278905 | 3300049572 | Bacteria | 1399 |
| 1406 | Ga0501036_1060526 | 3300049572 | Unclassified | 662 |
| 1407 | Ga0501038_0099437 | 3300049574 | Unclassified | 2425 |
| 1408 | Ga0501038_0250481 | 3300049574 | Bacteria | 1403 |
| 1409 | Ga0501038_0639775 | 3300049574 | Bacteria | 801 |
| 1410 | Ga0501039_0053404 | 3300049575 | Bacteria | 3127 |
| 1411 | Ga0501039_0078127 | 3300049575 | Bacteria | 2574 |
| 1412 | Ga0501039_0167072 | 3300049575 | Bacteria | 1730 |
| 1413 | Ga0501039_0212573 | 3300049575 | Bacteria | 1521 |
| 1414 | Ga0501039_0504810 | 3300049575 | Unclassified | 950 |
| 1415 | Ga0501039_1226203 | 3300049575 | Bacteria | 580 |
| 1416 | Ga0501040_0030080 | 3300049576 | Bacteria | 3666 |
| 1417 | Ga0501040_0038103 | 3300049576 | Bacteria | 3268 |
| 1418 | Ga0501040_0060087 | 3300049576 | Unclassified | 2612 |
| 1419 | Ga0501040_0116438 | 3300049576 | Bacteria | 1872 |
| 1420 | Ga0501040_0226057 | 3300049576 | Bacteria | 1332 |
| 1421 | Ga0501040_0255070 | 3300049576 | Unclassified | 1251 |
| 1422 | Ga0501040_0498434 | 3300049576 | Bacteria | 878 |
| 1423 | Ga0501040_0699699 | 3300049576 | Bacteria | 733 |
| 1424 | Ga0501040_0987307 | 3300049576 | Bacteria | 610 |
| 1425 | Ga0501041_0015406 | 3300049577 | Bacteria | 4539 |
| 1426 | Ga0501041_0054344 | 3300049577 | Bacteria | 2443 |
| 1427 | Ga0501041_0083530 | 3300049577 | Bacteria | 1968 |
| 1428 | Ga0501041_0103906 | 3300049577 | Bacteria | 1760 |
| 1429 | Ga0501041_0111791 | 3300049577 | Bacteria | 1695 |
| 1430 | Ga0501041_0237919 | 3300049577 | Bacteria | 1144 |
| 1431 | Ga0501041_0254373 | 3300049577 | Unclassified | 1104 |
| 1432 | Ga0501041_0557464 | 3300049577 | Bacteria | 730 |
| 1433 | Ga0501041_0864701 | 3300049577 | Bacteria | 580 |
| 1434 | Ga0501042_0004352 | 3300049578 | Bacteria | 9032 |
| 1435 | Ga0501042_0006294 | 3300049578 | Bacteria | 7701 |
| 1436 | Ga0501042_0049639 | 3300049578 | Bacteria | 2994 |
| 1437 | Ga0501042_0076956 | 3300049578 | Bacteria | 2388 |
| 1438 | Ga0501042_0079656 | 3300049578 | Bacteria | 2347 |
| 1439 | Ga0501042_0201100 | 3300049578 | Bacteria | 1437 |
| 1440 | Ga0501042_0300280 | 3300049578 | Bacteria | 1160 |
| 1441 | Ga0501042_0316617 | 3300049578 | Unclassified | 1127 |
| 1442 | Ga0501042_0619301 | 3300049578 | Bacteria | 787 |
| 1443 | Ga0501042_0854305 | 3300049578 | Unclassified | 663 |
| 1444 | Ga0501042_0899896 | 3300049578 | Bacteria | 645 |
| 1445 | Ga0501042_1196565 | 3300049578 | Bacteria | 554 |
| 1446 | Ga0501042_1247838 | 3300049578 | Bacteria | 542 |
| 1447 | Ga0501046_0077616 | 3300049580 | Unclassified | 2571 |
| 1448 | Ga0501046_0144572 | 3300049580 | Bacteria | 1797 |
| 1449 | Ga0501046_0203832 | 3300049580 | Bacteria | 1471 |
| 1450 | Ga0501046_0365586 | 3300049580 | Bacteria | 1046 |
| 1451 | Ga0501046_0490987 | 3300049580 | Bacteria | 880 |
| 1452 | Ga0501046_0580604 | 3300049580 | Bacteria | 797 |
| 1453 | Ga0501046_0854914 | 3300049580 | Bacteria | 636 |
| 1454 | Ga0501046_0881826 | 3300049580 | Bacteria | 625 |
| 1455 | Ga0501046_0975397 | 3300049580 | Bacteria | 589 |
| 1456 | Ga0501048_0041238 | 3300049582 | Bacteria | 3307 |
| 1457 | Ga0501048_0190242 | 3300049582 | Bacteria | 1454 |
| 1458 | Ga0501048_0227370 | 3300049582 | Unclassified | 1324 |
| 1459 | Ga0501067_0218144 | 3300049583 | Bacteria | 1062 |
| 1460 | Ga0501067_0551759 | 3300049583 | Bacteria | 645 |
| 1461 | Ga0501068_0416688 | 3300049584 | Bacteria | 867 |
| 1462 | Ga0501068_0575080 | 3300049584 | Bacteria | 733 |
| 1463 | Ga0501068_0820407 | 3300049584 | Bacteria | 610 |
| 1464 | Ga0501068_0967867 | 3300049584 | Unclassified | 561 |
| 1465 | Ga0501069_0016549 | 3300049585 | Bacteria | 3962 |
| 1466 | Ga0501069_0397933 | 3300049585 | Bacteria | 815 |
| 1467 | Ga0501070_0655922 | 3300049586 | Bacteria | 833 |
| 1468 | Ga0501071_0031633 | 3300049587 | Bacteria | 3753 |
| 1469 | Ga0501071_0048323 | 3300049587 | Bacteria | 3060 |
| 1470 | Ga0501071_0063771 | 3300049587 | Bacteria | 2672 |
| 1471 | Ga0501071_0081426 | 3300049587 | Unclassified | 2369 |
| 1472 | Ga0501071_0107221 | 3300049587 | Bacteria | 2063 |
| 1473 | Ga0501071_0109853 | 3300049587 | Bacteria | 2037 |
| 1474 | Ga0501071_0242716 | 3300049587 | Bacteria | 1358 |
| 1475 | Ga0501071_0306179 | 3300049587 | Bacteria | 1205 |
| 1476 | Ga0501071_0347803 | 3300049587 | Bacteria | 1128 |
| 1477 | Ga0501071_0354867 | 3300049587 | Bacteria | 1116 |
| 1478 | Ga0501071_0432787 | 3300049587 | Bacteria | 1006 |
| 1479 | Ga0501071_0523538 | 3300049587 | Bacteria | 910 |
| 1480 | Ga0501071_0670146 | 3300049587 | Unclassified | 798 |
| 1481 | Ga0501071_0996713 | 3300049587 | Unclassified | 647 |
| 1482 | Ga0501072_0029646 | 3300049588 | Bacteria | 4275 |
| 1483 | Ga0501072_0041729 | 3300049588 | Bacteria | 3604 |
| 1484 | Ga0501072_0044490 | 3300049588 | Bacteria | 3491 |
| 1485 | Ga0501072_0048029 | 3300049588 | Bacteria | 3361 |
| 1486 | Ga0501072_0048343 | 3300049588 | Bacteria | 3350 |
| 1487 | Ga0501072_0089431 | 3300049588 | Bacteria | 2444 |
| 1488 | Ga0501072_0431023 | 3300049588 | Unclassified | 1045 |
| 1489 | Ga0501072_0472281 | 3300049588 | Bacteria | 993 |
| 1490 | Ga0501072_0501968 | 3300049588 | Bacteria | 960 |
| 1491 | Ga0501073_0213239 | 3300049589 | Unclassified | 1334 |
| 1492 | Ga0501073_0215792 | 3300049589 | Bacteria | 1326 |
| 1493 | Ga0501073_0865991 | 3300049589 | Unclassified | 622 |
| 1494 | Ga0501073_0884497 | 3300049589 | Bacteria | 615 |
| 1495 | Ga0501073_0984686 | 3300049589 | Bacteria | 580 |
| 1496 | Ga0501074_0035716 | 3300049590 | Bacteria | 3601 |
| 1497 | Ga0501074_0092250 | 3300049590 | Unclassified | 2169 |
| 1498 | Ga0501074_0102598 | 3300049590 | Bacteria | 2048 |
| 1499 | Ga0501074_0258520 | 3300049590 | Bacteria | 1238 |
| 1500 | Ga0501074_0479483 | 3300049590 | Bacteria | 882 |
| 1501 | Ga0501074_1040128 | 3300049590 | Bacteria | 575 |
| 1502 | Ga0501075_0001534 | 3300049591 | Bacteria | 15063 |
| 1503 | Ga0501075_0049516 | 3300049591 | Bacteria | 3158 |
| 1504 | Ga0501075_0054943 | 3300049591 | Bacteria | 2996 |
| 1505 | Ga0501075_0096446 | 3300049591 | Bacteria | 2244 |
| 1506 | Ga0501075_0121378 | 3300049591 | Bacteria | 1989 |
| 1507 | Ga0501075_0230007 | 3300049591 | Bacteria | 1414 |
| 1508 | Ga0501075_0248926 | 3300049591 | Bacteria | 1354 |
| 1509 | Ga0501075_0342117 | 3300049591 | Unclassified | 1140 |
| 1510 | Ga0501075_0580187 | 3300049591 | Bacteria | 855 |
| 1511 | Ga0501075_0682699 | 3300049591 | Bacteria | 783 |
| 1512 | Ga0501075_0818579 | 3300049591 | Bacteria | 709 |
| 1513 | Ga0501075_0949379 | 3300049591 | Unclassified | 653 |
| 1514 | Ga0501075_1521763 | 3300049591 | Bacteria | 506 |
| 1515 | Ga0501076_0019323 | 3300049592 | Bacteria | 5207 |
| 1516 | Ga0501076_0038764 | 3300049592 | Bacteria | 3741 |
| 1517 | Ga0501076_0075398 | 3300049592 | Bacteria | 2703 |
| 1518 | Ga0501076_0096096 | 3300049592 | Bacteria | 2386 |
| 1519 | Ga0501076_0137576 | 3300049592 | Bacteria | 1983 |
| 1520 | Ga0501076_0182934 | 3300049592 | Bacteria | 1709 |
| 1521 | Ga0501076_0207182 | 3300049592 | Bacteria | 1602 |
| 1522 | Ga0501076_0212453 | 3300049592 | Bacteria | 1581 |
| 1523 | Ga0501076_0237592 | 3300049592 | Bacteria | 1490 |
| 1524 | Ga0501076_0241434 | 3300049592 | Bacteria | 1478 |
| 1525 | Ga0501076_0551030 | 3300049592 | Bacteria | 951 |
| 1526 | Ga0501076_0557294 | 3300049592 | Unclassified | 945 |
| 1527 | Ga0501076_0698563 | 3300049592 | Bacteria | 837 |
| 1528 | Ga0501076_1632557 | 3300049592 | Unclassified | 529 |
| 1529 | Ga0501077_0089699 | 3300049593 | Bacteria | 1948 |
| 1530 | Ga0501077_0134659 | 3300049593 | Bacteria | 1567 |
| 1531 | Ga0501077_0393406 | 3300049593 | Bacteria | 886 |
| 1532 | Ga0501077_0457684 | 3300049593 | Bacteria | 817 |
| 1533 | Ga0501077_0530309 | 3300049593 | Unclassified | 755 |
| 1534 | Ga0501077_0719995 | 3300049593 | Unclassified | 641 |
| 1535 | Ga0501077_0873736 | 3300049593 | Unclassified | 578 |
| 1536 | Ga0501202_092255 | 3300049652 | Unclassified | 726 |
| 1537 | Ga0501216_061920 | 3300049660 | Bacteria | 756 |
| 1538 | Ga0501227_112764 | 3300049665 | Unclassified | 730 |
| 1539 | Ga0501249_061747 | 3300049679 | Unclassified | 869 |
| 1540 | Ga0501257_271935 | 3300049686 | Unclassified | 508 |
| 1541 | Ga0501225_0073986 | 3300049705 | Bacteria | 971 |
| 1542 | Ga0501245_038230 | 3300049708 | Bacteria | 817 |
| 1543 | Ga0501079_0027535 | 3300049741 | Bacteria | 4359 |
| 1544 | Ga0501079_0131308 | 3300049741 | Bacteria | 1949 |
| 1545 | Ga0501079_0148554 | 3300049741 | Bacteria | 1827 |
| 1546 | Ga0501079_0228858 | 3300049741 | Unclassified | 1452 |
| 1547 | Ga0501079_0234487 | 3300049741 | Unclassified | 1434 |
| 1548 | Ga0501079_0234523 | 3300049741 | Bacteria | 1434 |
| 1549 | Ga0501079_0325735 | 3300049741 | Bacteria | 1203 |
| 1550 | Ga0501079_0332332 | 3300049741 | Bacteria | 1190 |
| 1551 | Ga0501079_0405745 | 3300049741 | Bacteria | 1069 |
| 1552 | Ga0501079_0464341 | 3300049741 | Bacteria | 994 |
| 1553 | Ga0501079_0505695 | 3300049741 | Unclassified | 950 |
| 1554 | Ga0501079_0635786 | 3300049741 | Bacteria | 840 |
| 1555 | Ga0501079_1397826 | 3300049741 | Unclassified | 551 |
| 1556 | Ga0501079_1499221 | 3300049741 | Unclassified | 530 |
| 1557 | Ga0501080_0027010 | 3300049742 | Bacteria | 5338 |
| 1558 | Ga0501080_0148803 | 3300049742 | Bacteria | 2165 |
| 1559 | Ga0501080_0171834 | 3300049742 | Bacteria | 1999 |
| 1560 | Ga0501080_0232516 | 3300049742 | Bacteria | 1685 |
| 1561 | Ga0501080_0591806 | 3300049742 | Unclassified | 985 |
| 1562 | Ga0501080_0689315 | 3300049742 | Bacteria | 902 |
| 1563 | Ga0501080_0732812 | 3300049742 | Bacteria | 870 |
| 1564 | Ga0501080_0823799 | 3300049742 | Unclassified | 813 |
| 1565 | Ga0501081_0000708 | 3300049743 | Bacteria | 19308 |
| 1566 | Ga0501081_0076474 | 3300049743 | Bacteria | 2338 |
| 1567 | Ga0501081_0118553 | 3300049743 | Bacteria | 1883 |
| 1568 | Ga0501081_0172852 | 3300049743 | Unclassified | 1560 |
| 1569 | Ga0501081_0255552 | 3300049743 | Bacteria | 1280 |
| 1570 | Ga0501081_0398103 | 3300049743 | Bacteria | 1019 |
| 1571 | Ga0501081_0523685 | 3300049743 | Bacteria | 884 |
| 1572 | Ga0501081_0554181 | 3300049743 | Unclassified | 859 |
| 1573 | Ga0501081_1103045 | 3300049743 | Unclassified | 601 |
| 1574 | Ga0501081_1177872 | 3300049743 | Unclassified | 580 |
| 1575 | Ga0501083_0208336 | 3300049744 | Bacteria | 1275 |
| 1576 | Ga0501083_0288049 | 3300049744 | Bacteria | 1068 |
| 1577 | Ga0501265_092295 | 3300049762 | Unclassified | 542 |
| 1578 | Ga0501273_048209 | 3300049770 | Bacteria | 646 |
| 1579 | Ga0501035_0353546 | 3300049822 | Bacteria | 1229 |
| 1580 | Ga0501035_0387322 | 3300049822 | Bacteria | 1165 |
