F495636

General Info

Members Datasets Scaffolds Average Seq Length
1766 408 3532 113

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_2680370|Ga0451807_2680370_558_914
Length 118
Sequence MNVTTATLGDVVVLQVNEPRLTYPILADFASAATNLIGSGQKKIVVDLTPVGYVDSATIGCLMDLYRQATSSGSALKLAGVQKRVETMLTMTGAHNFLEVHADQASALASFGVYPWRR

Samples

Sample ID Description Type Environment
1 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
121 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
207 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
226 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
227 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
228 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
229 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
230 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
231 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
232 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
233 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
234 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
235 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
237 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
238 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
239 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
240 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
245 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
254 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
255 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
256 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
257 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
258 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
259 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
260 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
261 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
262 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
263 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
264 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
265 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
266 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
267 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
268 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
269 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
270 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
271 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
272 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
273 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
274 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
275 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
276 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
277 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
278 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
279 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
280 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
281 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
282 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
283 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
284 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
285 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
288 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
289 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
290 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
291 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
292 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
293 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
296 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
297 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
298 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
299 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
300 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
301 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
302 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
305 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
306 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
322 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
323 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
324 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
325 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
326 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
327 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
328 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
329 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
330 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
331 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
332 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
333 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
334 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
335 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
336 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
337 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
338 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
339 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
340 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
341 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
342 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
343 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
344 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
345 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
346 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
359 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
360 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
361 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
362 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
363 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
364 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
365 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
366 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
367 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
368 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
369 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
370 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
371 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
372 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
373 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
374 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
375 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
376 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
377 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
378 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
379 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
380 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
381 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
384 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
385 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
386 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
387 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
388 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
389 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
390 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
391 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
397 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
398 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
399 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
400 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
401 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
402 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
403 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
404 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
405 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
406 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
407 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
408 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.94
Metatranscriptomes 0.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 2.77
Rhizosphere 96.15
Stem 0
Stem Tuber 0
Unclassified 22.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451807_2680370 3300041486 Bacteria 957
2 ARcpr5yngRDRAFT_c013371 3300000043 Unclassified 690
3 JGI24739J22299_10189834 3300001989 Bacteria 604
4 JGI24750J21931_1005644 3300002070 Bacteria 1541
5 JGI24745J21846_1045819 3300002073 Bacteria 548
6 JGI24748J21848_1039180 3300002074 Bacteria 600
7 JGI24749J21850_1022447 3300002076 Unclassified 895
8 JGI24751J29686_10036310 3300002459 Bacteria 1021
9 Ga0058863_11932409 3300004799 Unclassified 1332
10 Ga0065704_10123446 3300005289 Bacteria 1733
11 Ga0065704_10181414 3300005289 Bacteria 1235
12 Ga0065704_10705596 3300005289 Bacteria 559
13 Ga0065712_10022428 3300005290 Bacteria 1313
14 Ga0065712_10051606 3300005290 Unclassified 745
15 Ga0065712_10072906 3300005290 Bacteria 4571
16 Ga0065712_10284836 3300005290 Bacteria 888
17 Ga0065712_10307811 3300005290 Unclassified 849
18 Ga0065712_10312330 3300005290 Bacteria 842
19 Ga0065712_10358855 3300005290 Bacteria 777
20 Ga0065712_10420257 3300005290 Bacteria 712
21 Ga0065712_10587368 3300005290 Bacteria 597
22 Ga0065712_10725601 3300005290 Bacteria 530
23 Ga0065715_10097777 3300005293 Bacteria 3644
24 Ga0065715_10191708 3300005293 Unclassified 1411
25 Ga0065715_10370516 3300005293 Bacteria 922
26 Ga0065715_10406936 3300005293 Bacteria 874
27 Ga0065715_10497280 3300005293 Bacteria 770
28 Ga0065715_10868974 3300005293 Unclassified 585
29 Ga0065715_11158852 3300005293 Unclassified 507
30 Ga0065707_10005876 3300005295 Bacteria 5306
31 Ga0065707_10009901 3300005295 Bacteria 3233
32 Ga0065707_10149926 3300005295 Unclassified 1670
33 Ga0065707_10155199 3300005295 Bacteria 1616
34 Ga0065707_10176388 3300005295 Bacteria 1448
35 Ga0065707_10309646 3300005295 Bacteria 955
36 Ga0065707_10456554 3300005295 Bacteria 795
37 Ga0065707_10490249 3300005295 Unclassified 766
38 Ga0070676_10055794 3300005328 Bacteria 2332
39 Ga0070676_10366078 3300005328 Bacteria 995
40 Ga0070676_10465465 3300005328 Unclassified 892
41 Ga0070676_10636259 3300005328 Bacteria 773
42 Ga0070676_10886955 3300005328 Bacteria 663
43 Ga0070683_100083153 3300005329 Bacteria 2999
44 Ga0070683_102261996 3300005329 Unclassified 522
45 Ga0070690_100004426 3300005330 Bacteria 7799
46 Ga0070690_100024878 3300005330 Bacteria 3685
47 Ga0070690_100031293 3300005330 Unclassified 3314
48 Ga0070690_100078050 3300005330 Bacteria 2163
49 Ga0070690_100217284 3300005330 Bacteria 1338
50 Ga0070690_100805614 3300005330 Unclassified 729
51 Ga0070690_100947732 3300005330 Unclassified 676
52 Ga0070670_100010332 3300005331 Bacteria 7967
53 Ga0070670_100021798 3300005331 Bacteria 5510
54 Ga0070670_100067562 3300005331 Bacteria 3067
55 Ga0070670_100138925 3300005331 Bacteria 2101
56 Ga0070670_100145557 3300005331 Bacteria 2050
57 Ga0070670_100206851 3300005331 Unclassified 1706
58 Ga0070670_100215657 3300005331 Bacteria 1669
59 Ga0070670_100257732 3300005331 Bacteria 1520
60 Ga0070670_100561449 3300005331 Unclassified 1019
61 Ga0070670_100908009 3300005331 Bacteria 799
62 Ga0070670_101035724 3300005331 Unclassified 747
63 Ga0070677_10000884 3300005333 Bacteria 9865
64 Ga0070677_10018427 3300005333 Bacteria 2514
65 Ga0070677_10171655 3300005333 Bacteria 1025
66 Ga0070677_10246799 3300005333 Bacteria 884
67 Ga0070677_10333486 3300005333 Bacteria 781
68 Ga0070677_10767286 3300005333 Bacteria 548
69 Ga0068869_100001834 3300005334 Bacteria 12765
70 Ga0068869_100016747 3300005334 Bacteria 4948
71 Ga0068869_100035043 3300005334 Bacteria 3555
72 Ga0068869_100074252 3300005334 Bacteria 2524
73 Ga0068869_100112130 3300005334 Bacteria 2076
74 Ga0068869_100195197 3300005334 Bacteria 1594
75 Ga0068869_100419506 3300005334 Bacteria 1104
76 Ga0068869_100610616 3300005334 Bacteria 922
77 Ga0068869_100632074 3300005334 Bacteria 907
78 Ga0068869_101006269 3300005334 Bacteria 726
79 Ga0070666_10007259 3300005335 Bacteria 6834
80 Ga0070666_10055453 3300005335 Bacteria 2675
81 Ga0070666_10122016 3300005335 Bacteria 1808
82 Ga0070680_100038026 3300005336 Bacteria 3891
83 Ga0070680_100262987 3300005336 Bacteria 1460
84 Ga0070680_100316919 3300005336 Unclassified 1323
85 Ga0070680_100613790 3300005336 Bacteria 934
86 Ga0070682_100074373 3300005337 Bacteria 2182
87 Ga0070682_100399590 3300005337 Unclassified 1039
88 Ga0070682_100479706 3300005337 Bacteria 959
89 Ga0068868_100005344 3300005338 Bacteria 9017
90 Ga0068868_100105464 3300005338 Bacteria 2285
91 Ga0068868_100276025 3300005338 Bacteria 1421
92 Ga0068868_100811086 3300005338 Unclassified 845
93 Ga0068868_101236692 3300005338 Bacteria 692
94 Ga0070660_101053646 3300005339 Bacteria 688
95 Ga0070689_100018035 3300005340 Bacteria 5192
96 Ga0070689_100053398 3300005340 Bacteria 3127
97 Ga0070689_100163068 3300005340 Unclassified 1803
98 Ga0070689_100383040 3300005340 Bacteria 1186
99 Ga0070689_100757329 3300005340 Bacteria 851
100 Ga0070689_100759053 3300005340 Unclassified 851
101 Ga0070691_10060648 3300005341 Bacteria 1819
102 Ga0070691_10616899 3300005341 Bacteria 642