| 1581 | Ga0501035_0520082 | 3300049822 | Bacteria | 978 |
| 1582 | Ga0501035_0530483 | 3300049822 | Unclassified | 966 |
| 1583 | Ga0501035_0743217 | 3300049822 | Bacteria | 788 |
| 1584 | Ga0501045_0015789 | 3300049824 | Bacteria | 5356 |
| 1585 | Ga0501045_0064388 | 3300049824 | Bacteria | 2691 |
| 1586 | Ga0501045_0079907 | 3300049824 | Bacteria | 2411 |
| 1587 | Ga0501045_0363578 | 3300049824 | Bacteria | 1077 |
| 1588 | Ga0501045_0366621 | 3300049824 | Bacteria | 1072 |
| 1589 | Ga0501045_0527886 | 3300049824 | Bacteria | 876 |
| 1590 | Ga0501045_0531618 | 3300049824 | Bacteria | 873 |
| 1591 | Ga0501045_0650461 | 3300049824 | Unclassified | 779 |
| 1592 | Ga0501045_0688110 | 3300049824 | Unclassified | 755 |
| 1593 | Ga0501045_0869495 | 3300049824 | Bacteria | 663 |
| 1594 | nmdc:mga03n38_266970_c1 | 3300050490 | Bacteria | 909 |
| 1595 | nmdc:mga0yw44_52317_c1 | 3300050492 | Bacteria | 2475 |
| 1596 | nmdc:mga0k408_15652_c1 | 3300050493 | Bacteria | 4198 |
| 1597 | nmdc:mga06z11_141222_c1 | 3300050494 | Unclassified | 1362 |
| 1598 | nmdc:mga04h51_34990_c1 | 3300050495 | Bacteria | 1608 |
| 1599 | nmdc:mga07m45_795385_c1 | 3300050496 | Unclassified | 542 |
| 1600 | nmdc:mga05p37_106692_c1 | 3300050507 | Bacteria | 3446 |
| 1601 | nmdc:mga05p37_1504302_c1 | 3300050507 | Bacteria | 670 |
| 1602 | nmdc:mga05p37_154728_c1 | 3300050507 | Bacteria | 2803 |
| 1603 | nmdc:mga05p37_171660_c1 | 3300050507 | Bacteria | 2644 |
| 1604 | nmdc:mga05p37_1804323_c1 | 3300050507 | Bacteria | 590 |
| 1605 | nmdc:mga05p37_1976_c1 | 3300050507 | Bacteria | 23897 |
| 1606 | nmdc:mga05p37_197987_c1 | 3300050507 | Bacteria | 2435 |
| 1607 | nmdc:mga05p37_199120_c1 | 3300050507 | Bacteria | 2427 |
| 1608 | nmdc:mga05p37_223620_c1 | 3300050507 | Bacteria | 2271 |
| 1609 | nmdc:mga05p37_2275317_c1 | 3300050507 | Unclassified | 500 |
| 1610 | nmdc:mga05p37_2706_c1 | 3300050507 | Bacteria | 20600 |
| 1611 | nmdc:mga05p37_317756_c1 | 3300050507 | Bacteria | 1844 |
| 1612 | nmdc:mga05p37_337377_c1 | 3300050507 | Bacteria | 1778 |
| 1613 | nmdc:mga05p37_526088_c1 | 3300050507 | Unclassified | 1352 |
| 1614 | nmdc:mga05p37_585099_c1 | 3300050507 | Bacteria | 1263 |
| 1615 | nmdc:mga05p37_59257_c1 | 3300050507 | Bacteria | 4715 |
| 1616 | nmdc:mga05p37_68798_c1 | 3300050507 | Bacteria | 4354 |
| 1617 | nmdc:mga05p37_701855_c1 | 3300050507 | Bacteria | 1124 |
| 1618 | nmdc:mga05p37_93129_c1 | 3300050507 | Bacteria | 3713 |
| 1619 | nmdc:mga05p37_974318_c1 | 3300050507 | Bacteria | 904 |
| 1620 | nmdc:mga09592_1170006_c1 | 3300050508 | Bacteria | 637 |
| 1621 | nmdc:mga09592_1186048_c1 | 3300050508 | Unclassified | 632 |
| 1622 | nmdc:mga09592_1243835_c1 | 3300050508 | Bacteria | 614 |
| 1623 | nmdc:mga09592_23365_c1 | 3300050508 | Bacteria | 5107 |
| 1624 | nmdc:mga09592_27002_c1 | 3300050508 | Bacteria | 4761 |
| 1625 | nmdc:mga09592_355668_c1 | 3300050508 | Unclassified | 1267 |
| 1626 | nmdc:mga09592_381873_c1 | 3300050508 | Bacteria | 1218 |
| 1627 | nmdc:mga09592_4784_c1 | 3300050508 | Bacteria | 10966 |
| 1628 | nmdc:mga09592_5871_c1 | 3300050508 | Bacteria | 10020 |
| 1629 | nmdc:mga09592_6156_c1 | 3300050508 | Bacteria | 9765 |
| 1630 | nmdc:mga09592_62474_c1 | 3300050508 | Bacteria | 3151 |
| 1631 | nmdc:mga09592_8217_c1 | 3300050508 | Bacteria | 8486 |
| 1632 | nmdc:mga09592_9092_c1 | 3300050508 | Bacteria | 8077 |
| 1633 | nmdc:mga0qj67_1128930_c1 | 3300050509 | Bacteria | 612 |
| 1634 | nmdc:mga0qj67_1161620_c1 | 3300050509 | Unclassified | 601 |
| 1635 | nmdc:mga0qj67_123623_c1 | 3300050509 | Bacteria | 2093 |
| 1636 | nmdc:mga0qj67_14732_c1 | 3300050509 | Bacteria | 5910 |
| 1637 | nmdc:mga0qj67_148525_c1 | 3300050509 | Bacteria | 1901 |
| 1638 | nmdc:mga0qj67_1512_c1 | 3300050509 | Bacteria | 16310 |
| 1639 | nmdc:mga0qj67_196722_c1 | 3300050509 | Bacteria | 1638 |
| 1640 | nmdc:mga0qj67_205756_c1 | 3300050509 | Unclassified | 1599 |
| 1641 | nmdc:mga0qj67_23280_c1 | 3300050509 | Bacteria | 4763 |
| 1642 | nmdc:mga0qj67_299002_c1 | 3300050509 | Bacteria | 1304 |
| 1643 | nmdc:mga0qj67_363959_c1 | 3300050509 | Bacteria | 1168 |
| 1644 | nmdc:mga0qj67_43412_c1 | 3300050509 | Bacteria | 3541 |
| 1645 | nmdc:mga0qj67_52665_c1 | 3300050509 | Bacteria | 3222 |
| 1646 | nmdc:mga0qj67_615366_c1 | 3300050509 | Bacteria | 868 |
| 1647 | nmdc:mga06r32_1028982_c1 | 3300050510 | Bacteria | 775 |
| 1648 | nmdc:mga06r32_104941_c1 | 3300050510 | Bacteria | 2776 |
| 1649 | nmdc:mga06r32_13471_c1 | 3300050510 | Bacteria | 7409 |
| 1650 | nmdc:mga06r32_15765_c1 | 3300050510 | Bacteria | 6869 |
| 1651 | nmdc:mga06r32_16110_c1 | 3300050510 | Bacteria | 6806 |
| 1652 | nmdc:mga06r32_178119_c1 | 3300050510 | Bacteria | 2111 |
| 1653 | nmdc:mga06r32_237906_c1 | 3300050510 | Bacteria | 1809 |
| 1654 | nmdc:mga06r32_349348_c1 | 3300050510 | Bacteria | 1463 |
| 1655 | nmdc:mga06r32_3881_c1 | 3300050510 | Bacteria | 13387 |
| 1656 | nmdc:mga06r32_407277_c1 | 3300050510 | Bacteria | 1342 |
| 1657 | nmdc:mga06r32_407433_c1 | 3300050510 | Unclassified | 1342 |
| 1658 | nmdc:mga06r32_41924_c1 | 3300050510 | Bacteria | 4350 |
| 1659 | nmdc:mga06r32_506831_c1 | 3300050510 | Bacteria | 1183 |
| 1660 | nmdc:mga06r32_529084_c1 | 3300050510 | Unclassified | 1154 |
| 1661 | nmdc:mga06r32_558884_c1 | 3300050510 | Bacteria | 1118 |
| 1662 | nmdc:mga08y16_12708_c1 | 3300050511 | Bacteria | 8859 |
| 1663 | nmdc:mga08y16_1710_c1 | 3300050511 | Bacteria | 22264 |
| 1664 | nmdc:mga08y16_2030909_c1 | 3300050511 | Unclassified | 524 |
| 1665 | nmdc:mga08y16_225793_c1 | 3300050511 | Bacteria | 1938 |
| 1666 | nmdc:mga08y16_23899_c1 | 3300050511 | Bacteria | 6455 |
| 1667 | nmdc:mga08y16_242504_c1 | 3300050511 | Bacteria | 1863 |
| 1668 | nmdc:mga08y16_25391_c1 | 3300050511 | Bacteria | 6249 |
| 1669 | nmdc:mga08y16_262941_c1 | 3300050511 | Bacteria | 1782 |
| 1670 | nmdc:mga08y16_38458_c1 | 3300050511 | Bacteria | 5024 |
| 1671 | nmdc:mga08y16_48960_c1 | 3300050511 | Bacteria | 4423 |
| 1672 | nmdc:mga08y16_512312_c1 | 3300050511 | Bacteria | 1218 |
| 1673 | nmdc:mga08y16_58928_c1 | 3300050511 | Bacteria | 4012 |
| 1674 | nmdc:mga08y16_61068_c1 | 3300050511 | Bacteria | 3936 |
| 1675 | nmdc:mga08y16_611_c1 | 3300050511 | Bacteria | 33310 |
| 1676 | nmdc:mga08y16_661563_c1 | 3300050511 | Bacteria | 1048 |
| 1677 | nmdc:mga08y16_680507_c1 | 3300050511 | Bacteria | 1030 |
| 1678 | nmdc:mga08y16_92341_c1 | 3300050511 | Bacteria | 3154 |
| 1679 | nmdc:mga0n895_136748_c1 | 3300050512 | Unclassified | 2477 |
| 1680 | nmdc:mga0n895_1679667_c1 | 3300050512 | Unclassified | 598 |
| 1681 | nmdc:mga0n895_1711348_c1 | 3300050512 | Bacteria | 591 |
| 1682 | nmdc:mga0n895_266830_c1 | 3300050512 | Bacteria | 1737 |
| 1683 | nmdc:mga0n895_267989_c1 | 3300050512 | Bacteria | 1733 |
| 1684 | nmdc:mga0n895_409293_c1 | 3300050512 | Unclassified | 1372 |
| 1685 | nmdc:mga0n895_45123_c1 | 3300050512 | Bacteria | 4300 |
| 1686 | nmdc:mga0n895_46172_c1 | 3300050512 | Bacteria | 4254 |
| 1687 | nmdc:mga0n895_5739_c1 | 3300050512 | Bacteria | 10416 |
| 1688 | nmdc:mga0n895_65562_c1 | 3300050512 | Bacteria | 3595 |
| 1689 | nmdc:mga0n895_70695_c1 | 3300050512 | Bacteria | 3459 |
| 1690 | nmdc:mga0n895_796655_c1 | 3300050512 | Bacteria | 936 |
| 1691 | nmdc:mga0n895_87579_c1 | 3300050512 | Bacteria | 3112 |
| 1692 | nmdc:mga0n895_916967_c1 | 3300050512 | Unclassified | 861 |
| 1693 | nmdc:mga0rr50_108495_c1 | 3300050513 | Bacteria | 2193 |
| 1694 | nmdc:mga0rr50_12095_c1 | 3300050513 | Bacteria | 5560 |
| 1695 | nmdc:mga0rr50_13165_c1 | 3300050513 | Bacteria | 5375 |
| 1696 | nmdc:mga0rr50_13953_c1 | 3300050513 | Bacteria | 5250 |
| 1697 | nmdc:mga0rr50_290916_c1 | 3300050513 | Bacteria | 1365 |
| 1698 | nmdc:mga0rr50_33925_c1 | 3300050513 | Bacteria | 3650 |
| 1699 | nmdc:mga0rr50_393479_c1 | 3300050513 | Unclassified | 1170 |
| 1700 | nmdc:mga0rr50_41835_c1 | 3300050513 | Bacteria | 3342 |
| 1701 | nmdc:mga0rr50_430192_c1 | 3300050513 | Bacteria | 1117 |
| 1702 | nmdc:mga08x19_558855_c1 | 3300050514 | Unclassified | 810 |
| 1703 | nmdc:mga08x19_780647_c1 | 3300050514 | Unclassified | 678 |
| 1704 | nmdc:mga0a205_139238_c1 | 3300050515 | Bacteria | 2327 |
| 1705 | nmdc:mga0a205_146048_c1 | 3300050515 | Unclassified | 2265 |
| 1706 | nmdc:mga0a205_197617_c1 | 3300050515 | Unclassified | 1902 |
| 1707 | nmdc:mga0a205_265250_c1 | 3300050515 | Unclassified | 1595 |
| 1708 | nmdc:mga0a205_2970_c1 | 3300050515 | Bacteria | 15044 |
| 1709 | nmdc:mga0a205_34005_c1 | 3300050515 | Bacteria | 4890 |
| 1710 | nmdc:mga0a205_44696_c1 | 3300050515 | Bacteria | 4271 |
| 1711 | nmdc:mga0a205_475349_c1 | 3300050515 | Bacteria | 1108 |
| 1712 | nmdc:mga0a205_492_c1 | 3300050515 | Bacteria | 30923 |
| 1713 | nmdc:mga0a205_53372_c1 | 3300050515 | Bacteria | 3902 |
| 1714 | nmdc:mga0a205_60215_c1 | 3300050515 | Unclassified | 3667 |
| 1715 | nmdc:mga0a205_81248_c1 | 3300050515 | Bacteria | 3131 |
| 1716 | nmdc:mga0a205_88597_c2 | 3300050515 | Bacteria | 2400 |
| 1717 | nmdc:mga0a205_90545_c1 | 3300050515 | Bacteria | 2956 |
| 1718 | nmdc:mga0a205_986_c1 | 3300050515 | Bacteria | 23556 |
| 1719 | Ga0495601_0209666 | 3300053077 | Bacteria | 1273 |
| 1720 | Ga0495595_0078472 | 3300053084 | Bacteria | 1570 |
| 1721 | Ga0500627_0236848 | 3300053158 | Unclassified | 811 |
| 1722 | Ga0501084_0023866 | 3300054114 | Bacteria | 5101 |
| 1723 | Ga0501084_0040229 | 3300054114 | Bacteria | 3910 |
| 1724 | Ga0501084_0084650 | 3300054114 | Bacteria | 2662 |
| 1725 | Ga0501084_0183348 | 3300054114 | Bacteria | 1767 |
| 1726 | Ga0501084_0189565 | 3300054114 | Bacteria | 1735 |
| 1727 | Ga0501084_0229065 | 3300054114 | Bacteria | 1568 |
| 1728 | Ga0501084_0427270 | 3300054114 | Unclassified | 1120 |
| 1729 | Ga0501084_0506312 | 3300054114 | Bacteria | 1020 |
| 1730 | Ga0501084_0852898 | 3300054114 | Unclassified | 767 |
| 1731 | Ga0501084_1438926 | 3300054114 | Unclassified | 577 |
| 1732 | Ga0590071_000034 | 3300059421 | Bacteria | 36259 |
| 1733 | Ga0590071_000282 | 3300059421 | Bacteria | 14815 |
| 1734 | Ga0590071_070774 | 3300059421 | Bacteria | 859 |
| 1735 | Ga0590074_001566 | 3300059423 | Bacteria | 3716 |
| 1736 | Ga0590074_021132 | 3300059423 | Bacteria | 1121 |
| 1737 | Ga0590074_059239 | 3300059423 | Unclassified | 710 |
| 1738 | Ga0590074_086406 | 3300059423 | Unclassified | 603 |
| 1739 | Ga0590075_000025 | 3300059424 | Bacteria | 39755 |
| 1740 | Ga0590075_000872 | 3300059424 | Bacteria | 7892 |
| 1741 | Ga0590077_000006 | 3300059426 | Bacteria | 42966 |
| 1742 | Ga0590077_000238 | 3300059426 | Bacteria | 15670 |
| 1743 | Ga0590077_043048 | 3300059426 | Bacteria | 1006 |
| 1744 | Ga0501082_0020583 | 3300060353 | Bacteria | 5687 |
| 1745 | Ga0501082_0021769 | 3300060353 | Bacteria | 5528 |
| 1746 | Ga0501082_0121692 | 3300060353 | Bacteria | 2262 |
| 1747 | Ga0501082_0176603 | 3300060353 | Unclassified | 1857 |
| 1748 | Ga0501082_0286730 | 3300060353 | Unclassified | 1433 |
| 1749 | Ga0501082_0333163 | 3300060353 | Bacteria | 1322 |
| 1750 | Ga0501082_0378492 | 3300060353 | Bacteria | 1235 |
| 1751 | Ga0501082_0506550 | 3300060353 | Bacteria | 1055 |
| 1752 | Ga0501082_0555722 | 3300060353 | Bacteria | 1004 |
| 1753 | Ga0501082_0629369 | 3300060353 | Bacteria | 939 |
| 1754 | Ga0501082_0635418 | 3300060353 | Bacteria | 934 |
| 1755 | Ga0501082_0929052 | 3300060353 | Bacteria | 761 |
| 1756 | Ga0501082_1780991 | 3300060353 | Bacteria | 537 |
| 1757 | Ga0530510_0001780 | 3300061734 | Bacteria | 14689 |
| 1758 | Ga0530510_0001988 | 3300061734 | Bacteria | 14024 |
| 1759 | Ga0530510_0018377 | 3300061734 | Unclassified | 4957 |
| 1760 | Ga0530510_0225442 | 3300061734 | Bacteria | 1394 |
| 1761 | Ga0530510_0341993 | 3300061734 | Bacteria | 1123 |
| 1762 | Ga0530510_0438268 | 3300061734 | Unclassified | 987 |
| 1763 | Ga0530510_0640768 | 3300061734 | Bacteria | 809 |
| 1764 | Ga0530510_0649331 | 3300061734 | Bacteria | 803 |
| 1765 | Ga0530510_0806683 | 3300061734 | Bacteria | 716 |
| 1766 | Ga0530510_0863117 | 3300061734 | Unclassified | 691 |
| 1767 | Ga0451807_2680370 | |||
| 1768 | ARcpr5yngRDRAFT_c013371 | |||
| 1769 | JGI24739J22299_10189834 | |||
| 1770 | JGI24750J21931_1005644 | |||
| 1771 | JGI24745J21846_1045819 | |||
| 1772 | JGI24748J21848_1039180 | |||
| 1773 | JGI24749J21850_1022447 | |||
| 1774 | JGI24751J29686_10036310 | |||
| 1775 | Ga0058863_11932409 | |||
| 1776 | Ga0065704_10123446 | |||
| 1777 | Ga0065704_10181414 | |||
| 1778 | Ga0065704_10705596 | |||
| 1779 | Ga0065712_10022428 | |||
| 1780 | Ga0065712_10051606 | |||
| 1781 | Ga0065712_10072906 | |||
| 1782 | Ga0065712_10284836 | |||
| 1783 | Ga0065712_10307811 | |||
| 1784 | Ga0065712_10312330 | |||
| 1785 | Ga0065712_10358855 | |||
| 1786 | Ga0065712_10420257 | |||
| 1787 | Ga0065712_10587368 | |||
| 1788 | Ga0065712_10725601 | |||
| 1789 | Ga0065715_10097777 | |||
| 1790 | Ga0065715_10191708 | |||
| 1791 | Ga0065715_10370516 | |||
| 1792 | Ga0065715_10406936 | |||
| 1793 | Ga0065715_10497280 | |||
| 1794 | Ga0065715_10868974 | |||
| 1795 | Ga0065715_11158852 | |||
| 1796 | Ga0065707_10005876 | |||
| 1797 | Ga0065707_10009901 | |||
| 1798 | Ga0065707_10149926 | |||
| 1799 | Ga0065707_10155199 | |||
| 1800 | Ga0065707_10176388 | |||
| 1801 | Ga0065707_10309646 | |||
| 1802 | Ga0065707_10456554 | |||
| 1803 | Ga0065707_10490249 | |||
| 1804 | Ga0070676_10055794 | |||
| 1805 | Ga0070676_10366078 | |||
| 1806 | Ga0070676_10465465 | |||
| 1807 | Ga0070676_10636259 | |||
| 1808 | Ga0070676_10886955 | |||
| 1809 | Ga0070683_100083153 | |||
| 1810 | Ga0070683_102261996 | |||
| 1811 | Ga0070690_100004426 | |||
| 1812 | Ga0070690_100024878 | |||
| 1813 | Ga0070690_100031293 | |||
| 1814 | Ga0070690_100078050 | |||
| 1815 | Ga0070690_100217284 | |||
| 1816 | Ga0070690_100805614 | |||
| 1817 | Ga0070690_100947732 | |||
| 1818 | Ga0070670_100010332 | |||
| 1819 | Ga0070670_100021798 | |||
| 1820 | Ga0070670_100067562 | |||
| 1821 | Ga0070670_100138925 | |||
| 1822 | Ga0070670_100145557 | |||
| 1823 | Ga0070670_100206851 | |||
| 1824 | Ga0070670_100215657 | |||
| 1825 | Ga0070670_100257732 | |||
| 1826 | Ga0070670_100561449 | |||
| 1827 | Ga0070670_100908009 | |||
| 1828 | Ga0070670_101035724 | |||
| 1829 | Ga0070677_10000884 | |||
| 1830 | Ga0070677_10018427 | |||
| 1831 | Ga0070677_10171655 | |||
| 1832 | Ga0070677_10246799 | |||
| 1833 | Ga0070677_10333486 | |||
| 1834 | Ga0070677_10767286 | |||
| 1835 | Ga0068869_100001834 | |||
| 1836 | Ga0068869_100016747 | |||
| 1837 | Ga0068869_100035043 | |||
| 1838 | Ga0068869_100074252 | |||
| 1839 | Ga0068869_100112130 | |||
| 1840 | Ga0068869_100195197 | |||
| 1841 | Ga0068869_100419506 | |||
| 1842 | Ga0068869_100610616 | |||
| 1843 | Ga0068869_100632074 | |||
| 1844 | Ga0068869_101006269 | |||
| 1845 | Ga0070666_10007259 | |||
| 1846 | Ga0070666_10055453 | |||
| 1847 | Ga0070666_10122016 | |||
| 1848 | Ga0070680_100038026 | |||
| 1849 | Ga0070680_100262987 | |||
| 1850 | Ga0070680_100316919 | |||
| 1851 | Ga0070680_100613790 | |||
| 1852 | Ga0070682_100074373 | |||
| 1853 | Ga0070682_100399590 | |||
| 1854 | Ga0070682_100479706 | |||
| 1855 | Ga0068868_100005344 | |||
| 1856 | Ga0068868_100105464 | |||
| 1857 | Ga0068868_100276025 | |||
| 1858 | Ga0068868_100811086 | |||
| 1859 | Ga0068868_101236692 | |||
| 1860 | Ga0070660_101053646 | |||
| 1861 | Ga0070689_100018035 | |||
| 1862 | Ga0070689_100053398 | |||
| 1863 | Ga0070689_100163068 | |||
| 1864 | Ga0070689_100383040 | |||
| 1865 | Ga0070689_100757329 | |||
| 1866 | Ga0070689_100759053 | |||
| 1867 | Ga0070691_10060648 | |||
| 1868 | Ga0070691_10616899 | |||
| 1869 | Ga0070691_10783735 | |||
| 1870 | Ga0070687_100008085 | |||
| 1871 | Ga0070687_100028758 | |||
| 1872 | Ga0070687_100047930 | |||
| 1873 | Ga0070687_100187908 | |||
| 1874 | Ga0070687_100507436 | |||
| 1875 | Ga0070687_100621441 | |||
| 1876 | Ga0070661_100003293 | |||
| 1877 | Ga0070661_100065094 | |||
| 1878 | Ga0070661_100299993 | |||
| 1879 | Ga0070661_100441860 | |||
| 1880 | Ga0070661_101061208 | |||
| 1881 | Ga0070661_101556266 | |||
| 1882 | Ga0070692_10032075 | |||
| 1883 | Ga0070692_10174014 | |||
| 1884 | Ga0070692_10360788 | |||
| 1885 | Ga0070692_11045566 | |||
| 1886 | Ga0070668_100016902 | |||
| 1887 | Ga0070668_100020560 | |||
| 1888 | Ga0070668_100114614 | |||
| 1889 | Ga0070668_100518597 | |||
| 1890 | Ga0070668_100936212 | |||
| 1891 | Ga0070668_102128561 | |||
| 1892 | Ga0070669_100006473 | |||
| 1893 | Ga0070669_100075588 | |||
| 1894 | Ga0070669_100106995 | |||
| 1895 | Ga0070669_100234238 | |||
| 1896 | Ga0070669_100436878 | |||
| 1897 | Ga0070669_100829868 | |||
| 1898 | Ga0070669_101016108 | |||
| 1899 | Ga0070675_100002608 | |||
| 1900 | Ga0070675_100032679 | |||
| 1901 | Ga0070675_100076918 | |||
| 1902 | Ga0070675_100113663 | |||
| 1903 | Ga0070675_100132260 | |||
| 1904 | Ga0070675_100191156 | |||
| 1905 | Ga0070675_100195388 | |||
| 1906 | Ga0070675_100240873 | |||
| 1907 | Ga0070675_100292474 | |||
| 1908 | Ga0070675_100569030 | |||
| 1909 | Ga0070675_100783741 | |||
| 1910 | Ga0070675_100816705 | |||
| 1911 | Ga0070675_101188934 | |||
| 1912 | Ga0070675_101211555 | |||
| 1913 | Ga0070675_101618484 | |||
| 1914 | Ga0070671_100040632 | |||
| 1915 | Ga0070671_100136584 | |||
| 1916 | Ga0070671_100184331 | |||
| 1917 | Ga0070671_100265156 | |||
| 1918 | Ga0070671_100775060 | |||
| 1919 | Ga0070674_100203861 | |||
| 1920 | Ga0070674_100385609 | |||
| 1921 | Ga0070674_100454843 | |||
| 1922 | Ga0070674_100524896 | |||
| 1923 | Ga0070674_100863699 | |||
| 1924 | Ga0070674_101237510 | |||
| 1925 | Ga0070674_101484658 | |||
| 1926 | Ga0070674_101719120 | |||
| 1927 | Ga0070673_100007144 | |||
| 1928 | Ga0070673_100046488 | |||
| 1929 | Ga0070673_100123040 | |||
| 1930 | Ga0070673_100129990 | |||
| 1931 | Ga0070673_100173104 | |||
| 1932 | Ga0070673_100252368 | |||
| 1933 | Ga0070673_100397622 | |||
| 1934 | Ga0070673_100464947 | |||
| 1935 | Ga0070673_100506564 | |||
| 1936 | Ga0070673_100865848 | |||
| 1937 | Ga0070673_100875310 | |||
| 1938 | Ga0070673_101385688 | |||
| 1939 | Ga0070688_100013286 | |||
| 1940 | Ga0070688_100031261 | |||
| 1941 | Ga0070688_100044774 | |||
| 1942 | Ga0070688_100102851 | |||
| 1943 | Ga0070688_100120357 | |||
| 1944 | Ga0070688_100142136 | |||
| 1945 | Ga0070688_100186678 | |||
| 1946 | Ga0070688_100760263 | |||
| 1947 | Ga0070688_101223791 | |||
| 1948 | Ga0070659_100114324 | |||
| 1949 | Ga0070659_100135095 | |||
| 1950 | Ga0070659_100357828 | |||
| 1951 | Ga0070659_100470646 | |||
| 1952 | Ga0070659_100997148 | |||
| 1953 | Ga0070659_101211509 | |||
| 1954 | Ga0070667_100182205 | |||
| 1955 | Ga0070667_100270530 | |||
| 1956 | Ga0070667_100272075 | |||
| 1957 | Ga0070667_100707800 | |||
| 1958 | Ga0070667_101857765 | |||
| 1959 | Ga0070703_10016665 | |||
| 1960 | Ga0070703_10203076 | |||
| 1961 | Ga0070703_10280877 | |||
| 1962 | Ga0070713_100848750 | |||
| 1963 | Ga0070701_10009628 | |||
| 1964 | Ga0070701_10045217 | |||
| 1965 | Ga0070701_10082718 | |||
| 1966 | Ga0070701_10083747 | |||
| 1967 | Ga0070701_10186172 | |||
| 1968 | Ga0070701_10521090 | |||
| 1969 | Ga0070701_10587751 | |||
| 1970 | Ga0070705_100000353 | |||
| 1971 | Ga0070705_100008965 | |||
| 1972 | Ga0070705_100029016 | |||
| 1973 | Ga0070705_100079069 | |||
| 1974 | Ga0070705_100144556 | |||
| 1975 | Ga0070705_100791174 | |||
| 1976 | Ga0070705_100930933 | |||
| 1977 | Ga0070705_101050257 | |||
| 1978 | Ga0070700_100032037 | |||
| 1979 | Ga0070700_100098789 | |||
| 1980 | Ga0070700_100218161 | |||
| 1981 | Ga0070700_100393770 | |||
| 1982 | Ga0070700_100506595 | |||
| 1983 | Ga0070700_100684244 | |||
| 1984 | Ga0070700_100733301 | |||
| 1985 | Ga0070700_101044979 | |||
| 1986 | Ga0070700_101107382 | |||
| 1987 | Ga0070700_101202054 | |||
| 1988 | Ga0070700_101325164 | |||
| 1989 | Ga0070694_100001728 | |||
| 1990 | Ga0070694_100008513 | |||
| 1991 | Ga0070694_100010015 | |||
| 1992 | Ga0070694_100082599 | |||
| 1993 | Ga0070694_100375284 | |||
| 1994 | Ga0070694_100820701 | |||
| 1995 | Ga0070708_100071937 | |||
| 1996 | Ga0070708_100135240 | |||
| 1997 | Ga0070708_100305645 | |||
| 1998 | Ga0070708_100675580 | |||
| 1999 | Ga0070708_100708629 | |||
| 2000 | Ga0070663_100084753 | |||
| 2001 | Ga0070663_100737867 | |||
| 2002 | Ga0070663_100855807 | |||
| 2003 | Ga0070663_101759492 | |||
| 2004 | Ga0070678_100041874 | |||
| 2005 | Ga0070678_100065613 | |||
| 2006 | Ga0070678_100099831 | |||
| 2007 | Ga0070678_100106736 | |||
| 2008 | Ga0070678_100219733 | |||
| 2009 | Ga0070678_101533113 | |||
| 2010 | Ga0070678_101602946 | |||
| 2011 | Ga0070678_101644769 | |||
| 2012 | Ga0070678_102209454 | |||
| 2013 | Ga0070662_100006426 | |||
| 2014 | Ga0070662_100019273 | |||
| 2015 | Ga0070662_100046389 | |||
| 2016 | Ga0070662_100125965 | |||
| 2017 | Ga0070662_100710678 | |||
| 2018 | Ga0070681_10002446 | |||
| 2019 | Ga0070681_10217991 | |||
| 2020 | Ga0070681_10735226 | |||
| 2021 | Ga0068867_100019216 | |||
| 2022 | Ga0068867_100063872 | |||
| 2023 | Ga0068867_100129518 | |||
| 2024 | Ga0068867_100435637 | |||
| 2025 | Ga0068867_100759648 | |||
| 2026 | Ga0070685_10015733 | |||
| 2027 | Ga0070685_10031142 | |||
| 2028 | Ga0070685_10050188 | |||
| 2029 | Ga0070685_10203579 | |||
| 2030 | Ga0070685_10399757 | |||
| 2031 | Ga0070685_10440110 | |||
| 2032 | Ga0070685_10534829 | |||