103 Ga0070691_10783735 3300005341 Bacteria 579
104 Ga0070687_100008085 3300005343 Bacteria 4432
105 Ga0070687_100028758 3300005343 Bacteria 2699
106 Ga0070687_100047930 3300005343 Bacteria 2194
107 Ga0070687_100187908 3300005343 Bacteria 1243
108 Ga0070687_100507436 3300005343 Bacteria 813
109 Ga0070687_100621441 3300005343 Bacteria 745
110 Ga0070661_100003293 3300005344 Bacteria 11147
111 Ga0070661_100065094 3300005344 Unclassified 2678
112 Ga0070661_100299993 3300005344 Unclassified 1250
113 Ga0070661_100441860 3300005344 Bacteria 1034
114 Ga0070661_101061208 3300005344 Bacteria 674
115 Ga0070661_101556266 3300005344 Bacteria 558
116 Ga0070692_10032075 3300005345 Bacteria 2639
117 Ga0070692_10174014 3300005345 Unclassified 1243
118 Ga0070692_10360788 3300005345 Unclassified 906
119 Ga0070692_11045566 3300005345 Unclassified 574
120 Ga0070668_100016902 3300005347 Bacteria 5457
121 Ga0070668_100020560 3300005347 Bacteria 4983
122 Ga0070668_100114614 3300005347 Bacteria 2148
123 Ga0070668_100518597 3300005347 Bacteria 1034
124 Ga0070668_100936212 3300005347 Bacteria 776
125 Ga0070668_102128561 3300005347 Unclassified 518
126 Ga0070669_100006473 3300005353 Bacteria 8431
127 Ga0070669_100075588 3300005353 Bacteria 2498
128 Ga0070669_100106995 3300005353 Bacteria 2118
129 Ga0070669_100234238 3300005353 Bacteria 1456
130 Ga0070669_100436878 3300005353 Bacteria 1076
131 Ga0070669_100829868 3300005353 Bacteria 787
132 Ga0070669_101016108 3300005353 Bacteria 712
133 Ga0070675_100002608 3300005354 Bacteria 13528
134 Ga0070675_100032679 3300005354 Bacteria 4212
135 Ga0070675_100076918 3300005354 Bacteria 2777
136 Ga0070675_100113663 3300005354 Bacteria 2293
137 Ga0070675_100132260 3300005354 Unclassified 2127
138 Ga0070675_100191156 3300005354 Bacteria 1774
139 Ga0070675_100195388 3300005354 Bacteria 1755
140 Ga0070675_100240873 3300005354 Bacteria 1580
141 Ga0070675_100292474 3300005354 Bacteria 1434
142 Ga0070675_100569030 3300005354 Bacteria 1026
143 Ga0070675_100783741 3300005354 Bacteria 871
144 Ga0070675_100816705 3300005354 Bacteria 853
145 Ga0070675_101188934 3300005354 Unclassified 702
146 Ga0070675_101211555 3300005354 Bacteria 695
147 Ga0070675_101618484 3300005354 Bacteria 597
148 Ga0070671_100040632 3300005355 Bacteria 3864
149 Ga0070671_100136584 3300005355 Bacteria 2067
150 Ga0070671_100184331 3300005355 Unclassified 1768
151 Ga0070671_100265156 3300005355 Bacteria 1460
152 Ga0070671_100775060 3300005355 Archaea 834
153 Ga0070674_100203861 3300005356 Unclassified 1529
154 Ga0070674_100385609 3300005356 Bacteria 1141
155 Ga0070674_100454843 3300005356 Unclassified 1057
156 Ga0070674_100524896 3300005356 Unclassified 990
157 Ga0070674_100863699 3300005356 Unclassified 786
158 Ga0070674_101237510 3300005356 Bacteria 664
159 Ga0070674_101484658 3300005356 Bacteria 609
160 Ga0070674_101719120 3300005356 Bacteria 568
161 Ga0070673_100007144 3300005364 Bacteria 7334
162 Ga0070673_100046488 3300005364 Bacteria 3372
163 Ga0070673_100123040 3300005364 Bacteria 2167
164 Ga0070673_100129990 3300005364 Bacteria 2111
165 Ga0070673_100173104 3300005364 Unclassified 1844
166 Ga0070673_100252368 3300005364 Unclassified 1538
167 Ga0070673_100397622 3300005364 Unclassified 1231
168 Ga0070673_100464947 3300005364 Bacteria 1140
169 Ga0070673_100506564 3300005364 Bacteria 1092
170 Ga0070673_100865848 3300005364 Bacteria 837
171 Ga0070673_100875310 3300005364 Bacteria 832
172 Ga0070673_101385688 3300005364 Bacteria 661
173 Ga0070688_100013286 3300005365 Bacteria 4638
174 Ga0070688_100031261 3300005365 Bacteria 3202
175 Ga0070688_100044774 3300005365 Bacteria 2731
176 Ga0070688_100102851 3300005365 Unclassified 1886
177 Ga0070688_100120357 3300005365 Bacteria 1757
178 Ga0070688_100142136 3300005365 Unclassified 1632
179 Ga0070688_100186678 3300005365 Bacteria 1441
180 Ga0070688_100760263 3300005365 Bacteria 755
181 Ga0070688_101223791 3300005365 Bacteria 604
182 Ga0070659_100114324 3300005366 Unclassified 2180
183 Ga0070659_100135095 3300005366 Bacteria 2005
184 Ga0070659_100357828 3300005366 Bacteria 1226
185 Ga0070659_100470646 3300005366 Bacteria 1068
186 Ga0070659_100997148 3300005366 Bacteria 735
187 Ga0070659_101211509 3300005366 Bacteria 668
188 Ga0070667_100182205 3300005367 Bacteria 1858
189 Ga0070667_100270530 3300005367 Bacteria 1523
190 Ga0070667_100272075 3300005367 Bacteria 1519
191 Ga0070667_100707800 3300005367 Unclassified 932
192 Ga0070667_101857765 3300005367 Archaea 567
193 Ga0070703_10016665 3300005406 Bacteria 2110
194 Ga0070703_10203076 3300005406 Unclassified 779
195 Ga0070703_10280877 3300005406 Unclassified 687
196 Ga0070713_100848750 3300005436 Bacteria 877
197 Ga0070701_10009628 3300005438 Bacteria 4239
198 Ga0070701_10045217 3300005438 Bacteria 2258
199 Ga0070701_10082718 3300005438 Bacteria 1742
200 Ga0070701_10083747 3300005438 Unclassified 1732
201 Ga0070701_10186172 3300005438 Bacteria 1219
202 Ga0070701_10521090 3300005438 Unclassified 775
203 Ga0070701_10587751 3300005438 Bacteria 736
204 Ga0070705_100000353 3300005440 Bacteria 27139
205 Ga0070705_100008965 3300005440 Bacteria 4963
206 Ga0070705_100029016 3300005440 Unclassified 3037
207 Ga0070705_100079069 3300005440 Unclassified 2013
208 Ga0070705_100144556 3300005440 Bacteria 1570
209 Ga0070705_100791174 3300005440 Bacteria 754
210 Ga0070705_100930933 3300005440 Unclassified 701
211 Ga0070705_101050257 3300005440 Bacteria 664
212 Ga0070700_100032037 3300005441 Bacteria 3156
213 Ga0070700_100098789 3300005441 Unclassified 1919
214 Ga0070700_100218161 3300005441 Bacteria 1350
215 Ga0070700_100393770 3300005441 Bacteria 1040
216 Ga0070700_100506595 3300005441 Unclassified 930
217 Ga0070700_100684244 3300005441 Bacteria 813
218 Ga0070700_100733301 3300005441 Unclassified 789
219 Ga0070700_101044979 3300005441 Bacteria 674
220 Ga0070700_101107382 3300005441 Unclassified 657
221 Ga0070700_101202054 3300005441 Unclassified 633
222 Ga0070700_101325164 3300005441 Unclassified 606
223 Ga0070694_100001728 3300005444 Bacteria 12875
224 Ga0070694_100008513 3300005444 Bacteria 6276
225 Ga0070694_100010015 3300005444 Bacteria 5829
226 Ga0070694_100082599 3300005444 Bacteria 2238
227 Ga0070694_100375284 3300005444 Unclassified 1108
228 Ga0070694_100820701 3300005444 Unclassified 764
229 Ga0070708_100071937 3300005445 Bacteria 3115
230 Ga0070708_100135240 3300005445 Bacteria 2283
231 Ga0070708_100305645 3300005445 Bacteria 1498
232 Ga0070708_100675580 3300005445 Bacteria 973
233 Ga0070708_100708629 3300005445 Unclassified 947
234 Ga0070663_100084753 3300005455 Bacteria 2337
235 Ga0070663_100737867 3300005455 Unclassified 840
236 Ga0070663_100855807 3300005455 Unclassified 783
237 Ga0070663_101759492 3300005455 Unclassified 555
238 Ga0070678_100041874 3300005456 Bacteria 3251
239 Ga0070678_100065613 3300005456 Bacteria 2696
240 Ga0070678_100099831 3300005456 Bacteria 2247
241 Ga0070678_100106736 3300005456 Bacteria 2183
242 Ga0070678_100219733 3300005456 Unclassified 1579
243 Ga0070678_101533113 3300005456 Unclassified 624
244 Ga0070678_101602946 3300005456 Unclassified 611
245 Ga0070678_101644769 3300005456 Unclassified 603
246 Ga0070678_102209454 3300005456 Unclassified 522
247 Ga0070662_100006426 3300005457 Bacteria 7575
248 Ga0070662_100019273 3300005457 Unclassified 4630
249 Ga0070662_100046389 3300005457 Bacteria 3122
250 Ga0070662_100125965 3300005457 Bacteria 1969
251 Ga0070662_100710678 3300005457 Unclassified 851
252 Ga0070681_10002446 3300005458 Bacteria 17007
253 Ga0070681_10217991 3300005458 Bacteria 1824
254 Ga0070681_10735226 3300005458 Bacteria 903
255 Ga0068867_100019216 3300005459 Unclassified 4868
256 Ga0068867_100063872 3300005459 Bacteria 2737
257 Ga0068867_100129518 3300005459 Bacteria 1959
258 Ga0068867_100435637 3300005459 Bacteria 1114
259 Ga0068867_100759648 3300005459 Unclassified 861
260 Ga0070685_10015733 3300005466 Bacteria 4021
261 Ga0070685_10031142 3300005466 Bacteria 2978
262 Ga0070685_10050188 3300005466 Bacteria 2410
263 Ga0070685_10203579 3300005466 Unclassified 1288
264 Ga0070685_10399757 3300005466 Bacteria 951
265 Ga0070685_10440110 3300005466 Unclassified 911
266 Ga0070685_10534829 3300005466 Unclassified 834
267 Ga0070706_100169304 3300005467 Bacteria 2040
268 Ga0070706_100555807 3300005467 Bacteria 1067
269 Ga0070706_101801291 3300005467 Bacteria 556
270 Ga0070707_100201317 3300005468 Unclassified 1941
271 Ga0070707_100289816 3300005468 Bacteria 1590
272 Ga0070707_101337589 3300005468 Bacteria 683
273 Ga0070707_101439161 3300005468 Bacteria 656
274 Ga0070707_101627374 3300005468 Archaea 613
275 Ga0070698_100005270 3300005471 Bacteria 14146
276 Ga0070698_100029738 3300005471 Bacteria 5669
277 Ga0070698_100100980 3300005471 Bacteria 2857
278 Ga0070698_100153539 3300005471 Bacteria 2248
279 Ga0070698_100583610 3300005471 Bacteria 1058
280 Ga0070698_100623961 3300005471 Bacteria 1019
281 Ga0070698_100976120 3300005471 Bacteria 794
282 Ga0070698_101260595 3300005471 Bacteria 689
283 Ga0070698_101566007 3300005471 Bacteria 611
284 Ga0070699_100003285 3300005518 Bacteria 14297
285 Ga0070699_100007386 3300005518 Bacteria 9569
286 Ga0070699_100022796 3300005518 Bacteria 5396
287 Ga0070699_100525976 3300005518 Bacteria 1075
288 Ga0070699_100629527 3300005518 Unclassified 979
289 Ga0070679_100597545 3300005530 Unclassified 1047
290 Ga0070679_101518941 3300005530 Bacteria 617
291 Ga0070684_100099393 3300005535 Unclassified 2597
292 Ga0070684_100175655 3300005535 Bacteria 1947
293 Ga0070684_100748943 3300005535 Bacteria 912
294 Ga0070684_101215353 3300005535 Unclassified 709
295 Ga0070697_100084866 3300005536 Bacteria 2612
296 Ga0070697_100313326 3300005536 Bacteria 1350
297 Ga0070697_101935200 3300005536 Bacteria 528
298 Ga0068853_101085069 3300005539 Bacteria 772
299 Ga0070672_100006955 3300005543 Bacteria 7650
300 Ga0070672_100009505 3300005543 Bacteria 6707
301 Ga0070672_100043637 3300005543 Bacteria 3459
302 Ga0070672_100043840 3300005543 Bacteria 3452
303 Ga0070672_100061587 3300005543 Unclassified 2959
304 Ga0070672_100621509 3300005543 Archaea 942
305 Ga0070672_100977589 3300005543 Unclassified 749
306 Ga0070672_101023322 3300005543 Bacteria 732
307 Ga0070672_101504782 3300005543 Bacteria 603
308 Ga0070686_100006474 3300005544 Bacteria 6512
309 Ga0070686_100045869 3300005544 Bacteria 2754
310 Ga0070686_100345857 3300005544 Unclassified 1116
311 Ga0070686_100375750 3300005544 Unclassified 1074
312 Ga0070686_100627161 3300005544 Unclassified 850
313 Ga0070686_101071031 3300005544 Bacteria 664
314 Ga0070686_101165057 3300005544 Bacteria 639
315 Ga0070695_100003268 3300005545 Bacteria 9468
316 Ga0070695_100020676 3300005545 Bacteria 4020
317 Ga0070695_100060865 3300005545 Bacteria 2447
318 Ga0070695_100306956 3300005545 Unclassified 1175
319 Ga0070696_100000751 3300005546 Bacteria 20742
320 Ga0070696_100013141 3300005546 Bacteria 5554
321 Ga0070696_100039033 3300005546 Bacteria 3279
322 Ga0070696_100120202 3300005546 Unclassified 1901
323 Ga0070696_100172919 3300005546 Bacteria 1598
324 Ga0070696_100406628 3300005546 Bacteria 1066
325 Ga0070696_100673499 3300005546 Bacteria 841
326 Ga0070696_101002298 3300005546 Bacteria 698
327 Ga0070696_101005789 3300005546 Bacteria 697
328 Ga0070693_100032579 3300005547 Bacteria 2867
329 Ga0070665_100090893 3300005548 Bacteria 3059
330 Ga0070665_100252021 3300005548 Bacteria 1766
331 Ga0070665_101023731 3300005548 Bacteria 838
332 Ga0070665_101691191 3300005548 Bacteria 640
333 Ga0070704_100002185 3300005549 Bacteria 10894
334 Ga0070704_100014281 3300005549 Bacteria 4957
335 Ga0070704_100047016 3300005549 Bacteria 3014
336 Ga0070704_100073926 3300005549 Bacteria 2484
337 Ga0070704_100075821 3300005549 Bacteria 2458
338 Ga0070704_100115315 3300005549 Bacteria 2052
339 Ga0070704_100175061 3300005549 Bacteria 1711
340 Ga0070704_100223686 3300005549 Unclassified 1531
341 Ga0070704_100354916 3300005549 Unclassified 1239
342 Ga0070704_100717534 3300005549 Unclassified 888
343 Ga0070704_101547348 3300005549 Bacteria 611
344 Ga0068855_100621950 3300005563 Bacteria 1163
345 Ga0070664_100018194 3300005564 Bacteria 5767
346 Ga0070664_100039531 3300005564 Bacteria 3975
347 Ga0070664_100053084 3300005564 Bacteria 3434
348 Ga0070664_100175999 3300005564 Bacteria 1900
349 Ga0070664_100272927 3300005564 Bacteria 1524
350 Ga0070664_100363263 3300005564 Bacteria 1319
351 Ga0070664_100476796 3300005564 Bacteria 1148
352 Ga0070664_100591079 3300005564 Bacteria 1029
353 Ga0070664_100722184 3300005564 Bacteria 929
354 Ga0070664_101082640 3300005564 Bacteria 755
355 Ga0070664_101381278 3300005564 Unclassified 666
356 Ga0068857_100202629 3300005577 Bacteria 1809
357 Ga0068857_100326042 3300005577 Bacteria 1419
358 Ga0068857_100544462 3300005577 Bacteria 1093
359 Ga0068857_101196268 3300005577 Bacteria 736
360 Ga0068854_100058261 3300005578 Bacteria 2787
361 Ga0068856_100182009 3300005614 Unclassified 2115
362 Ga0070702_100057017 3300005615 Bacteria 2258
363 Ga0070702_100696521 3300005615 Bacteria 774
364 Ga0070702_101201197 3300005615 Bacteria 611
365 Ga0068852_100025184 3300005616 Bacteria 4817
366 Ga0068852_100051784 3300005616 Bacteria 3526
367 Ga0068852_100582464 3300005616 Unclassified 1122