| 2033 | Ga0070706_100169304 | |||
| 2034 | Ga0070706_100555807 | |||
| 2035 | Ga0070706_101801291 | |||
| 2036 | Ga0070707_100201317 | |||
| 2037 | Ga0070707_100289816 | |||
| 2038 | Ga0070707_101337589 | |||
| 2039 | Ga0070707_101439161 | |||
| 2040 | Ga0070707_101627374 | |||
| 2041 | Ga0070698_100005270 | |||
| 2042 | Ga0070698_100029738 | |||
| 2043 | Ga0070698_100100980 | |||
| 2044 | Ga0070698_100153539 | |||
| 2045 | Ga0070698_100583610 | |||
| 2046 | Ga0070698_100623961 | |||
| 2047 | Ga0070698_100976120 | |||
| 2048 | Ga0070698_101260595 | |||
| 2049 | Ga0070698_101566007 | |||
| 2050 | Ga0070699_100003285 | |||
| 2051 | Ga0070699_100007386 | |||
| 2052 | Ga0070699_100022796 | |||
| 2053 | Ga0070699_100525976 | |||
| 2054 | Ga0070699_100629527 | |||
| 2055 | Ga0070679_100597545 | |||
| 2056 | Ga0070679_101518941 | |||
| 2057 | Ga0070684_100099393 | |||
| 2058 | Ga0070684_100175655 | |||
| 2059 | Ga0070684_100748943 | |||
| 2060 | Ga0070684_101215353 | |||
| 2061 | Ga0070697_100084866 | |||
| 2062 | Ga0070697_100313326 | |||
| 2063 | Ga0070697_101935200 | |||
| 2064 | Ga0068853_101085069 | |||
| 2065 | Ga0070672_100006955 | |||
| 2066 | Ga0070672_100009505 | |||
| 2067 | Ga0070672_100043637 | |||
| 2068 | Ga0070672_100043840 | |||
| 2069 | Ga0070672_100061587 | |||
| 2070 | Ga0070672_100621509 | |||
| 2071 | Ga0070672_100977589 | |||
| 2072 | Ga0070672_101023322 | |||
| 2073 | Ga0070672_101504782 | |||
| 2074 | Ga0070686_100006474 | |||
| 2075 | Ga0070686_100045869 | |||
| 2076 | Ga0070686_100345857 | |||
| 2077 | Ga0070686_100375750 | |||
| 2078 | Ga0070686_100627161 | |||
| 2079 | Ga0070686_101071031 | |||
| 2080 | Ga0070686_101165057 | |||
| 2081 | Ga0070695_100003268 | |||
| 2082 | Ga0070695_100020676 | |||
| 2083 | Ga0070695_100060865 | |||
| 2084 | Ga0070695_100306956 | |||
| 2085 | Ga0070696_100000751 | |||
| 2086 | Ga0070696_100013141 | |||
| 2087 | Ga0070696_100039033 | |||
| 2088 | Ga0070696_100120202 | |||
| 2089 | Ga0070696_100172919 | |||
| 2090 | Ga0070696_100406628 | |||
| 2091 | Ga0070696_100673499 | |||
| 2092 | Ga0070696_101002298 | |||
| 2093 | Ga0070696_101005789 | |||
| 2094 | Ga0070693_100032579 | |||
| 2095 | Ga0070665_100090893 | |||
| 2096 | Ga0070665_100252021 | |||
| 2097 | Ga0070665_101023731 | |||
| 2098 | Ga0070665_101691191 | |||
| 2099 | Ga0070704_100002185 | |||
| 2100 | Ga0070704_100014281 | |||
| 2101 | Ga0070704_100047016 | |||
| 2102 | Ga0070704_100073926 | |||
| 2103 | Ga0070704_100075821 | |||
| 2104 | Ga0070704_100115315 | |||
| 2105 | Ga0070704_100175061 | |||
| 2106 | Ga0070704_100223686 | |||
| 2107 | Ga0070704_100354916 | |||
| 2108 | Ga0070704_100717534 | |||
| 2109 | Ga0070704_101547348 | |||
| 2110 | Ga0068855_100621950 | |||
| 2111 | Ga0070664_100018194 | |||
| 2112 | Ga0070664_100039531 | |||
| 2113 | Ga0070664_100053084 | |||
| 2114 | Ga0070664_100175999 | |||
| 2115 | Ga0070664_100272927 | |||
| 2116 | Ga0070664_100363263 | |||
| 2117 | Ga0070664_100476796 | |||
| 2118 | Ga0070664_100591079 | |||
| 2119 | Ga0070664_100722184 | |||
| 2120 | Ga0070664_101082640 | |||
| 2121 | Ga0070664_101381278 | |||
| 2122 | Ga0068857_100202629 | |||
| 2123 | Ga0068857_100326042 | |||
| 2124 | Ga0068857_100544462 | |||
| 2125 | Ga0068857_101196268 | |||
| 2126 | Ga0068854_100058261 | |||
| 2127 | Ga0068856_100182009 | |||
| 2128 | Ga0070702_100057017 | |||
| 2129 | Ga0070702_100696521 | |||
| 2130 | Ga0070702_101201197 | |||
| 2131 | Ga0068852_100025184 | |||
| 2132 | Ga0068852_100051784 | |||
| 2133 | Ga0068852_100582464 | |||
| 2134 | Ga0068852_100761046 | |||
| 2135 | Ga0068859_100006095 | |||
| 2136 | Ga0068859_100039000 | |||
| 2137 | Ga0068859_100045758 | |||
| 2138 | Ga0068859_100089189 | |||
| 2139 | Ga0068859_100117279 | |||
| 2140 | Ga0068859_100186560 | |||
| 2141 | Ga0068859_100549484 | |||
| 2142 | Ga0068859_100813849 | |||
| 2143 | Ga0068859_100816269 | |||
| 2144 | Ga0068859_101009129 | |||
| 2145 | Ga0068859_101535945 | |||
| 2146 | Ga0068859_101572149 | |||
| 2147 | Ga0068859_101673644 | |||
| 2148 | Ga0068864_100047439 | |||
| 2149 | Ga0068864_100102782 | |||
| 2150 | Ga0068864_100197663 | |||
| 2151 | Ga0068864_100305474 | |||
| 2152 | Ga0068864_100356891 | |||
| 2153 | Ga0068864_100618902 | |||
| 2154 | Ga0068864_100765314 | |||
| 2155 | Ga0068864_100930031 | |||
| 2156 | Ga0068864_102178903 | |||
| 2157 | Ga0068864_102451046 | |||
| 2158 | Ga0068866_10011566 | |||
| 2159 | Ga0068866_10559458 | |||
| 2160 | Ga0068866_11035447 | |||
| 2161 | Ga0068861_100012791 | |||
| 2162 | Ga0068861_100032640 | |||
| 2163 | Ga0068861_100359379 | |||
| 2164 | Ga0068861_100487645 | |||
| 2165 | Ga0068861_100646235 | |||
| 2166 | Ga0068861_100946562 | |||
| 2167 | Ga0068861_102032757 | |||
| 2168 | Ga0068851_10130199 | |||
| 2169 | Ga0068870_10013998 | |||
| 2170 | Ga0068870_10018525 | |||
| 2171 | Ga0068870_10080772 | |||
| 2172 | Ga0068870_10396623 | |||
| 2173 | Ga0068870_10477245 | |||
| 2174 | Ga0068870_10544109 | |||
| 2175 | Ga0068870_10590487 | |||
| 2176 | Ga0068870_10955347 | |||
| 2177 | Ga0068870_11361482 | |||
| 2178 | Ga0068863_100002899 | |||
| 2179 | Ga0068863_100025702 | |||
| 2180 | Ga0068863_100046141 | |||
| 2181 | Ga0068863_100124010 | |||
| 2182 | Ga0068863_101007924 | |||
| 2183 | Ga0068858_100007484 | |||
| 2184 | Ga0068858_100018524 | |||
| 2185 | Ga0068858_100052461 | |||
| 2186 | Ga0068858_100192947 | |||
| 2187 | Ga0068858_100641104 | |||
| 2188 | Ga0068858_101377077 | |||
| 2189 | Ga0068860_100014383 | |||
| 2190 | Ga0068860_100038249 | |||
| 2191 | Ga0068860_100059770 | |||
| 2192 | Ga0068860_100185323 | |||
| 2193 | Ga0068860_100623832 | |||
| 2194 | Ga0068860_101003170 | |||
| 2195 | Ga0068860_101200032 | |||
| 2196 | Ga0068862_100002073 | |||
| 2197 | Ga0068862_100008919 | |||
| 2198 | Ga0068862_100025434 | |||
| 2199 | Ga0068862_100111241 | |||
| 2200 | Ga0068862_100186842 | |||
| 2201 | Ga0068862_100704301 | |||
| 2202 | Ga0068862_100705369 | |||
| 2203 | Ga0068862_100922615 | |||
| 2204 | Ga0068862_101052701 | |||
| 2205 | Ga0068862_101221321 | |||
| 2206 | Ga0081538_10151793 | |||
| 2207 | Ga0081539_10000291 | |||
| 2208 | Ga0081539_10000295 | |||
| 2209 | Ga0081539_10006823 | |||
| 2210 | Ga0081539_10079711 | |||
| 2211 | Ga0070717_10631548 | |||
| 2212 | Ga0075368_10016927 | |||
| 2213 | Ga0075363_100212204 | |||
| 2214 | Ga0075364_11206725 | |||
| 2215 | Ga0070716_100271392 | |||
| 2216 | Ga0070712_100606567 | |||
| 2217 | Ga0075367_10008193 | |||
| 2218 | Ga0075367_10703668 | |||
| 2219 | Ga0075427_10026819 | |||
| 2220 | Ga0075366_10018803 | |||
| 2221 | Ga0075366_10590950 | |||
| 2222 | Ga0097621_100439385 | |||
| 2223 | Ga0097621_100800049 | |||
| 2224 | Ga0097621_100910532 | |||
| 2225 | Ga0068871_100159793 | |||
| 2226 | Ga0068871_100233077 | |||
| 2227 | Ga0068871_100310837 | |||
| 2228 | Ga0068871_101051709 | |||
| 2229 | Ga0068871_101120908 | |||
| 2230 | Ga0068871_101368067 | |||
| 2231 | Ga0068871_101643937 | |||
| 2232 | Ga0075428_100001205 | |||
| 2233 | Ga0075428_100011446 | |||
| 2234 | Ga0075428_100012226 | |||
| 2235 | Ga0075428_100021842 | |||
| 2236 | Ga0075428_100030863 | |||
| 2237 | Ga0075428_100042724 | |||
| 2238 | Ga0075428_100113028 | |||
| 2239 | Ga0075428_100315122 | |||
| 2240 | Ga0075428_100523099 | |||
| 2241 | Ga0075428_101279983 | |||
| 2242 | Ga0075428_102510936 | |||
| 2243 | Ga0075430_100063682 | |||
| 2244 | Ga0075430_100089047 | |||
| 2245 | Ga0075430_100127878 | |||
| 2246 | Ga0075430_100188316 | |||
| 2247 | Ga0075430_100193055 | |||
| 2248 | Ga0075430_100206542 | |||
| 2249 | Ga0075430_100212369 | |||
| 2250 | Ga0075430_100251135 | |||
| 2251 | Ga0075430_100290736 | |||
| 2252 | Ga0075430_100327315 | |||
| 2253 | Ga0075430_100441278 | |||
| 2254 | Ga0075430_100460028 | |||
| 2255 | Ga0075430_100688712 | |||
| 2256 | Ga0075431_100005109 | |||
| 2257 | Ga0075431_100010681 | |||
| 2258 | Ga0075431_100018733 | |||
| 2259 | Ga0075431_100053307 | |||
| 2260 | Ga0075431_100068317 | |||
| 2261 | Ga0075431_100102439 | |||
| 2262 | Ga0075431_100183629 | |||
| 2263 | Ga0075431_100428397 | |||
| 2264 | Ga0075431_100484231 | |||
| 2265 | Ga0075431_100579921 | |||
| 2266 | Ga0075431_100661215 | |||
| 2267 | Ga0075431_100671892 | |||
| 2268 | Ga0075431_100747466 | |||
| 2269 | Ga0075431_100850090 | |||
| 2270 | Ga0075431_101075246 | |||
| 2271 | Ga0075433_10001675 | |||
| 2272 | Ga0075433_10001688 | |||
| 2273 | Ga0075433_10018246 | |||
| 2274 | Ga0075433_10042019 | |||
| 2275 | Ga0075433_10050964 | |||
| 2276 | Ga0075433_10055219 | |||
| 2277 | Ga0075433_10069629 | |||
| 2278 | Ga0075433_10129709 | |||
| 2279 | Ga0075433_10243939 | |||
| 2280 | Ga0075433_10348333 | |||
| 2281 | Ga0075433_10526575 | |||
| 2282 | Ga0075433_10605558 | |||
| 2283 | Ga0075433_11064861 | |||
| 2284 | Ga0075434_100002545 | |||
| 2285 | Ga0075434_100005218 | |||
| 2286 | Ga0075434_100028400 | |||
| 2287 | Ga0075434_100033741 | |||
| 2288 | Ga0075434_100035306 | |||
| 2289 | Ga0075434_100064826 | |||
| 2290 | Ga0075434_100158188 | |||
| 2291 | Ga0075434_100228243 | |||
| 2292 | Ga0075434_100474284 | |||
| 2293 | Ga0075434_100718790 | |||
| 2294 | Ga0075434_101250246 | |||
| 2295 | Ga0075434_101515317 | |||
| 2296 | Ga0075434_101584952 | |||
| 2297 | Ga0075429_100005715 | |||
| 2298 | Ga0075429_100023129 | |||
| 2299 | Ga0075429_100025834 | |||
| 2300 | Ga0075429_100051940 | |||
| 2301 | Ga0075429_100073043 | |||
| 2302 | Ga0075429_100117682 | |||
| 2303 | Ga0075429_100205088 | |||
| 2304 | Ga0075429_100422501 | |||
| 2305 | Ga0075429_100629963 | |||
| 2306 | Ga0075429_101239515 | |||
| 2307 | Ga0068865_100053704 | |||
| 2308 | Ga0068865_100202386 | |||
| 2309 | Ga0068865_100295905 | |||
| 2310 | Ga0068865_100377330 | |||
| 2311 | Ga0068865_100442578 | |||
| 2312 | Ga0068865_100561968 | |||
| 2313 | Ga0068865_100576935 | |||
| 2314 | Ga0068865_100718063 | |||
| 2315 | Ga0068865_100976064 | |||
| 2316 | Ga0068865_101741953 | |||
| 2317 | Ga0075436_100733731 | |||
| 2318 | Ga0097620_100006095 | |||
| 2319 | Ga0097620_100039000 | |||
| 2320 | Ga0097620_100045760 | |||
| 2321 | Ga0097620_100089193 | |||
| 2322 | Ga0097620_100117285 | |||
| 2323 | Ga0097620_100186561 | |||
| 2324 | Ga0097620_100549460 | |||
| 2325 | Ga0097620_100813782 | |||
| 2326 | Ga0097620_100816270 | |||
| 2327 | Ga0097620_101009298 | |||
| 2328 | Ga0097620_101536739 | |||
| 2329 | Ga0097620_101572300 | |||
| 2330 | Ga0097620_101673356 | |||
| 2331 | Ga0075435_100002880 | |||
| 2332 | Ga0075435_100010137 | |||
| 2333 | Ga0075435_100058881 | |||
| 2334 | Ga0075435_100065154 | |||
| 2335 | Ga0075435_100178693 | |||
| 2336 | Ga0075435_100371504 | |||
| 2337 | Ga0075435_100479813 | |||
| 2338 | Ga0075435_100917712 | |||
| 2339 | Ga0105244_10271737 | |||
| 2340 | Ga0111539_10000542 | |||
| 2341 | Ga0111539_10018201 | |||
| 2342 | Ga0111539_10022938 | |||
| 2343 | Ga0111539_10029838 | |||
| 2344 | Ga0111539_10055826 | |||
| 2345 | Ga0111539_10103964 | |||
| 2346 | Ga0111539_10197442 | |||
| 2347 | Ga0111539_10197900 | |||
| 2348 | Ga0111539_10216760 | |||
| 2349 | Ga0111539_10229720 | |||
| 2350 | Ga0111539_10255737 | |||
| 2351 | Ga0111539_10619556 | |||
| 2352 | Ga0111539_10739421 | |||
| 2353 | Ga0111539_11007936 | |||
| 2354 | Ga0111539_12361096 | |||
| 2355 | Ga0111539_12542578 | |||
| 2356 | Ga0105245_10116409 | |||
| 2357 | Ga0105247_11742608 | |||
| 2358 | Ga0114129_10001659 | |||
| 2359 | Ga0114129_10002530 | |||
| 2360 | Ga0114129_10003888 | |||
| 2361 | Ga0114129_10007226 | |||
| 2362 | Ga0114129_10016436 | |||
| 2363 | Ga0114129_10033249 | |||
| 2364 | Ga0114129_10086038 | |||
| 2365 | Ga0114129_10116266 | |||
| 2366 | Ga0114129_10223067 | |||
| 2367 | Ga0114129_10296290 | |||
| 2368 | Ga0114129_10305021 | |||
| 2369 | Ga0114129_10394086 | |||
| 2370 | Ga0114129_10484547 | |||
| 2371 | Ga0114129_10540513 | |||
| 2372 | Ga0114129_10800058 | |||
| 2373 | Ga0114129_11401400 | |||
| 2374 | Ga0114129_11829108 | |||
| 2375 | Ga0114129_12217607 | |||
| 2376 | Ga0114129_12794571 | |||
| 2377 | Ga0105243_10050813 | |||
| 2378 | Ga0105243_10093757 | |||
| 2379 | Ga0105243_10158402 | |||
| 2380 | Ga0105243_10740098 | |||
| 2381 | Ga0105243_11607989 | |||
| 2382 | Ga0105243_11969344 | |||
| 2383 | Ga0105243_12028349 | |||
| 2384 | Ga0105241_10327782 | |||
| 2385 | Ga0105242_10065331 | |||
| 2386 | Ga0105242_10244483 | |||
| 2387 | Ga0105242_11084179 | |||
| 2388 | Ga0105242_12831945 | |||
| 2389 | Ga0105242_12833620 | |||
| 2390 | Ga0105248_10016814 | |||
| 2391 | Ga0105248_10051872 | |||
| 2392 | Ga0105248_10199006 | |||
| 2393 | Ga0105248_10346905 | |||
| 2394 | Ga0105248_10350036 | |||
| 2395 | Ga0105248_10396219 | |||
| 2396 | Ga0105248_10499315 | |||
| 2397 | Ga0105248_10977960 | |||
| 2398 | Ga0105248_12605035 | |||
| 2399 | Ga0105238_10700108 | |||
| 2400 | Ga0105249_10000672 | |||
| 2401 | Ga0105249_10001821 | |||
| 2402 | Ga0105249_10018156 | |||
| 2403 | Ga0105249_10118253 | |||
| 2404 | Ga0105249_10157278 | |||
| 2405 | Ga0105249_10252825 | |||
| 2406 | Ga0105249_10946030 | |||
| 2407 | Ga0105249_11171369 | |||
| 2408 | Ga0105249_11230770 | |||
| 2409 | Ga0105249_11285126 | |||
| 2410 | Ga0105249_12553917 | |||
| 2411 | Ga0105239_10799423 | |||
| 2412 | Ga0105246_10364554 | |||
| 2413 | Ga0105246_10681296 | |||
| 2414 | Ga0157321_1003202 | |||
| 2415 | Ga0157313_1032810 | |||
| 2416 | Ga0157373_10850033 | |||
| 2417 | Ga0157374_10185254 | |||
| 2418 | Ga0157374_11254284 | |||
| 2419 | Ga0157378_10137274 | |||
| 2420 | Ga0157378_10158732 | |||
| 2421 | Ga0157378_10513867 | |||
| 2422 | Ga0163162_10007803 | |||
| 2423 | Ga0163162_10033381 | |||
| 2424 | Ga0163162_10087199 | |||
| 2425 | Ga0163162_12395422 | |||
| 2426 | Ga0157372_10077056 | |||
| 2427 | Ga0157375_10011615 | |||
| 2428 | Ga0157375_10015562 | |||
| 2429 | Ga0157375_10166603 | |||
| 2430 | Ga0157375_10320781 | |||
| 2431 | Ga0157375_10397378 | |||
| 2432 | Ga0157375_10422420 | |||
| 2433 | Ga0157375_11005624 | |||
| 2434 | Ga0163163_10000005 | |||
| 2435 | Ga0163163_10098812 | |||
| 2436 | Ga0163163_10247540 | |||
| 2437 | Ga0163163_10569774 | |||
| 2438 | Ga0163163_11206194 | |||
| 2439 | Ga0163163_11691809 | |||
| 2440 | Ga0163163_12133385 | |||
| 2441 | Ga0157380_10067669 | |||
| 2442 | Ga0157380_10166625 | |||
| 2443 | Ga0157380_10196563 | |||
| 2444 | Ga0157380_10236903 | |||
| 2445 | Ga0157380_10252800 | |||
| 2446 | Ga0157380_10311064 | |||
| 2447 | Ga0157380_10412115 | |||
| 2448 | Ga0157380_10437948 | |||
| 2449 | Ga0157380_10458235 | |||
| 2450 | Ga0157380_10539319 | |||
| 2451 | Ga0157380_10631087 | |||
| 2452 | Ga0157380_10663926 | |||
| 2453 | Ga0157380_10843307 | |||
| 2454 | Ga0157377_10042179 | |||
| 2455 | Ga0157377_10044023 | |||
| 2456 | Ga0157377_10096840 | |||
| 2457 | Ga0157377_10117014 | |||
| 2458 | Ga0157377_10171699 | |||
| 2459 | Ga0157377_10449125 | |||
| 2460 | Ga0157379_10013361 | |||
| 2461 | Ga0157379_10392981 | |||
| 2462 | Ga0157379_11528393 | |||
| 2463 | Ga0157376_10051020 | |||
| 2464 | Ga0157376_10083020 | |||
| 2465 | Ga0157376_10362594 | |||
| 2466 | Ga0157376_10415068 | |||
| 2467 | Ga0157376_10475218 | |||
| 2468 | Ga0157376_10844177 | |||
| 2469 | Ga0182007_10407725 | |||
| 2470 | Ga0163161_10114895 | |||
| 2471 | Ga0163161_10488411 | |||
| 2472 | Ga0207666_1006342 | |||
| 2473 | Ga0207673_1001644 | |||
| 2474 | Ga0207697_10000027 | |||
| 2475 | Ga0207697_10027070 | |||
| 2476 | Ga0207697_10046882 | |||
| 2477 | Ga0207697_10140340 | |||
| 2478 | Ga0207697_10306687 | |||
| 2479 | Ga0207656_10133562 | |||
| 2480 | Ga0207653_10040120 | |||
| 2481 | Ga0207653_10213155 | |||
| 2482 | Ga0207682_10004644 | |||
| 2483 | Ga0207682_10008666 | |||
| 2484 | Ga0207682_10016389 | |||
| 2485 | Ga0207682_10243992 | |||
| 2486 | Ga0207682_10250462 | |||
| 2487 | Ga0207682_10256282 | |||
| 2488 | Ga0207682_10317813 | |||
| 2489 | Ga0207682_10345322 | |||
| 2490 | Ga0207642_10061947 | |||
| 2491 | Ga0207642_10258510 | |||
| 2492 | Ga0207688_10000041 | |||
| 2493 | Ga0207688_10028006 | |||
| 2494 | Ga0207688_10134788 | |||
| 2495 | Ga0207688_10237014 | |||
| 2496 | Ga0207688_10796349 | |||
| 2497 | Ga0207688_10917629 | |||
| 2498 | Ga0207680_10020405 | |||
| 2499 | Ga0207680_10023926 | |||
| 2500 | Ga0207680_10293039 | |||
| 2501 | Ga0207647_10025156 | |||
| 2502 | Ga0207647_10370539 | |||
| 2503 | Ga0207645_10000227 | |||
| 2504 | Ga0207645_10002713 | |||
| 2505 | Ga0207645_10205039 | |||
| 2506 | Ga0207645_10307239 | |||
| 2507 | Ga0207645_10327622 | |||
| 2508 | Ga0207645_11235142 | |||
| 2509 | Ga0207643_10005161 | |||
| 2510 | Ga0207643_10023237 | |||
| 2511 | Ga0207643_10038219 | |||
| 2512 | Ga0207643_10092900 | |||
| 2513 | Ga0207643_10195992 | |||
| 2514 | Ga0207643_10234962 | |||
| 2515 | Ga0207643_10411311 | |||
| 2516 | Ga0207643_10793075 | |||
| 2517 | Ga0207643_10919221 | |||
| 2518 | Ga0207643_10935585 | |||
| 2519 | Ga0207684_10095825 | |||
| 2520 | Ga0207684_10220997 | |||
| 2521 | Ga0207684_10518557 | |||
| 2522 | Ga0207684_10920302 | |||
| 2523 | Ga0207684_11023530 | |||
| 2524 | Ga0207654_10158211 | |||
| 2525 | Ga0207707_10030021 | |||
| 2526 | Ga0207693_10032205 | |||
| 2527 | Ga0207693_10741698 | |||
| 2528 | Ga0207660_10166418 | |||
| 2529 | Ga0207660_10184365 | |||
| 2530 | Ga0207660_10384042 | |||
| 2531 | Ga0207660_10451738 | |||
| 2532 | Ga0207660_11460858 | |||
| 2533 | Ga0207662_10003200 | |||
| 2534 | Ga0207662_10030980 | |||
| 2535 | Ga0207662_10156944 | |||
| 2536 | Ga0207662_10160812 | |||
| 2537 | Ga0207662_10194251 | |||
| 2538 | Ga0207662_10237935 | |||
| 2539 | Ga0207662_10470489 | |||
| 2540 | Ga0207657_10295678 | |||
| 2541 | Ga0207657_10798209 | |||
| 2542 | Ga0207649_10018539 | |||
| 2543 | Ga0207649_10157926 | |||
| 2544 | Ga0207649_10601098 | |||
| 2545 | Ga0207649_10639142 | |||
| 2546 | Ga0207652_10189796 | |||
| 2547 | Ga0207646_10120102 | |||
| 2548 | Ga0207646_10166324 | |||
| 2549 | Ga0207646_10288753 | |||
| 2550 | Ga0207646_10390394 | |||
| 2551 | Ga0207646_11755045 | |||
| 2552 | Ga0207681_10003610 | |||
| 2553 | Ga0207681_10010850 | |||
| 2554 | Ga0207681_10153791 | |||
| 2555 | Ga0207681_10253884 | |||
| 2556 | Ga0207681_10390341 | |||
| 2557 | Ga0207681_10534268 | |||
| 2558 | Ga0207681_10958236 | |||
| 2559 | Ga0207681_11087563 | |||
| 2560 | Ga0207681_11486801 | |||
| 2561 | Ga0207694_11386903 | |||
| 2562 | Ga0207650_10028707 | |||
| 2563 | Ga0207650_10060265 | |||
| 2564 | Ga0207650_10141949 | |||
| 2565 | Ga0207650_10194492 | |||
| 2566 | Ga0207650_10216404 | |||
| 2567 | Ga0207650_10221723 | |||
| 2568 | Ga0207650_10536255 | |||
| 2569 | Ga0207650_10624260 | |||
| 2570 | Ga0207650_10983689 | |||
| 2571 | Ga0207650_11133404 | |||
| 2572 | Ga0207650_11268438 | |||
| 2573 | Ga0207659_10010993 | |||
| 2574 | Ga0207659_10043481 | |||
| 2575 | Ga0207659_10067577 | |||
| 2576 | Ga0207659_10147189 | |||
| 2577 | Ga0207659_10153099 | |||
| 2578 | Ga0207659_10381905 | |||
| 2579 | Ga0207659_10424576 | |||
| 2580 | Ga0207659_10425176 | |||
| 2581 | Ga0207659_10461407 | |||
| 2582 | Ga0207659_10502597 | |||
| 2583 | Ga0207659_10503555 | |||
| 2584 | Ga0207659_10607906 | |||
| 2585 | Ga0207659_10868420 | |||
| 2586 | Ga0207659_11014355 | |||
| 2587 | Ga0207659_11087766 | |||
| 2588 | Ga0207659_11088966 | |||
| 2589 | Ga0207687_10405824 | |||
| 2590 | Ga0207687_10822312 | |||
| 2591 | Ga0207687_10996575 | |||
| 2592 | Ga0207700_10005256 | |||
| 2593 | Ga0207644_10018034 | |||
| 2594 | Ga0207644_10452454 | |||
| 2595 | Ga0207644_10630925 | |||
| 2596 | Ga0207644_11208531 | |||
| 2597 | Ga0207690_10046001 | |||
| 2598 | Ga0207690_10121160 | |||
| 2599 | Ga0207690_10177085 | |||
| 2600 | Ga0207690_10610160 | |||
| 2601 | Ga0207690_10799958 | |||
| 2602 | Ga0207690_11035729 | |||
| 2603 | Ga0207706_10005190 | |||
| 2604 | Ga0207706_10044964 | |||
| 2605 | Ga0207706_10156986 | |||
| 2606 | Ga0207706_10756872 | |||
| 2607 | Ga0207706_11007593 | |||
| 2608 | Ga0207686_10251325 | |||
| 2609 | Ga0207686_10254623 | |||
| 2610 | Ga0207686_10284028 | |||
| 2611 | Ga0207686_10737134 | |||
| 2612 | Ga0207709_10015105 | |||
| 2613 | Ga0207709_10049606 | |||
| 2614 | Ga0207709_11612661 | |||
| 2615 | Ga0207670_10032315 | |||
| 2616 | Ga0207670_10139766 | |||
| 2617 | Ga0207670_10155653 | |||
| 2618 | Ga0207670_10182884 | |||
| 2619 | Ga0207670_10830035 | |||
| 2620 | Ga0207670_11013481 | |||
| 2621 | Ga0207670_11910668 | |||
| 2622 | Ga0207669_10037520 | |||
| 2623 | Ga0207669_10135020 | |||
| 2624 | Ga0207669_10172455 | |||
| 2625 | Ga0207669_10516967 | |||
| 2626 | Ga0207704_10057827 | |||
| 2627 | Ga0207704_10085927 | |||
| 2628 | Ga0207704_10092318 | |||
| 2629 | Ga0207704_10173570 | |||
| 2630 | Ga0207704_10447504 | |||
| 2631 | Ga0207704_10984942 | |||
| 2632 | Ga0207665_10822309 | |||
| 2633 | Ga0207691_10000239 | |||
| 2634 | Ga0207691_10036868 | |||
| 2635 | Ga0207691_10043175 | |||
| 2636 | Ga0207691_10046646 | |||
| 2637 | Ga0207691_10051379 | |||
| 2638 | Ga0207691_10295663 | |||
| 2639 | Ga0207691_10360409 | |||
| 2640 | Ga0207691_10869975 | |||
| 2641 | Ga0207691_11609732 | |||
| 2642 | Ga0207711_10021329 | |||
| 2643 | Ga0207711_10031939 | |||
| 2644 | Ga0207711_10204662 | |||
| 2645 | Ga0207711_10268590 | |||
| 2646 | Ga0207711_10349380 | |||
| 2647 | Ga0207711_10691829 | |||
| 2648 | Ga0207711_11193478 | |||