368 Ga0068852_100761046 3300005616 Unclassified 981
369 Ga0068859_100006095 3300005617 Bacteria 12245
370 Ga0068859_100039000 3300005617 Bacteria 4764
371 Ga0068859_100045758 3300005617 Bacteria 4396
372 Ga0068859_100089189 3300005617 Bacteria 3134
373 Ga0068859_100117279 3300005617 Unclassified 2727
374 Ga0068859_100186560 3300005617 Bacteria 2157
375 Ga0068859_100549484 3300005617 Bacteria 1249
376 Ga0068859_100813849 3300005617 Unclassified 1021
377 Ga0068859_100816269 3300005617 Bacteria 1020
378 Ga0068859_101009129 3300005617 Bacteria 914
379 Ga0068859_101535945 3300005617 Unclassified 735
380 Ga0068859_101572149 3300005617 Bacteria 726
381 Ga0068859_101673644 3300005617 Unclassified 703
382 Ga0068864_100047439 3300005618 Bacteria 3689
383 Ga0068864_100102782 3300005618 Bacteria 2536
384 Ga0068864_100197663 3300005618 Bacteria 1846
385 Ga0068864_100305474 3300005618 Bacteria 1490
386 Ga0068864_100356891 3300005618 Bacteria 1381
387 Ga0068864_100618902 3300005618 Unclassified 1052
388 Ga0068864_100765314 3300005618 Bacteria 947
389 Ga0068864_100930031 3300005618 Bacteria 860
390 Ga0068864_102178903 3300005618 Bacteria 561
391 Ga0068864_102451046 3300005618 Bacteria 528
392 Ga0068866_10011566 3300005718 Bacteria 3823
393 Ga0068866_10559458 3300005718 Bacteria 766
394 Ga0068866_11035447 3300005718 Bacteria 585
395 Ga0068861_100012791 3300005719 Bacteria 5860
396 Ga0068861_100032640 3300005719 Bacteria 3834
397 Ga0068861_100359379 3300005719 Bacteria 1280
398 Ga0068861_100487645 3300005719 Bacteria 1112
399 Ga0068861_100646235 3300005719 Unclassified 977
400 Ga0068861_100946562 3300005719 Unclassified 819
401 Ga0068861_102032757 3300005719 Unclassified 574
402 Ga0068851_10130199 3300005834 Unclassified 1360
403 Ga0068870_10013998 3300005840 Bacteria 3780
404 Ga0068870_10018525 3300005840 Bacteria 3364
405 Ga0068870_10080772 3300005840 Bacteria 1797
406 Ga0068870_10396623 3300005840 Unclassified 897
407 Ga0068870_10477245 3300005840 Unclassified 827
408 Ga0068870_10544109 3300005840 Unclassified 781
409 Ga0068870_10590487 3300005840 Bacteria 753
410 Ga0068870_10955347 3300005840 Bacteria 609
411 Ga0068870_11361482 3300005840 Bacteria 519
412 Ga0068863_100002899 3300005841 Bacteria 16989
413 Ga0068863_100025702 3300005841 Bacteria 5615
414 Ga0068863_100046141 3300005841 Bacteria 4136
415 Ga0068863_100124010 3300005841 Unclassified 2465
416 Ga0068863_101007924 3300005841 Bacteria 836
417 Ga0068858_100007484 3300005842 Bacteria 10556
418 Ga0068858_100018524 3300005842 Bacteria 6518
419 Ga0068858_100052461 3300005842 Bacteria 3773
420 Ga0068858_100192947 3300005842 Bacteria 1925
421 Ga0068858_100641104 3300005842 Bacteria 1032
422 Ga0068858_101377077 3300005842 Unclassified 695
423 Ga0068860_100014383 3300005843 Bacteria 7755
424 Ga0068860_100038249 3300005843 Bacteria 4590
425 Ga0068860_100059770 3300005843 Bacteria 3623
426 Ga0068860_100185323 3300005843 Bacteria 2012
427 Ga0068860_100623832 3300005843 Unclassified 1085
428 Ga0068860_101003170 3300005843 Bacteria 853
429 Ga0068860_101200032 3300005843 Unclassified 779
430 Ga0068862_100002073 3300005844 Bacteria 18094
431 Ga0068862_100008919 3300005844 Bacteria 8304
432 Ga0068862_100025434 3300005844 Bacteria 4971
433 Ga0068862_100111241 3300005844 Bacteria 2404
434 Ga0068862_100186842 3300005844 Unclassified 1862
435 Ga0068862_100704301 3300005844 Unclassified 979
436 Ga0068862_100705369 3300005844 Bacteria 978
437 Ga0068862_100922615 3300005844 Unclassified 860
438 Ga0068862_101052701 3300005844 Bacteria 807
439 Ga0068862_101221321 3300005844 Bacteria 751
440 Ga0081538_10151793 3300005981 Unclassified 1047
441 Ga0081539_10000291 3300005985 Bacteria 113769
442 Ga0081539_10000295 3300005985 Bacteria 112740
443 Ga0081539_10006823 3300005985 Bacteria 10691
444 Ga0081539_10079711 3300005985 Unclassified 1724
445 Ga0070717_10631548 3300006028 Bacteria 972
446 Ga0075368_10016927 3300006042 Bacteria 2722
447 Ga0075363_100212204 3300006048 Bacteria 1108
448 Ga0075364_11206725 3300006051 Unclassified 513
449 Ga0070716_100271392 3300006173 Bacteria 1166
450 Ga0070712_100606567 3300006175 Bacteria 927
451 Ga0075367_10008193 3300006178 Bacteria 5401
452 Ga0075367_10703668 3300006178 Bacteria 643
453 Ga0075427_10026819 3300006194 Unclassified 934
454 Ga0075366_10018803 3300006195 Bacteria 3993
455 Ga0075366_10590950 3300006195 Bacteria 688
456 Ga0097621_100439385 3300006237 Unclassified 1174
457 Ga0097621_100800049 3300006237 Bacteria 873
458 Ga0097621_100910532 3300006237 Bacteria 819
459 Ga0068871_100159793 3300006358 Bacteria 1927
460 Ga0068871_100233077 3300006358 Bacteria 1598
461 Ga0068871_100310837 3300006358 Bacteria 1385
462 Ga0068871_101051709 3300006358 Bacteria 760
463 Ga0068871_101120908 3300006358 Bacteria 736
464 Ga0068871_101368067 3300006358 Unclassified 667
465 Ga0068871_101643937 3300006358 Unclassified 608
466 Ga0075428_100001205 3300006844 Bacteria 27639
467 Ga0075428_100011446 3300006844 Bacteria 9867
468 Ga0075428_100012226 3300006844 Bacteria 9545
469 Ga0075428_100021842 3300006844 Bacteria 7087
470 Ga0075428_100030863 3300006844 Bacteria 5926
471 Ga0075428_100042724 3300006844 Bacteria 4984
472 Ga0075428_100113028 3300006844 Bacteria 2958
473 Ga0075428_100315122 3300006844 Unclassified 1681
474 Ga0075428_100523099 3300006844 Bacteria 1269
475 Ga0075428_101279983 3300006844 Unclassified 772
476 Ga0075428_102510936 3300006844 Unclassified 528
477 Ga0075430_100063682 3300006846 Bacteria 3097
478 Ga0075430_100089047 3300006846 Bacteria 2582
479 Ga0075430_100127878 3300006846 Bacteria 2118
480 Ga0075430_100188316 3300006846 Bacteria 1715
481 Ga0075430_100193055 3300006846 Bacteria 1692
482 Ga0075430_100206542 3300006846 Bacteria 1630
483 Ga0075430_100212369 3300006846 Unclassified 1605
484 Ga0075430_100251135 3300006846 Unclassified 1465
485 Ga0075430_100290736 3300006846 Bacteria 1352
486 Ga0075430_100327315 3300006846 Unclassified 1267
487 Ga0075430_100441278 3300006846 Bacteria 1074
488 Ga0075430_100460028 3300006846 Bacteria 1050
489 Ga0075430_100688712 3300006846 Unclassified 842
490 Ga0075431_100005109 3300006847 Bacteria 12909
491 Ga0075431_100010681 3300006847 Bacteria 9226
492 Ga0075431_100018733 3300006847 Bacteria 7053
493 Ga0075431_100053307 3300006847 Bacteria 4170
494 Ga0075431_100068317 3300006847 Bacteria 3667
495 Ga0075431_100102439 3300006847 Bacteria 2954
496 Ga0075431_100183629 3300006847 Bacteria 2146
497 Ga0075431_100428397 3300006847 Unclassified 1321
498 Ga0075431_100484231 3300006847 Bacteria 1230
499 Ga0075431_100579921 3300006847 Bacteria 1107