| 2649 | Ga0207711_12144345 | |||
| 2650 | Ga0207689_10003638 | |||
| 2651 | Ga0207689_10014641 | |||
| 2652 | Ga0207689_10029381 | |||
| 2653 | Ga0207689_10035267 | |||
| 2654 | Ga0207689_10084114 | |||
| 2655 | Ga0207689_10133601 | |||
| 2656 | Ga0207689_10336412 | |||
| 2657 | Ga0207689_10723935 | |||
| 2658 | Ga0207661_11810926 | |||
| 2659 | Ga0207679_10026957 | |||
| 2660 | Ga0207679_10056775 | |||
| 2661 | Ga0207679_10061779 | |||
| 2662 | Ga0207679_10237538 | |||
| 2663 | Ga0207679_10240027 | |||
| 2664 | Ga0207679_10359356 | |||
| 2665 | Ga0207679_10429603 | |||
| 2666 | Ga0207679_10905811 | |||
| 2667 | Ga0207679_11979131 | |||
| 2668 | Ga0207667_10511748 | |||
| 2669 | Ga0207651_10047431 | |||
| 2670 | Ga0207651_10065560 | |||
| 2671 | Ga0207651_10156442 | |||
| 2672 | Ga0207651_10274330 | |||
| 2673 | Ga0207651_10331791 | |||
| 2674 | Ga0207651_10513033 | |||
| 2675 | Ga0207651_10540266 | |||
| 2676 | Ga0207651_10677082 | |||
| 2677 | Ga0207651_10722213 | |||
| 2678 | Ga0207712_10020206 | |||
| 2679 | Ga0207712_10025216 | |||
| 2680 | Ga0207712_10087933 | |||
| 2681 | Ga0207712_10131257 | |||
| 2682 | Ga0207712_10347558 | |||
| 2683 | Ga0207712_10447097 | |||
| 2684 | Ga0207712_11092920 | |||
| 2685 | Ga0207712_11118843 | |||
| 2686 | Ga0207712_11773909 | |||
| 2687 | Ga0207668_10255299 | |||
| 2688 | Ga0207668_10347608 | |||
| 2689 | Ga0207668_10686280 | |||
| 2690 | Ga0207668_10824329 | |||
| 2691 | Ga0207668_11414219 | |||
| 2692 | Ga0207668_11543854 | |||
| 2693 | Ga0207640_10102475 | |||
| 2694 | Ga0207640_10965696 | |||
| 2695 | Ga0207658_10069444 | |||
| 2696 | Ga0207658_10191923 | |||
| 2697 | Ga0207658_10219518 | |||
| 2698 | Ga0207658_10432497 | |||
| 2699 | Ga0207658_10590333 | |||
| 2700 | Ga0207677_10055612 | |||
| 2701 | Ga0207677_10489755 | |||
| 2702 | Ga0207677_10781184 | |||
| 2703 | Ga0207677_11029476 | |||
| 2704 | Ga0207677_11574095 | |||
| 2705 | Ga0207703_10009365 | |||
| 2706 | Ga0207703_10041677 | |||
| 2707 | Ga0207703_10109568 | |||
| 2708 | Ga0207703_10141957 | |||
| 2709 | Ga0207703_10825891 | |||
| 2710 | Ga0207639_10066993 | |||
| 2711 | Ga0207678_10201267 | |||
| 2712 | Ga0207678_10867584 | |||
| 2713 | Ga0207708_10008322 | |||
| 2714 | Ga0207708_10035461 | |||
| 2715 | Ga0207708_10112169 | |||
| 2716 | Ga0207708_10148739 | |||
| 2717 | Ga0207708_10262877 | |||
| 2718 | Ga0207708_10639095 | |||
| 2719 | Ga0207708_10644522 | |||
| 2720 | Ga0207708_10803718 | |||
| 2721 | Ga0207708_10968341 | |||
| 2722 | Ga0207641_10053541 | |||
| 2723 | Ga0207641_10148494 | |||
| 2724 | Ga0207641_10216711 | |||
| 2725 | Ga0207641_10388821 | |||
| 2726 | Ga0207641_11899274 | |||
| 2727 | Ga0207641_12387757 | |||
| 2728 | Ga0207648_10005096 | |||
| 2729 | Ga0207648_10009645 | |||
| 2730 | Ga0207648_10051234 | |||
| 2731 | Ga0207648_10102428 | |||
| 2732 | Ga0207648_10178752 | |||
| 2733 | Ga0207648_10270290 | |||
| 2734 | Ga0207648_10516875 | |||
| 2735 | Ga0207648_10649501 | |||
| 2736 | Ga0207648_10740261 | |||
| 2737 | Ga0207648_11434418 | |||
| 2738 | Ga0207648_12071355 | |||
| 2739 | Ga0207676_10092775 | |||
| 2740 | Ga0207676_10175669 | |||
| 2741 | Ga0207676_10263626 | |||
| 2742 | Ga0207676_10540002 | |||
| 2743 | Ga0207676_11142258 | |||
| 2744 | Ga0207674_10107420 | |||
| 2745 | Ga0207674_10108580 | |||
| 2746 | Ga0207674_10131336 | |||
| 2747 | Ga0207674_10158850 | |||
| 2748 | Ga0207674_10323039 | |||
| 2749 | Ga0207674_11064609 | |||
| 2750 | Ga0207675_100005724 | |||
| 2751 | Ga0207675_100022564 | |||
| 2752 | Ga0207675_100070901 | |||
| 2753 | Ga0207675_100166549 | |||
| 2754 | Ga0207675_100429742 | |||
| 2755 | Ga0207675_100781734 | |||
| 2756 | Ga0207675_101457217 | |||
| 2757 | Ga0207675_101458169 | |||
| 2758 | Ga0207675_102190776 | |||
| 2759 | Ga0207683_10002140 | |||
| 2760 | Ga0207683_10036397 | |||
| 2761 | Ga0207683_10084807 | |||
| 2762 | Ga0207683_10129472 | |||
| 2763 | Ga0207683_10167894 | |||
| 2764 | Ga0207683_10171952 | |||
| 2765 | Ga0207683_10256952 | |||
| 2766 | Ga0207683_10438629 | |||
| 2767 | Ga0207683_10445439 | |||
| 2768 | Ga0207683_11183201 | |||
| 2769 | Ga0207698_10215666 | |||
| 2770 | Ga0207698_10266732 | |||
| 2771 | Ga0207698_10401482 | |||
| 2772 | Ga0207698_10527512 | |||
| 2773 | Ga0207698_10565191 | |||
| 2774 | Ga0209973_1018226 | |||
| 2775 | Ga0209969_1065712 | |||
| 2776 | Ga0209996_1063244 | |||
| 2777 | Ga0210000_1040959 | |||
| 2778 | Ga0209968_1006266 | |||
| 2779 | Ga0209999_1031658 | |||
| 2780 | Ga0209982_1025828 | |||
| 2781 | Ga0209970_1014763 | |||
| 2782 | Ga0210002_1026697 | |||
| 2783 | Ga0209983_1058324 | |||
| 2784 | Ga0209998_10095070 | |||
| 2785 | Ga0209813_10021164 | |||
| 2786 | Ga0209974_10057113 | |||
| 2787 | Ga0209974_10066894 | |||
| 2788 | Ga0207428_10000349 | |||
| 2789 | Ga0207428_10000712 | |||
| 2790 | Ga0207428_10003385 | |||
| 2791 | Ga0207428_10003621 | |||
| 2792 | Ga0207428_10005253 | |||
| 2793 | Ga0207428_10014253 | |||
| 2794 | Ga0207428_10020924 | |||
| 2795 | Ga0207428_10092864 | |||
| 2796 | Ga0207428_10149291 | |||
| 2797 | Ga0207428_10364693 | |||
| 2798 | Ga0207428_10436585 | |||
| 2799 | Ga0207428_10518742 | |||
| 2800 | Ga0207428_10590962 | |||
| 2801 | Ga0207428_10692890 | |||
| 2802 | Ga0268266_11071921 | |||
| 2803 | Ga0268266_11283796 | |||
| 2804 | Ga0268265_10001193 | |||
| 2805 | Ga0268265_10009264 | |||
| 2806 | Ga0268265_10019011 | |||
| 2807 | Ga0268265_10315492 | |||
| 2808 | Ga0268265_10361483 | |||
| 2809 | Ga0268265_10421163 | |||
| 2810 | Ga0268265_10447961 | |||
| 2811 | Ga0268265_10557341 | |||
| 2812 | Ga0268265_10850355 | |||
| 2813 | Ga0268265_10990743 | |||
| 2814 | Ga0268264_10041346 | |||
| 2815 | Ga0268264_10090200 | |||
| 2816 | Ga0268264_10321033 | |||
| 2817 | Ga0268264_10458881 | |||
| 2818 | Ga0268264_10591113 | |||
| 2819 | Ga0316178_1121891 | |||
| 2820 | Ga0316178_1125099 | |||
| 2821 | Ga0307408_100045422 | |||
| 2822 | Ga0307408_100078654 | |||
| 2823 | Ga0307408_100110251 | |||
| 2824 | Ga0307408_100327780 | |||
| 2825 | Ga0307408_100330602 | |||
| 2826 | Ga0307408_100535976 | |||
| 2827 | Ga0307408_100585827 | |||
| 2828 | Ga0307408_100740419 | |||
| 2829 | Ga0307408_100985467 | |||
| 2830 | Ga0307405_10036153 | |||
| 2831 | Ga0307405_10103932 | |||
| 2832 | Ga0307405_10279159 | |||
| 2833 | Ga0307405_10433885 | |||
| 2834 | Ga0307405_10530239 | |||
| 2835 | Ga0307413_10082909 | |||
| 2836 | Ga0307413_10212256 | |||
| 2837 | Ga0307413_10296776 | |||
| 2838 | Ga0307413_10556385 | |||
| 2839 | Ga0307413_10771005 | |||
| 2840 | Ga0307413_11568089 | |||
| 2841 | Ga0307413_11854035 | |||
| 2842 | Ga0307410_10033548 | |||
| 2843 | Ga0307410_10035916 | |||
| 2844 | Ga0307410_10127209 | |||
| 2845 | Ga0307410_10252476 | |||
| 2846 | Ga0307410_10451403 | |||
| 2847 | Ga0307410_10819182 | |||
| 2848 | Ga0307406_10028273 | |||
| 2849 | Ga0307406_10032820 | |||
| 2850 | Ga0307406_10258929 | |||
| 2851 | Ga0307406_10306786 | |||
| 2852 | Ga0307406_10376173 | |||
| 2853 | Ga0307406_11163277 | |||
| 2854 | Ga0307406_11404059 | |||
| 2855 | Ga0307407_10009129 | |||
| 2856 | Ga0307407_10069122 | |||
| 2857 | Ga0307407_10437374 | |||
| 2858 | Ga0307407_10746492 | |||
| 2859 | Ga0307407_10818033 | |||
| 2860 | Ga0307407_10976059 | |||
| 2861 | Ga0307412_10021563 | |||
| 2862 | Ga0307412_10072599 | |||
| 2863 | Ga0307412_10248597 | |||
| 2864 | Ga0307412_10287603 | |||
| 2865 | Ga0307412_10325164 | |||
| 2866 | Ga0307412_10461052 | |||
| 2867 | Ga0307412_11031866 | |||
| 2868 | Ga0307412_11168664 | |||
| 2869 | Ga0307412_12230138 | |||
| 2870 | Ga0307409_100011203 | |||
| 2871 | Ga0307409_100022487 | |||
| 2872 | Ga0307409_100026651 | |||
| 2873 | Ga0307409_100098923 | |||
| 2874 | Ga0307409_100184355 | |||
| 2875 | Ga0307409_100207098 | |||
| 2876 | Ga0307409_101677757 | |||
| 2877 | Ga0307409_102243049 | |||
| 2878 | Ga0307416_100001674 | |||
| 2879 | Ga0307416_100009915 | |||
| 2880 | Ga0307416_100026805 | |||
| 2881 | Ga0307416_100056674 | |||
| 2882 | Ga0307416_100131865 | |||
| 2883 | Ga0307416_100153108 | |||
| 2884 | Ga0307416_100160503 | |||
| 2885 | Ga0307416_100620634 | |||
| 2886 | Ga0307416_101043049 | |||
| 2887 | Ga0307416_101761539 | |||
| 2888 | Ga0307416_102224680 | |||
| 2889 | Ga0307416_102511534 | |||
| 2890 | Ga0307414_10358836 | |||
| 2891 | Ga0307414_10674327 | |||
| 2892 | Ga0307414_10959155 | |||
| 2893 | Ga0307414_11053250 | |||
| 2894 | Ga0307414_11675213 | |||
| 2895 | Ga0307411_10012530 | |||
| 2896 | Ga0307411_10033406 | |||
| 2897 | Ga0307411_10045602 | |||
| 2898 | Ga0307411_10142666 | |||
| 2899 | Ga0307411_10272078 | |||
| 2900 | Ga0307411_10332286 | |||
| 2901 | Ga0307411_10401465 | |||
| 2902 | Ga0307411_10402475 | |||
| 2903 | Ga0307411_10480110 | |||
| 2904 | Ga0307411_10629031 | |||
| 2905 | Ga0307411_10659286 | |||
| 2906 | Ga0307411_10720879 | |||
| 2907 | Ga0307411_11909683 | |||
| 2908 | Ga0307415_100014778 | |||
| 2909 | Ga0307415_100044852 | |||
| 2910 | Ga0307415_100238149 | |||
| 2911 | Ga0307415_102053544 | |||
| 2912 | Ga0373930_0056077 | |||
| 2913 | Ga0373930_0143019 | |||
| 2914 | Ga0373948_0096995 | |||
| 2915 | Ga0373950_0140565 | |||
| 2916 | Ga0373959_0008472 | |||
| 2917 | Ga0373938_0086091 | |||
| 2918 | Ga0373938_0090990 | |||
| 2919 | Ga0373928_0048271 | |||
| 2920 | Ga0373934_0004468 | |||
| 2921 | Ga0373934_0277115 | |||
| 2922 | Ga0373940_0119441 | |||
| 2923 | Ga0373949_0016508 | |||
| 2924 | Ga0373949_0086483 | |||
| 2925 | Ga0373951_0024736 | |||
| 2926 | Ga0373923_0337989 | |||
| 2927 | Ga0373923_0590249 | |||
| 2928 | Ga0373932_0006139 | |||
| 2929 | Ga0373939_0050966 | |||
| 2930 | Ga0373953_0046414 | |||
| 2931 | Ga0373956_0022440 | |||
| 2932 | Ga0373956_0615016 | |||
| 2933 | Ga0373957_0044026 | |||
| 2934 | Ga0373943_0647648 | |||
| 2935 | Ga0373946_0143261 | |||
| 2936 | Ga0373955_0008601 | |||
| 2937 | Ga0373961_0033334 | |||
| 2938 | Ga0373962_0010858 | |||
| 2939 | Ga0373962_0061456 | |||
| 2940 | Ga0373931_0010056 | |||
| 2941 | Ga0373935_0117923 | |||
| 2942 | Ga0373933_0004292 | |||
| 2943 | Ga0373947_0021292 | |||
| 2944 | Ga0373947_0186396 | |||
| 2945 | Ga0373937_0000636 | |||
| 2946 | Ga0373937_0026134 | |||
| 2947 | Ga0373937_0085337 | |||
| 2948 | Ga0373925_1046224 | |||
| 2949 | Ga0373925_1428439 | |||
| 2950 | Ga0436365_0953110 | |||
| 2951 | Ga0439439_0078764 | |||
| 2952 | Ga0439439_0091287 | |||
| 2953 | Ga0439447_144857 | |||
| 2954 | Ga0439453_0002220 | |||
| 2955 | Ga0439453_0073614 | |||
| 2956 | Ga0451800_1242213 | |||
| 2957 | Ga0451802_1299424 | |||
| 2958 | Ga0451804_0497166 | |||
| 2959 | Ga0451807_2002591 | |||
| 2960 | Ga0451839_1004516 | |||
| 2961 | Ga0451853_2851514 | |||