500 Ga0075431_100661215 3300006847 Bacteria 1025
501 Ga0075431_100671892 3300006847 Unclassified 1015
502 Ga0075431_100747466 3300006847 Unclassified 953
503 Ga0075431_100850090 3300006847 Bacteria 884
504 Ga0075431_101075246 3300006847 Bacteria 770
505 Ga0075433_10001675 3300006852 Bacteria 16487
506 Ga0075433_10001688 3300006852 Bacteria 16445
507 Ga0075433_10018246 3300006852 Bacteria 5828
508 Ga0075433_10042019 3300006852 Bacteria 3965
509 Ga0075433_10050964 3300006852 Unclassified 3604
510 Ga0075433_10055219 3300006852 Bacteria 3467
511 Ga0075433_10069629 3300006852 Bacteria 3090
512 Ga0075433_10129709 3300006852 Bacteria 2240
513 Ga0075433_10243939 3300006852 Bacteria 1595
514 Ga0075433_10348333 3300006852 Unclassified 1309
515 Ga0075433_10526575 3300006852 Unclassified 1040
516 Ga0075433_10605558 3300006852 Bacteria 962
517 Ga0075433_11064861 3300006852 Unclassified 704
518 Ga0075434_100002545 3300006871 Bacteria 16085
519 Ga0075434_100005218 3300006871 Bacteria 11802
520 Ga0075434_100028400 3300006871 Bacteria 5496
521 Ga0075434_100033741 3300006871 Bacteria 5052
522 Ga0075434_100035306 3300006871 Bacteria 4942
523 Ga0075434_100064826 3300006871 Unclassified 3638
524 Ga0075434_100158188 3300006871 Bacteria 2285
525 Ga0075434_100228243 3300006871 Unclassified 1881
526 Ga0075434_100474284 3300006871 Unclassified 1272
527 Ga0075434_100718790 3300006871 Unclassified 1016
528 Ga0075434_101250246 3300006871 Unclassified 754
529 Ga0075434_101515317 3300006871 Bacteria 680
530 Ga0075434_101584952 3300006871 Bacteria 663
531 Ga0075429_100005715 3300006880 Bacteria 10730
532 Ga0075429_100023129 3300006880 Bacteria 5389
533 Ga0075429_100025834 3300006880 Bacteria 5099
534 Ga0075429_100051940 3300006880 Bacteria 3566
535 Ga0075429_100073043 3300006880 Bacteria 2987
536 Ga0075429_100117682 3300006880 Bacteria 2322
537 Ga0075429_100205088 3300006880 Unclassified 1727
538 Ga0075429_100422501 3300006880 Unclassified 1167
539 Ga0075429_100629963 3300006880 Unclassified 939
540 Ga0075429_101239515 3300006880 Bacteria 651
541 Ga0068865_100053704 3300006881 Unclassified 2796
542 Ga0068865_100202386 3300006881 Bacteria 1542
543 Ga0068865_100295905 3300006881 Bacteria 1294
544 Ga0068865_100377330 3300006881 Bacteria 1155
545 Ga0068865_100442578 3300006881 Bacteria 1073
546 Ga0068865_100561968 3300006881 Bacteria 959
547 Ga0068865_100576935 3300006881 Bacteria 948
548 Ga0068865_100718063 3300006881 Unclassified 855
549 Ga0068865_100976064 3300006881 Bacteria 741
550 Ga0068865_101741953 3300006881 Unclassified 562
551 Ga0075436_100733731 3300006914 Unclassified 733
552 Ga0097620_100006095 3300006931 Bacteria 12245
553 Ga0097620_100039000 3300006931 Bacteria 4764
554 Ga0097620_100045760 3300006931 Bacteria 4396
555 Ga0097620_100089193 3300006931 Bacteria 3134
556 Ga0097620_100117285 3300006931 Unclassified 2727
557 Ga0097620_100186561 3300006931 Bacteria 2157
558 Ga0097620_100549460 3300006931 Bacteria 1249
559 Ga0097620_100813782 3300006931 Unclassified 1021
560 Ga0097620_100816270 3300006931 Bacteria 1020
561 Ga0097620_101009298 3300006931 Bacteria 914
562 Ga0097620_101536739 3300006931 Unclassified 735
563 Ga0097620_101572300 3300006931 Bacteria 726
564 Ga0097620_101673356 3300006931 Unclassified 703
565 Ga0075435_100002880 3300007076 Bacteria 11534
566 Ga0075435_100010137 3300007076 Bacteria 6882
567 Ga0075435_100058881 3300007076 Bacteria 3112
568 Ga0075435_100065154 3300007076 Bacteria 2961
569 Ga0075435_100178693 3300007076 Bacteria 1793
570 Ga0075435_100371504 3300007076 Unclassified 1228
571 Ga0075435_100479813 3300007076 Bacteria 1074
572 Ga0075435_100917712 3300007076 Bacteria 764
573 Ga0105244_10271737 3300009036 Bacteria 787
574 Ga0111539_10000542 3300009094 Bacteria 48084
575 Ga0111539_10018201 3300009094 Bacteria 8703
576 Ga0111539_10022938 3300009094 Bacteria 7663
577 Ga0111539_10029838 3300009094 Bacteria 6635
578 Ga0111539_10055826 3300009094 Bacteria 4695
579 Ga0111539_10103964 3300009094 Bacteria 3333
580 Ga0111539_10197442 3300009094 Bacteria 2347
581 Ga0111539_10197900 3300009094 Bacteria 2344
582 Ga0111539_10216760 3300009094 Bacteria 2229
583 Ga0111539_10229720 3300009094 Bacteria 2160
584 Ga0111539_10255737 3300009094 Bacteria 2039
585 Ga0111539_10619556 3300009094 Bacteria 1260
586 Ga0111539_10739421 3300009094 Bacteria 1145
587 Ga0111539_11007936 3300009094 Bacteria 968
588 Ga0111539_12361096 3300009094 Bacteria 617
589 Ga0111539_12542578 3300009094 Unclassified 594
590 Ga0105245_10116409 3300009098 Bacteria 2492
591 Ga0105247_11742608 3300009101 Unclassified 516
592 Ga0114129_10001659 3300009147 Bacteria 30298
593 Ga0114129_10002530 3300009147 Bacteria 25397
594 Ga0114129_10003888 3300009147 Bacteria 21072
595 Ga0114129_10007226 3300009147 Bacteria 15811
596 Ga0114129_10016436 3300009147 Bacteria 10531
597 Ga0114129_10033249 3300009147 Bacteria 7288
598 Ga0114129_10086038 3300009147 Bacteria 4360
599 Ga0114129_10116266 3300009147 Bacteria 3686
600 Ga0114129_10223067 3300009147 Bacteria 2542
601 Ga0114129_10296290 3300009147 Unclassified 2157
602 Ga0114129_10305021 3300009147 Bacteria 2121
603 Ga0114129_10394086 3300009147 Bacteria 1826
604 Ga0114129_10484547 3300009147 Bacteria 1618
605 Ga0114129_10540513 3300009147 Bacteria 1517
606 Ga0114129_10800058 3300009147 Unclassified 1203
607 Ga0114129_11401400 3300009147 Bacteria 862
608 Ga0114129_11829108 3300009147 Unclassified 738
609 Ga0114129_12217607 3300009147 Unclassified 661
610 Ga0114129_12794571 3300009147 Unclassified 580
611 Ga0105243_10050813 3300009148 Bacteria 3277
612 Ga0105243_10093757 3300009148 Bacteria 2478
613 Ga0105243_10158402 3300009148 Bacteria 1950
614 Ga0105243_10740098 3300009148 Bacteria 963
615 Ga0105243_11607989 3300009148 Bacteria 676
616 Ga0105243_11969344 3300009148 Unclassified 618
617 Ga0105243_12028349 3300009148 Bacteria 610
618 Ga0105241_10327782 3300009174 Unclassified 1322
619 Ga0105242_10065331 3300009176 Bacteria 3001
620 Ga0105242_10244483 3300009176 Bacteria 1615
621 Ga0105242_11084179 3300009176 Bacteria 814
622 Ga0105242_12831945 3300009176 Bacteria 535
623 Ga0105242_12833620 3300009176 Unclassified 535
624 Ga0105248_10016814 3300009177 Bacteria 8052
625 Ga0105248_10051872 3300009177 Bacteria 4603
626 Ga0105248_10199006 3300009177 Bacteria 2257
627 Ga0105248_10346905 3300009177 Bacteria 1671
628 Ga0105248_10350036 3300009177 Bacteria 1663
629 Ga0105248_10396219 3300009177 Bacteria 1555
630 Ga0105248_10499315 3300009177 Bacteria 1372
631 Ga0105248_10977960 3300009177 Bacteria 956
632 Ga0105248_12605035 3300009177 Unclassified 576
633 Ga0105238_10700108 3300009551 Bacteria 1025