| 2962 | Ga0451853_3766231 | |||
| 2963 | Ga0439433_0034595 | |||
| 2964 | Ga0439433_0110546 | |||
| 2965 | Ga0439433_0197986 | |||
| 2966 | Ga0439443_031403 | |||
| 2967 | Ga0439449_0053239 | |||
| 2968 | Ga0439450_005909 | |||
| 2969 | Ga0439451_104283 | |||
| 2970 | Ga0439454_013548 | |||
| 2971 | Ga0439455_0114671 | |||
| 2972 | Ga0439462_0025023 | |||
| 2973 | Ga0450921_035558 | |||
| 2974 | Ga0450923_017462 | |||
| 2975 | Ga0450923_159847 | |||
| 2976 | Ga0450896_015177 | |||
| 2977 | Ga0450910_011732 | |||
| 2978 | Ga0439446_0003023 | |||
| 2979 | Ga0439446_0021022 | |||
| 2980 | Ga0439446_0084355 | |||
| 2981 | Ga0439434_0054175 | |||
| 2982 | Ga0439434_0055441 | |||
| 2983 | Ga0439434_0062109 | |||
| 2984 | Ga0439434_0114700 | |||
| 2985 | Ga0439434_0311933 | |||
| 2986 | Ga0439435_0003643 | |||
| 2987 | Ga0439435_0011938 | |||
| 2988 | Ga0439435_0102358 | |||
| 2989 | Ga0439435_0203733 | |||
| 2990 | Ga0439435_0209413 | |||
| 2991 | Ga0439464_0046054 | |||
| 2992 | Ga0439464_0167033 | |||
| 2993 | Ga0439460_0043518 | |||
| 2994 | Ga0439460_0158880 | |||
| 2995 | Ga0439460_0333968 | |||
| 2996 | Ga0451577_0038896 | |||
| 2997 | Ga0451577_0533990 | |||
| 2998 | Ga0451577_1053720 | |||
| 2999 | Ga0451577_1576744 | |||
| 3000 | Ga0451577_1619139 | |||
| 3001 | Ga0439440_0027927 | |||
| 3002 | Ga0439440_0099536 | |||
| 3003 | Ga0439440_0166330 | |||
| 3004 | Ga0453683_0091878 | |||
| 3005 | Ga0453683_0528129 | |||
| 3006 | Ga0451576_0012634 | |||
| 3007 | Ga0451576_0031403 | |||
| 3008 | Ga0451576_0058861 | |||
| 3009 | Ga0451576_0259416 | |||
| 3010 | Ga0451576_0273634 | |||
| 3011 | Ga0451576_0323658 | |||
| 3012 | Ga0451576_0583309 | |||
| 3013 | Ga0451576_0618807 | |||
| 3014 | Ga0451576_0620486 | |||
| 3015 | Ga0451576_0970371 | |||
| 3016 | Ga0466967_0595390 | |||
| 3017 | Ga0495592_0175793 | |||
| 3018 | Ga0495592_0214714 | |||
| 3019 | Ga0495592_0322870 | |||
| 3020 | Ga0495603_0028716 | |||
| 3021 | Ga0495603_0203919 | |||
| 3022 | Ga0495603_0304534 | |||
| 3023 | Ga0495591_095428 | |||
| 3024 | Ga0495629_0010127 | |||
| 3025 | Ga0495629_0432018 | |||
| 3026 | Ga0495629_0566880 | |||
| 3027 | Ga0495641_0411295 | |||
| 3028 | Ga0495651_0086226 | |||
| 3029 | Ga0495653_0465696 | |||
| 3030 | Ga0495580_0068165 | |||
| 3031 | Ga0495582_0102419 | |||
| 3032 | Ga0495639_0089871 | |||
| 3033 | Ga0495584_0006908 | |||
| 3034 | Ga0495594_0244993 | |||
| 3035 | Ga0495594_0579791 | |||
| 3036 | Ga0495596_0248217 | |||
| 3037 | Ga0495628_0282618 | |||
| 3038 | Ga0495628_0886300 | |||
| 3039 | Ga0495630_0355794 | |||
| 3040 | Ga0495643_0002815 | |||
| 3041 | Ga0495644_0010822 | |||
| 3042 | Ga0495663_0045519 | |||
| 3043 | Ga0495663_0058320 | |||
| 3044 | Ga0495663_0184678 | |||
| 3045 | Ga0495642_0020701 | |||
| 3046 | Ga0495642_0067859 | |||
| 3047 | Ga0495665_0218846 | |||
| 3048 | Ga0495665_0234161 | |||
| 3049 | Ga0495640_0476707 | |||
| 3050 | Ga0495598_0007773 | |||
| 3051 | Ga0495598_0024579 | |||
| 3052 | Ga0495598_0036341 | |||
| 3053 | Ga0495598_0150546 | |||
| 3054 | Ga0495609_0012011 | |||
| 3055 | Ga0495609_0042546 | |||
| 3056 | Ga0495621_0014062 | |||
| 3057 | Ga0495621_0027383 | |||
| 3058 | Ga0495621_0042478 | |||
| 3059 | Ga0495621_0095893 | |||
| 3060 | Ga0495621_0148753 | |||
| 3061 | Ga0495621_0177310 | |||
| 3062 | Ga0495621_0401471 | |||
| 3063 | Ga0495645_0152782 | |||
| 3064 | Ga0495645_0700655 | |||
| 3065 | Ga0495633_0042236 | |||
| 3066 | Ga0495633_0366956 | |||
| 3067 | Ga0495656_0013094 | |||
| 3068 | Ga0495656_0174465 | |||
| 3069 | Ga0495656_0480620 | |||
| 3070 | Ga0495634_0108588 | |||
| 3071 | Ga0495659_0004263 | |||
| 3072 | Ga0495659_0014786 | |||
| 3073 | Ga0495659_0024829 | |||
| 3074 | Ga0495659_0028143 | |||
| 3075 | Ga0495659_0035778 | |||
| 3076 | Ga0495659_0184986 | |||
| 3077 | Ga0495588_0185482 | |||
| 3078 | Ga0495657_0228745 | |||
| 3079 | Ga0495599_0158825 | |||
| 3080 | Ga0495599_0301724 | |||
| 3081 | Ga0495599_0393328 | |||
| 3082 | Ga0495647_0193634 | |||
| 3083 | Ga0495658_0022875 | |||
| 3084 | Ga0495658_0300792 | |||
| 3085 | Ga0495658_0340284 | |||
| 3086 | Ga0495658_0624089 | |||
| 3087 | Ga0495669_0072519 | |||
| 3088 | Ga0495669_0146586 | |||
| 3089 | Ga0495613_0114988 | |||
| 3090 | Ga0495613_0500522 | |||
| 3091 | Ga0495670_0011708 | |||
| 3092 | Ga0495600_0309593 | |||
| 3093 | Ga0495636_0009944 | |||
| 3094 | Ga0495636_0090396 | |||
| 3095 | Ga0495636_0509187 | |||
| 3096 | Ga0495636_0634507 | |||
| 3097 | Ga0495636_0674064 | |||
| 3098 | Ga0495680_0134588 | |||
| 3099 | Ga0495680_0399604 | |||
| 3100 | Ga0495677_0049108 | |||
| 3101 | Ga0495677_0118788 | |||
| 3102 | Ga0495685_031609 | |||
| 3103 | Ga0495681_0319422 | |||
| 3104 | Ga0495684_0089234 | |||
| 3105 | Ga0495684_0460863 | |||
| 3106 | Ga0495684_0505847 | |||
| 3107 | Ga0495615_0316624 | |||
| 3108 | Ga0496100_0121371 | |||
| 3109 | Ga0496101_0195879 | |||
| 3110 | Ga0496101_0679749 | |||
| 3111 | Ga0496102_0206051 | |||
| 3112 | Ga0496102_0261172 | |||
| 3113 | Ga0496102_0269420 | |||
| 3114 | Ga0496102_0569143 | |||
| 3115 | Ga0496102_1671889 | |||
| 3116 | Ga0496103_0095295 | |||
| 3117 | Ga0496103_0545996 | |||
| 3118 | Ga0496104_0174331 | |||
| 3119 | Ga0496104_0460648 | |||
| 3120 | Ga0496104_0738223 | |||
| 3121 | Ga0496104_0746304 | |||
| 3122 | Ga0496104_0970935 | |||
| 3123 | Ga0496105_0490804 | |||
| 3124 | Ga0496105_0744554 | |||
| 3125 | Ga0496106_0037675 | |||
| 3126 | Ga0496106_0127079 | |||
| 3127 | Ga0496106_0159753 | |||
| 3128 | Ga0496106_0956915 | |||
| 3129 | Ga0496106_1354798 | |||
| 3130 | Ga0496106_1368031 | |||
| 3131 | Ga0496107_0060010 | |||
| 3132 | Ga0496108_0801139 | |||
| 3133 | Ga0496108_0901811 | |||
| 3134 | Ga0496108_1104027 | |||
| 3135 | Ga0496109_0101586 | |||
| 3136 | Ga0496109_0297960 | |||
| 3137 | Ga0496109_0445681 | |||
| 3138 | Ga0496110_0122855 | |||
| 3139 | Ga0496110_0239227 | |||
| 3140 | Ga0496111_0080696 | |||
| 3141 | Ga0496112_0182869 | |||
| 3142 | Ga0496112_0188578 | |||
| 3143 | Ga0496112_0269256 | |||
| 3144 | Ga0496112_0354959 | |||
| 3145 | Ga0496112_0474935 | |||
| 3146 | Ga0496113_0048818 | |||
| 3147 | Ga0496113_0191155 | |||
| 3148 | Ga0496113_0736987 | |||
| 3149 | Ga0496113_1322015 | |||
| 3150 | Ga0496114_0055265 | |||
| 3151 | Ga0496114_0448148 | |||
| 3152 | Ga0501292_067102 | |||
| 3153 | Ga0501298_045014 | |||
| 3154 | Ga0501299_087856 | |||
| 3155 | Ga0501031_0038545 | |||
| 3156 | Ga0501031_0141434 | |||
| 3157 | Ga0501031_0251274 | |||
| 3158 | Ga0501031_0448789 | |||
| 3159 | Ga0501031_0601906 | |||
| 3160 | Ga0501031_0723589 | |||
| 3161 | Ga0501031_1003046 | |||
| 3162 | Ga0501032_0384007 | |||
| 3163 | Ga0501032_0493440 | |||
| 3164 | Ga0501033_1029612 | |||
| 3165 | Ga0501034_0015608 | |||
| 3166 | Ga0501036_0028391 | |||
| 3167 | Ga0501036_0061087 | |||
| 3168 | Ga0501036_0061802 | |||
| 3169 | Ga0501036_0110384 | |||
| 3170 | Ga0501036_0171280 | |||
| 3171 | Ga0501036_0278905 | |||
| 3172 | Ga0501036_1060526 | |||
| 3173 | Ga0501038_0099437 | |||
| 3174 | Ga0501038_0250481 | |||
| 3175 | Ga0501038_0639775 | |||
| 3176 | Ga0501039_0053404 | |||
| 3177 | Ga0501039_0078127 | |||
| 3178 | Ga0501039_0167072 | |||
| 3179 | Ga0501039_0212573 | |||
| 3180 | Ga0501039_0504810 | |||
| 3181 | Ga0501039_1226203 | |||
| 3182 | Ga0501040_0030080 | |||
| 3183 | Ga0501040_0038103 | |||
| 3184 | Ga0501040_0060087 | |||
| 3185 | Ga0501040_0116438 | |||
| 3186 | Ga0501040_0226057 | |||
| 3187 | Ga0501040_0255070 | |||
| 3188 | Ga0501040_0498434 | |||
| 3189 | Ga0501040_0699699 | |||
| 3190 | Ga0501040_0987307 | |||
| 3191 | Ga0501041_0015406 | |||
| 3192 | Ga0501041_0054344 | |||
| 3193 | Ga0501041_0083530 | |||
| 3194 | Ga0501041_0103906 | |||
| 3195 | Ga0501041_0111791 | |||
| 3196 | Ga0501041_0237919 | |||
| 3197 | Ga0501041_0254373 | |||
| 3198 | Ga0501041_0557464 | |||
| 3199 | Ga0501041_0864701 | |||
| 3200 | Ga0501042_0004352 | |||
| 3201 | Ga0501042_0006294 | |||
| 3202 | Ga0501042_0049639 | |||
| 3203 | Ga0501042_0076956 | |||
| 3204 | Ga0501042_0079656 | |||
| 3205 | Ga0501042_0201100 | |||
| 3206 | Ga0501042_0300280 | |||
| 3207 | Ga0501042_0316617 | |||
| 3208 | Ga0501042_0619301 | |||
| 3209 | Ga0501042_0854305 | |||
| 3210 | Ga0501042_0899896 | |||
| 3211 | Ga0501042_1196565 | |||
| 3212 | Ga0501042_1247838 | |||
| 3213 | Ga0501046_0077616 | |||
| 3214 | Ga0501046_0144572 | |||
| 3215 | Ga0501046_0203832 | |||
| 3216 | Ga0501046_0365586 | |||
| 3217 | Ga0501046_0490987 | |||
| 3218 | Ga0501046_0580604 | |||
| 3219 | Ga0501046_0854914 | |||
| 3220 | Ga0501046_0881826 | |||
| 3221 | Ga0501046_0975397 | |||
| 3222 | Ga0501048_0041238 | |||
| 3223 | Ga0501048_0190242 | |||
| 3224 | Ga0501048_0227370 | |||
| 3225 | Ga0501067_0218144 | |||
| 3226 | Ga0501067_0551759 | |||
| 3227 | Ga0501068_0416688 | |||
| 3228 | Ga0501068_0575080 | |||
| 3229 | Ga0501068_0820407 | |||
| 3230 | Ga0501068_0967867 | |||
| 3231 | Ga0501069_0016549 | |||
| 3232 | Ga0501069_0397933 | |||
| 3233 | Ga0501070_0655922 | |||
| 3234 | Ga0501071_0031633 | |||
| 3235 | Ga0501071_0048323 | |||
| 3236 | Ga0501071_0063771 | |||
| 3237 | Ga0501071_0081426 | |||
| 3238 | Ga0501071_0107221 | |||
| 3239 | Ga0501071_0109853 | |||
| 3240 | Ga0501071_0242716 | |||
| 3241 | Ga0501071_0306179 | |||
| 3242 | Ga0501071_0347803 | |||
| 3243 | Ga0501071_0354867 | |||
| 3244 | Ga0501071_0432787 | |||
| 3245 | Ga0501071_0523538 | |||
| 3246 | Ga0501071_0670146 | |||
| 3247 | Ga0501071_0996713 | |||
| 3248 | Ga0501072_0029646 | |||
| 3249 | Ga0501072_0041729 | |||
| 3250 | Ga0501072_0044490 | |||
| 3251 | Ga0501072_0048029 | |||
| 3252 | Ga0501072_0048343 | |||
| 3253 | Ga0501072_0089431 | |||
| 3254 | Ga0501072_0431023 | |||
| 3255 | Ga0501072_0472281 | |||
| 3256 | Ga0501072_0501968 | |||
| 3257 | Ga0501073_0213239 | |||
| 3258 | Ga0501073_0215792 | |||
| 3259 | Ga0501073_0865991 | |||
| 3260 | Ga0501073_0884497 | |||
| 3261 | Ga0501073_0984686 | |||
| 3262 | Ga0501074_0035716 | |||
| 3263 | Ga0501074_0092250 | |||
| 3264 | Ga0501074_0102598 | |||
| 3265 | Ga0501074_0258520 | |||
| 3266 | Ga0501074_0479483 | |||
| 3267 | Ga0501074_1040128 | |||
| 3268 | Ga0501075_0001534 | |||
| 3269 | Ga0501075_0049516 | |||
| 3270 | Ga0501075_0054943 | |||
| 3271 | Ga0501075_0096446 | |||
| 3272 | Ga0501075_0121378 | |||
| 3273 | Ga0501075_0230007 | |||
| 3274 | Ga0501075_0248926 | |||
| 3275 | Ga0501075_0342117 | |||
| 3276 | Ga0501075_0580187 | |||
| 3277 | Ga0501075_0682699 | |||
| 3278 | Ga0501075_0818579 | |||
| 3279 | Ga0501075_0949379 | |||
| 3280 | Ga0501075_1521763 | |||
| 3281 | Ga0501076_0019323 | |||
| 3282 | Ga0501076_0038764 | |||
| 3283 | Ga0501076_0075398 | |||
| 3284 | Ga0501076_0096096 | |||
| 3285 | Ga0501076_0137576 | |||
| 3286 | Ga0501076_0182934 | |||
| 3287 | Ga0501076_0207182 | |||
| 3288 | Ga0501076_0212453 | |||
| 3289 | Ga0501076_0237592 | |||
| 3290 | Ga0501076_0241434 | |||
| 3291 | Ga0501076_0551030 | |||
| 3292 | Ga0501076_0557294 | |||
| 3293 | Ga0501076_0698563 | |||
| 3294 | Ga0501076_1632557 | |||
| 3295 | Ga0501077_0089699 | |||
| 3296 | Ga0501077_0134659 | |||
| 3297 | Ga0501077_0393406 | |||
| 3298 | Ga0501077_0457684 | |||
| 3299 | Ga0501077_0530309 | |||
| 3300 | Ga0501077_0719995 | |||
| 3301 | Ga0501077_0873736 | |||
| 3302 | Ga0501202_092255 | |||
| 3303 | Ga0501216_061920 | |||
| 3304 | Ga0501227_112764 | |||
| 3305 | Ga0501249_061747 | |||
| 3306 | Ga0501257_271935 | |||
| 3307 | Ga0501225_0073986 | |||
| 3308 | Ga0501245_038230 | |||
| 3309 | Ga0501079_0027535 | |||
| 3310 | Ga0501079_0131308 | |||
| 3311 | Ga0501079_0148554 | |||
| 3312 | Ga0501079_0228858 | |||
| 3313 | Ga0501079_0234487 | |||
| 3314 | Ga0501079_0234523 | |||
| 3315 | Ga0501079_0325735 | |||
| 3316 | Ga0501079_0332332 | |||
| 3317 | Ga0501079_0405745 | |||
| 3318 | Ga0501079_0464341 | |||
| 3319 | Ga0501079_0505695 | |||
| 3320 | Ga0501079_0635786 | |||
| 3321 | Ga0501079_1397826 | |||
| 3322 | Ga0501079_1499221 | |||
| 3323 | Ga0501080_0027010 | |||
| 3324 | Ga0501080_0148803 | |||
| 3325 | Ga0501080_0171834 | |||
| 3326 | Ga0501080_0232516 | |||
| 3327 | Ga0501080_0591806 | |||
| 3328 | Ga0501080_0689315 | |||
| 3329 | Ga0501080_0732812 | |||
| 3330 | Ga0501080_0823799 | |||
| 3331 | Ga0501081_0000708 | |||
| 3332 | Ga0501081_0076474 | |||
| 3333 | Ga0501081_0118553 | |||
| 3334 | Ga0501081_0172852 | |||
| 3335 | Ga0501081_0255552 | |||
| 3336 | Ga0501081_0398103 | |||
| 3337 | Ga0501081_0523685 | |||
| 3338 | Ga0501081_0554181 | |||
| 3339 | Ga0501081_1103045 | |||
| 3340 | Ga0501081_1177872 | |||
| 3341 | Ga0501083_0208336 | |||
| 3342 | Ga0501083_0288049 | |||
| 3343 | Ga0501265_092295 | |||
| 3344 | Ga0501273_048209 | |||
| 3345 | Ga0501035_0353546 | |||
| 3346 | Ga0501035_0387322 | |||
| 3347 | Ga0501035_0520082 | |||
| 3348 | Ga0501035_0530483 | |||
| 3349 | Ga0501035_0743217 | |||
| 3350 | Ga0501045_0015789 | |||
| 3351 | Ga0501045_0064388 | |||
| 3352 | Ga0501045_0079907 | |||
| 3353 | Ga0501045_0363578 | |||
| 3354 | Ga0501045_0366621 | |||
| 3355 | Ga0501045_0527886 | |||
| 3356 | Ga0501045_0531618 | |||
| 3357 | Ga0501045_0650461 | |||
| 3358 | Ga0501045_0688110 | |||
| 3359 | Ga0501045_0869495 | |||
| 3360 | nmdc:mga03n38_266970_c1 | |||
| 3361 | nmdc:mga0yw44_52317_c1 | |||
| 3362 | nmdc:mga0k408_15652_c1 | |||
| 3363 | nmdc:mga06z11_141222_c1 | |||
| 3364 | nmdc:mga04h51_34990_c1 | |||
| 3365 | nmdc:mga07m45_795385_c1 | |||
| 3366 | nmdc:mga05p37_106692_c1 | |||
| 3367 | nmdc:mga05p37_1504302_c1 | |||
| 3368 | nmdc:mga05p37_154728_c1 | |||
| 3369 | nmdc:mga05p37_171660_c1 | |||
| 3370 | nmdc:mga05p37_1804323_c1 | |||
| 3371 | nmdc:mga05p37_1976_c1 | |||
| 3372 | nmdc:mga05p37_197987_c1 | |||
| 3373 | nmdc:mga05p37_199120_c1 | |||
| 3374 | nmdc:mga05p37_223620_c1 | |||
| 3375 | nmdc:mga05p37_2275317_c1 | |||
| 3376 | nmdc:mga05p37_2706_c1 | |||
| 3377 | nmdc:mga05p37_317756_c1 | |||
| 3378 | nmdc:mga05p37_337377_c1 | |||
| 3379 | nmdc:mga05p37_526088_c1 | |||
| 3380 | nmdc:mga05p37_585099_c1 | |||
| 3381 | nmdc:mga05p37_59257_c1 | |||
| 3382 | nmdc:mga05p37_68798_c1 | |||
| 3383 | nmdc:mga05p37_701855_c1 | |||
| 3384 | nmdc:mga05p37_93129_c1 | |||
| 3385 | nmdc:mga05p37_974318_c1 | |||
| 3386 | nmdc:mga09592_1170006_c1 | |||
| 3387 | nmdc:mga09592_1186048_c1 | |||
| 3388 | nmdc:mga09592_1243835_c1 | |||
| 3389 | nmdc:mga09592_23365_c1 | |||
| 3390 | nmdc:mga09592_27002_c1 | |||
| 3391 | nmdc:mga09592_355668_c1 | |||
| 3392 | nmdc:mga09592_381873_c1 | |||
| 3393 | nmdc:mga09592_4784_c1 | |||
| 3394 | nmdc:mga09592_5871_c1 | |||
| 3395 | nmdc:mga09592_6156_c1 | |||
| 3396 | nmdc:mga09592_62474_c1 | |||
| 3397 | nmdc:mga09592_8217_c1 | |||
| 3398 | nmdc:mga09592_9092_c1 | |||
| 3399 | nmdc:mga0qj67_1128930_c1 | |||
| 3400 | nmdc:mga0qj67_1161620_c1 | |||
| 3401 | nmdc:mga0qj67_123623_c1 | |||
| 3402 | nmdc:mga0qj67_14732_c1 | |||
| 3403 | nmdc:mga0qj67_148525_c1 | |||
| 3404 | nmdc:mga0qj67_1512_c1 | |||
| 3405 | nmdc:mga0qj67_196722_c1 | |||
| 3406 | nmdc:mga0qj67_205756_c1 | |||
| 3407 | nmdc:mga0qj67_23280_c1 | |||
| 3408 | nmdc:mga0qj67_299002_c1 | |||
| 3409 | nmdc:mga0qj67_363959_c1 | |||
| 3410 | nmdc:mga0qj67_43412_c1 | |||
| 3411 | nmdc:mga0qj67_52665_c1 | |||
| 3412 | nmdc:mga0qj67_615366_c1 | |||
| 3413 | nmdc:mga06r32_1028982_c1 | |||
| 3414 | nmdc:mga06r32_104941_c1 | |||
| 3415 | nmdc:mga06r32_13471_c1 | |||
| 3416 | nmdc:mga06r32_15765_c1 | |||
| 3417 | nmdc:mga06r32_16110_c1 | |||
| 3418 | nmdc:mga06r32_178119_c1 | |||
| 3419 | nmdc:mga06r32_237906_c1 | |||
| 3420 | nmdc:mga06r32_349348_c1 | |||
| 3421 | nmdc:mga06r32_3881_c1 | |||
| 3422 | nmdc:mga06r32_407277_c1 | |||
| 3423 | nmdc:mga06r32_407433_c1 | |||
| 3424 | nmdc:mga06r32_41924_c1 | |||
| 3425 | nmdc:mga06r32_506831_c1 | |||
| 3426 | nmdc:mga06r32_529084_c1 | |||
| 3427 | nmdc:mga06r32_558884_c1 | |||
| 3428 | nmdc:mga08y16_12708_c1 | |||
| 3429 | nmdc:mga08y16_1710_c1 | |||
| 3430 | nmdc:mga08y16_2030909_c1 | |||
| 3431 | nmdc:mga08y16_225793_c1 | |||
| 3432 | nmdc:mga08y16_23899_c1 | |||
| 3433 | nmdc:mga08y16_242504_c1 | |||
| 3434 | nmdc:mga08y16_25391_c1 | |||
| 3435 | nmdc:mga08y16_262941_c1 | |||
| 3436 | nmdc:mga08y16_38458_c1 | |||
| 3437 | nmdc:mga08y16_48960_c1 | |||
| 3438 | nmdc:mga08y16_512312_c1 | |||
| 3439 | nmdc:mga08y16_58928_c1 | |||
| 3440 | nmdc:mga08y16_61068_c1 | |||
| 3441 | nmdc:mga08y16_611_c1 | |||
| 3442 | nmdc:mga08y16_661563_c1 | |||
| 3443 | nmdc:mga08y16_680507_c1 | |||
| 3444 | nmdc:mga08y16_92341_c1 | |||
| 3445 | nmdc:mga0n895_136748_c1 | |||
| 3446 | nmdc:mga0n895_1679667_c1 | |||
| 3447 | nmdc:mga0n895_1711348_c1 | |||
| 3448 | nmdc:mga0n895_266830_c1 | |||
| 3449 | nmdc:mga0n895_267989_c1 | |||
| 3450 | nmdc:mga0n895_409293_c1 | |||
| 3451 | nmdc:mga0n895_45123_c1 | |||
| 3452 | nmdc:mga0n895_46172_c1 | |||
| 3453 | nmdc:mga0n895_5739_c1 | |||
| 3454 | nmdc:mga0n895_65562_c1 | |||
| 3455 | nmdc:mga0n895_70695_c1 | |||
| 3456 | nmdc:mga0n895_796655_c1 | |||
| 3457 | nmdc:mga0n895_87579_c1 | |||
| 3458 | nmdc:mga0n895_916967_c1 | |||
| 3459 | nmdc:mga0rr50_108495_c1 | |||
| 3460 | nmdc:mga0rr50_12095_c1 | |||
| 3461 | nmdc:mga0rr50_13165_c1 | |||
| 3462 | nmdc:mga0rr50_13953_c1 | |||
| 3463 | nmdc:mga0rr50_290916_c1 | |||
| 3464 | nmdc:mga0rr50_33925_c1 | |||
| 3465 | nmdc:mga0rr50_393479_c1 | |||
| 3466 | nmdc:mga0rr50_41835_c1 | |||
| 3467 | nmdc:mga0rr50_430192_c1 | |||
| 3468 | nmdc:mga08x19_558855_c1 | |||
| 3469 | nmdc:mga08x19_780647_c1 | |||
| 3470 | nmdc:mga0a205_139238_c1 | |||
| 3471 | nmdc:mga0a205_146048_c1 | |||
| 3472 | nmdc:mga0a205_197617_c1 | |||
| 3473 | nmdc:mga0a205_265250_c1 | |||
| 3474 | nmdc:mga0a205_2970_c1 | |||
| 3475 | nmdc:mga0a205_34005_c1 | |||
| 3476 | nmdc:mga0a205_44696_c1 | |||
| 3477 | nmdc:mga0a205_475349_c1 | |||
| 3478 | nmdc:mga0a205_492_c1 | |||
| 3479 | nmdc:mga0a205_53372_c1 | |||
| 3480 | nmdc:mga0a205_60215_c1 | |||
| 3481 | nmdc:mga0a205_81248_c1 | |||
| 3482 | nmdc:mga0a205_88597_c2 | |||
| 3483 | nmdc:mga0a205_90545_c1 | |||
| 3484 | nmdc:mga0a205_986_c1 | |||
| 3485 | Ga0495601_0209666 | |||
| 3486 | Ga0495595_0078472 | |||
| 3487 | Ga0500627_0236848 | |||
| 3488 | Ga0501084_0023866 | |||
| 3489 | Ga0501084_0040229 | |||
| 3490 | Ga0501084_0084650 | |||
| 3491 | Ga0501084_0183348 | |||
| 3492 | Ga0501084_0189565 | |||
| 3493 | Ga0501084_0229065 | |||
| 3494 | Ga0501084_0427270 | |||
| 3495 | Ga0501084_0506312 | |||
| 3496 | Ga0501084_0852898 | |||
| 3497 | Ga0501084_1438926 | |||
| 3498 | Ga0590071_000034 | |||
| 3499 | Ga0590071_000282 | |||
| 3500 | Ga0590071_070774 | |||
| 3501 | Ga0590074_001566 | |||
| 3502 | Ga0590074_021132 | |||
| 3503 | Ga0590074_059239 | |||
| 3504 | Ga0590074_086406 | |||
| 3505 | Ga0590075_000025 | |||
| 3506 | Ga0590075_000872 | |||
| 3507 | Ga0590077_000006 | |||
| 3508 | Ga0590077_000238 | |||
| 3509 | Ga0590077_043048 | |||
| 3510 | Ga0501082_0020583 | |||
| 3511 | Ga0501082_0021769 | |||
| 3512 | Ga0501082_0121692 | |||
| 3513 | Ga0501082_0176603 | |||
| 3514 | Ga0501082_0286730 | |||
| 3515 | Ga0501082_0333163 | |||
| 3516 | Ga0501082_0378492 | |||
| 3517 | Ga0501082_0506550 | |||
| 3518 | Ga0501082_0555722 | |||
| 3519 | Ga0501082_0629369 | |||
| 3520 | Ga0501082_0635418 | |||
| 3521 | Ga0501082_0929052 | |||
| 3522 | Ga0501082_1780991 | |||
| 3523 | Ga0530510_0001780 | |||
| 3524 | Ga0530510_0001988 | |||
| 3525 | Ga0530510_0018377 | |||
| 3526 | Ga0530510_0225442 | |||
| 3527 | Ga0530510_0341993 | |||
| 3528 | Ga0530510_0438268 | |||
| 3529 | Ga0530510_0640768 | |||
| 3530 | Ga0530510_0649331 | |||
| 3531 | Ga0530510_0806683 | |||
| 3532 | Ga0530510_0863117 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f43-assembly1.cif.gz_A-2 | crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution | 0.9372 | 3 | 110 |
| 4qtp-assembly3.cif.gz_C | crystal structure of an anti-sigma factor antagonist from mycobacterium paratuberculosis | 0.9311 | 2 | 110 |
| 6m36-assembly1.cif.gz_H | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.9304 | 2 | 102 |
| 4hyl-assembly1.cif.gz_A | the crystal structure of an anti-sigma-factor antagonist from haliangium ochraceum dsm 14365 | 0.9182 | 2 | 113 |
| 1th8-assembly1.cif.gz_B | crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii | 0.9165 | 2 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0N7KGR6_2_88_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9563 | 42 | 111 | 3.30.750.24 |
| af_A0A0R0KL09_2_75_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9312 | 53 | 111 | 3.30.750.24 |
| 4qtpB00 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9226 | 2 | 110 | 3.30.750.24 |
| 3f43A01 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.918 | 6 | 112 | 3.30.750.24 |
| af_Q10QI4_508_648_3.30.750.24 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain | 0.9164 | 6 | 110 | 3.30.750.24 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2TGN8-F1-model_v4 | STAS domain-containing protein | 0.9912 | 1 | 112 |
GO:0043856
|
| AF-A0A2V7XEN0-F1-model_v4 | Anti-sigma factor antagonist | 0.9899 | 2 | 110 |
GO:0043856
|
| AF-A0A2V7XAJ0-F1-model_v4 | Anti-sigma factor antagonist | 0.9868 | 1 | 112 |
GO:0043856
|
| AF-A0A2V7VRZ4-F1-model_v4 | Anti-sigma factor antagonist | 0.9854 | 1 | 113 |
GO:0043856
|
| AF-A0A2V7XFS2-F1-model_v4 | STAS domain-containing protein | 0.9851 | 1 | 112 |
GO:0043856
|