634 Ga0105249_10000672 3300009553 Bacteria 31059
635 Ga0105249_10001821 3300009553 Bacteria 18542
636 Ga0105249_10018156 3300009553 Bacteria 6253
637 Ga0105249_10118253 3300009553 Bacteria 2515
638 Ga0105249_10157278 3300009553 Bacteria 2193
639 Ga0105249_10252825 3300009553 Bacteria 1748
640 Ga0105249_10946030 3300009553 Unclassified 929
641 Ga0105249_11171369 3300009553 Unclassified 839
642 Ga0105249_11230770 3300009553 Unclassified 820
643 Ga0105249_11285126 3300009553 Unclassified 803
644 Ga0105249_12553917 3300009553 Bacteria 583
645 Ga0105239_10799423 3300010375 Unclassified 1081
646 Ga0105246_10364554 3300011119 Bacteria 1188
647 Ga0105246_10681296 3300011119 Bacteria 899
648 Ga0157321_1003202 3300012487 Bacteria 962
649 Ga0157313_1032810 3300012503 Bacteria 599
650 Ga0157373_10850033 3300013100 Unclassified 675
651 Ga0157374_10185254 3300013296 Unclassified 2035
652 Ga0157374_11254284 3300013296 Bacteria 763
653 Ga0157378_10137274 3300013297 Bacteria 2268
654 Ga0157378_10158732 3300013297 Bacteria 2113
655 Ga0157378_10513867 3300013297 Bacteria 1198
656 Ga0163162_10007803 3300013306 Bacteria 10433
657 Ga0163162_10033381 3300013306 Bacteria 5114
658 Ga0163162_10087199 3300013306 Unclassified 3199
659 Ga0163162_12395422 3300013306 Unclassified 607
660 Ga0157372_10077056 3300013307 Bacteria 3765
661 Ga0157375_10011615 3300013308 Bacteria 7781
662 Ga0157375_10015562 3300013308 Bacteria 6813
663 Ga0157375_10166603 3300013308 Bacteria 2348
664 Ga0157375_10320781 3300013308 Bacteria 1714
665 Ga0157375_10397378 3300013308 Unclassified 1545
666 Ga0157375_10422420 3300013308 Bacteria 1499
667 Ga0157375_11005624 3300013308 Unclassified 973
668 Ga0163163_10000005 3300014325 Bacteria 369548
669 Ga0163163_10098812 3300014325 Bacteria 2940
670 Ga0163163_10247540 3300014325 Bacteria 1833
671 Ga0163163_10569774 3300014325 Bacteria 1195
672 Ga0163163_11206194 3300014325 Unclassified 819
673 Ga0163163_11691809 3300014325 Unclassified 693
674 Ga0163163_12133385 3300014325 Bacteria 620
675 Ga0157380_10067669 3300014326 Bacteria 2877
676 Ga0157380_10166625 3300014326 Bacteria 1921
677 Ga0157380_10196563 3300014326 Bacteria 1785
678 Ga0157380_10236903 3300014326 Bacteria 1643
679 Ga0157380_10252800 3300014326 Bacteria 1596
680 Ga0157380_10311064 3300014326 Unclassified 1456
681 Ga0157380_10412115 3300014326 Bacteria 1286
682 Ga0157380_10437948 3300014326 Unclassified 1252
683 Ga0157380_10458235 3300014326 Bacteria 1227
684 Ga0157380_10539319 3300014326 Bacteria 1142
685 Ga0157380_10631087 3300014326 Bacteria 1065
686 Ga0157380_10663926 3300014326 Bacteria 1042
687 Ga0157380_10843307 3300014326 Unclassified 937
688 Ga0157377_10042179 3300014745 Bacteria 2534
689 Ga0157377_10044023 3300014745 Bacteria 2487
690 Ga0157377_10096840 3300014745 Bacteria 1751
691 Ga0157377_10117014 3300014745 Bacteria 1610
692 Ga0157377_10171699 3300014745 Bacteria 1357
693 Ga0157377_10449125 3300014745 Bacteria 889
694 Ga0157379_10013361 3300014968 Bacteria 7190
695 Ga0157379_10392981 3300014968 Bacteria 1274
696 Ga0157379_11528393 3300014968 Bacteria 650
697 Ga0157376_10051020 3300014969 Bacteria 3435
698 Ga0157376_10083020 3300014969 Bacteria 2755
699 Ga0157376_10362594 3300014969 Bacteria 1390
700 Ga0157376_10415068 3300014969 Bacteria 1305
701 Ga0157376_10475218 3300014969 Bacteria 1224
702 Ga0157376_10844177 3300014969 Bacteria 931
703 Ga0182007_10407725 3300015262 Bacteria 519
704 Ga0163161_10114895 3300017792 Bacteria 2017
705 Ga0163161_10488411 3300017792 Unclassified 1001
706 Ga0207666_1006342 3300025271 Bacteria 1532
707 Ga0207673_1001644 3300025290 Bacteria 2469
708 Ga0207697_10000027 3300025315 Bacteria 51720
709 Ga0207697_10027070 3300025315 Bacteria 2345
710 Ga0207697_10046882 3300025315 Bacteria 1781
711 Ga0207697_10140340 3300025315 Bacteria 1048
712 Ga0207697_10306687 3300025315 Unclassified 704
713 Ga0207656_10133562 3300025321 Unclassified 1164
714 Ga0207653_10040120 3300025885 Bacteria 1534
715 Ga0207653_10213155 3300025885 Unclassified 731
716 Ga0207682_10004644 3300025893 Bacteria 5708
717 Ga0207682_10008666 3300025893 Bacteria 4021
718 Ga0207682_10016389 3300025893 Bacteria 2890
719 Ga0207682_10243992 3300025893 Bacteria 835
720 Ga0207682_10250462 3300025893 Bacteria 824
721 Ga0207682_10256282 3300025893 Bacteria 815
722 Ga0207682_10317813 3300025893 Unclassified 731
723 Ga0207682_10345322 3300025893 Bacteria 701
724 Ga0207642_10061947 3300025899 Bacteria 1742
725 Ga0207642_10258510 3300025899 Bacteria 992
726 Ga0207688_10000041 3300025901 Bacteria 44495
727 Ga0207688_10028006 3300025901 Bacteria 3100
728 Ga0207688_10134788 3300025901 Unclassified 1449
729 Ga0207688_10237014 3300025901 Unclassified 1103
730 Ga0207688_10796349 3300025901 Bacteria 599
731 Ga0207688_10917629 3300025901 Unclassified 554
732 Ga0207680_10020405 3300025903 Bacteria 3566
733 Ga0207680_10023926 3300025903 Bacteria 3343
734 Ga0207680_10293039 3300025903 Bacteria 1133
735 Ga0207647_10025156 3300025904 Bacteria 3918
736 Ga0207647_10370539 3300025904 Bacteria 809
737 Ga0207645_10000227 3300025907 Bacteria 46640
738 Ga0207645_10002713 3300025907 Bacteria 13791
739 Ga0207645_10205039 3300025907 Bacteria 1298
740 Ga0207645_10307239 3300025907 Bacteria 1056
741 Ga0207645_10327622 3300025907 Bacteria 1022
742 Ga0207645_11235142 3300025907 Bacteria 501
743 Ga0207643_10005161 3300025908 Bacteria 6986
744 Ga0207643_10023237 3300025908 Bacteria 3418
745 Ga0207643_10038219 3300025908 Bacteria 2696
746 Ga0207643_10092900 3300025908 Bacteria 1761
747 Ga0207643_10195992 3300025908 Unclassified 1228
748 Ga0207643_10234962 3300025908 Bacteria 1125
749 Ga0207643_10411311 3300025908 Bacteria 856
750 Ga0207643_10793075 3300025908 Bacteria 614
751 Ga0207643_10919221 3300025908 Bacteria 567
752 Ga0207643_10935585 3300025908 Unclassified 561
753 Ga0207684_10095825 3300025910 Bacteria 2532
754 Ga0207684_10220997 3300025910 Bacteria 1635
755 Ga0207684_10518557 3300025910 Bacteria 1021
756 Ga0207684_10920302 3300025910 Unclassified 734
757 Ga0207684_11023530 3300025910 Unclassified 690
758 Ga0207654_10158211 3300025911 Bacteria 1461
759 Ga0207707_10030021 3300025912 Bacteria 4753
760 Ga0207693_10032205 3300025915 Bacteria 4138
761 Ga0207693_10741698 3300025915 Bacteria 759
762 Ga0207660_10166418 3300025917 Unclassified 1704
763 Ga0207660_10184365 3300025917 Bacteria 1623
764 Ga0207660_10384042 3300025917 Bacteria 1129
765 Ga0207660_10451738 3300025917 Bacteria 1039
766 Ga0207660_11460858 3300025917 Bacteria 553
767 Ga0207662_10003200 3300025918 Bacteria 8383
768 Ga0207662_10030980 3300025918 Bacteria 3107
769 Ga0207662_10156944 3300025918 Bacteria 1451
770 Ga0207662_10160812 3300025918 Bacteria 1435
771 Ga0207662_10194251 3300025918 Bacteria 1311
772 Ga0207662_10237935 3300025918 Bacteria 1191
773 Ga0207662_10470489 3300025918 Unclassified 862
774 Ga0207657_10295678 3300025919 Bacteria 1283
775 Ga0207657_10798209 3300025919 Unclassified 730
776 Ga0207649_10018539 3300025920 Bacteria 3961
777 Ga0207649_10157926 3300025920 Bacteria 1569
778 Ga0207649_10601098 3300025920 Bacteria 846
779 Ga0207649_10639142 3300025920 Bacteria 821
780 Ga0207652_10189796 3300025921 Bacteria 1848
781 Ga0207646_10120102 3300025922 Unclassified 2361
782 Ga0207646_10166324 3300025922 Bacteria 1991
783 Ga0207646_10288753 3300025922 Bacteria 1482
784 Ga0207646_10390394 3300025922 Bacteria 1257
785 Ga0207646_11755045 3300025922 Bacteria 532
786 Ga0207681_10003610 3300025923 Bacteria 9630
787 Ga0207681_10010850 3300025923 Bacteria 5597
788 Ga0207681_10153791 3300025923 Bacteria 1727
789 Ga0207681_10253884 3300025923 Unclassified 1374
790 Ga0207681_10390341 3300025923 Bacteria 1122
791 Ga0207681_10534268 3300025923 Bacteria 963
792 Ga0207681_10958236 3300025923 Bacteria 717
793 Ga0207681_11087563 3300025923 Unclassified 671
794 Ga0207681_11486801 3300025923 Bacteria 568
795 Ga0207694_11386903 3300025924 Bacteria 594
796 Ga0207650_10028707 3300025925 Bacteria 3992
797 Ga0207650_10060265 3300025925 Bacteria 2832
798 Ga0207650_10141949 3300025925 Bacteria 1889
799 Ga0207650_10194492 3300025925 Bacteria 1622
800 Ga0207650_10216404 3300025925 Bacteria 1540
801 Ga0207650_10221723 3300025925 Bacteria 1522
802 Ga0207650_10536255 3300025925 Unclassified 980
803 Ga0207650_10624260 3300025925 Unclassified 907
804 Ga0207650_10983689 3300025925 Unclassified 717
805 Ga0207650_11133404 3300025925 Bacteria 666
806 Ga0207650_11268438 3300025925 Bacteria 627
807 Ga0207659_10010993 3300025926 Bacteria 5702
808 Ga0207659_10043481 3300025926 Bacteria 3155
809 Ga0207659_10067577 3300025926 Unclassified 2596
810 Ga0207659_10147189 3300025926 Bacteria 1835
811 Ga0207659_10153099 3300025926 Unclassified 1802
812 Ga0207659_10381905 3300025926 Bacteria 1175
813 Ga0207659_10424576 3300025926 Unclassified 1115
814 Ga0207659_10425176 3300025926 Bacteria 1115
815 Ga0207659_10461407 3300025926 Unclassified 1071
816 Ga0207659_10502597 3300025926 Bacteria 1026
817 Ga0207659_10503555 3300025926 Bacteria 1025
818 Ga0207659_10607906 3300025926 Unclassified 932
819 Ga0207659_10868420 3300025926 Unclassified 775
820 Ga0207659_11014355 3300025926 Bacteria 714
821 Ga0207659_11087766 3300025926 Bacteria 688
822 Ga0207659_11088966 3300025926 Bacteria 687
823 Ga0207687_10405824 3300025927 Unclassified 1122
824 Ga0207687_10822312 3300025927 Unclassified 793
825 Ga0207687_10996575 3300025927 Bacteria 718
826 Ga0207700_10005256 3300025928 Bacteria 7717
827 Ga0207644_10018034 3300025931 Bacteria 4771
828 Ga0207644_10452454 3300025931 Bacteria 1055
829 Ga0207644_10630925 3300025931 Bacteria 891
830 Ga0207644_11208531 3300025931 Bacteria 635
831 Ga0207690_10046001 3300025932 Bacteria 2887
832 Ga0207690_10121160 3300025932 Bacteria 1900
833 Ga0207690_10177085 3300025932 Bacteria 1603
834 Ga0207690_10610160 3300025932 Bacteria 891
835 Ga0207690_10799958 3300025932 Bacteria 779
836 Ga0207690_11035729 3300025932 Bacteria 683
837 Ga0207706_10005190 3300025933 Bacteria 12159
838 Ga0207706_10044964 3300025933 Unclassified 3912
839 Ga0207706_10156986 3300025933 Bacteria 2000
840 Ga0207706_10756872 3300025933 Bacteria 827
841 Ga0207706_11007593 3300025933 Bacteria 699
842 Ga0207686_10251325 3300025934 Bacteria 1292
843 Ga0207686_10254623 3300025934 Unclassified 1284
844 Ga0207686_10284028 3300025934 Bacteria 1223
845 Ga0207686_10737134 3300025934 Bacteria 786
846 Ga0207709_10015105 3300025935 Bacteria 4278
847 Ga0207709_10049606 3300025935 Bacteria 2563
848 Ga0207709_11612661 3300025935 Unclassified 539
849 Ga0207670_10032315 3300025936 Bacteria 3364
850 Ga0207670_10139766 3300025936 Bacteria 1785
851 Ga0207670_10155653 3300025936 Unclassified 1701
852 Ga0207670_10182884 3300025936 Bacteria 1580
853 Ga0207670_10830035 3300025936 Unclassified 771
854 Ga0207670_11013481 3300025936 Bacteria 699
855 Ga0207670_11910668 3300025936 Unclassified 505
856 Ga0207669_10037520 3300025937 Bacteria 2781
857 Ga0207669_10135020 3300025937 Bacteria 1702
858 Ga0207669_10172455 3300025937 Bacteria 1541
859 Ga0207669_10516967 3300025937 Bacteria 958
860 Ga0207704_10057827 3300025938 Bacteria 2385
861 Ga0207704_10085927 3300025938 Unclassified 2050
862 Ga0207704_10092318 3300025938 Bacteria 1992
863 Ga0207704_10173570 3300025938 Unclassified 1549
864 Ga0207704_10447504 3300025938 Unclassified 1030
865 Ga0207704_10984942 3300025938 Bacteria 712
866 Ga0207665_10822309 3300025939 Bacteria 735
867 Ga0207691_10000239 3300025940 Bacteria 53779
868 Ga0207691_10036868 3300025940 Bacteria 4529
869 Ga0207691_10043175 3300025940 Bacteria 4155
870 Ga0207691_10046646 3300025940 Bacteria 3980
871 Ga0207691_10051379 3300025940 Bacteria 3769
872 Ga0207691_10295663 3300025940 Bacteria 1392
873 Ga0207691_10360409 3300025940 Bacteria 1243
874 Ga0207691_10869975 3300025940 Archaea 755
875 Ga0207691_11609732 3300025940 Bacteria 528
876 Ga0207711_10021329 3300025941 Bacteria 5412
877 Ga0207711_10031939 3300025941 Bacteria 4449
878 Ga0207711_10204662 3300025941 Bacteria 1802
879 Ga0207711_10268590 3300025941 Bacteria 1569
880 Ga0207711_10349380 3300025941 Bacteria 1369
881 Ga0207711_10691829 3300025941 Bacteria 951
882 Ga0207711_11193478 3300025941 Unclassified 702
883 Ga0207711_12144345 3300025941 Unclassified 501
884 Ga0207689_10003638 3300025942 Bacteria 14080
885 Ga0207689_10014641 3300025942 Bacteria 6663
886 Ga0207689_10029381 3300025942 Bacteria 4591
887 Ga0207689_10035267 3300025942 Bacteria 4157
888 Ga0207689_10084114 3300025942 Bacteria 2615
889 Ga0207689_10133601 3300025942 Bacteria 2043
890 Ga0207689_10336412 3300025942 Bacteria 1254
891 Ga0207689_10723935 3300025942 Bacteria 839
892 Ga0207661_11810926 3300025944 Unclassified 556
893 Ga0207679_10026957 3300025945 Bacteria 3968
894 Ga0207679_10056775 3300025945 Unclassified 2892
895 Ga0207679_10061779 3300025945 Bacteria 2790
896 Ga0207679_10237538 3300025945 Bacteria 1542
897 Ga0207679_10240027 3300025945 Bacteria 1535
898 Ga0207679_10359356 3300025945 Bacteria 1271
899 Ga0207679_10429603 3300025945 Bacteria 1167
900 Ga0207679_10905811 3300025945 Bacteria 807
901 Ga0207679_11979131 3300025945 Unclassified 531
902 Ga0207667_10511748 3300025949 Bacteria 1217
903 Ga0207651_10047431 3300025960 Bacteria 2896
904 Ga0207651_10065560 3300025960 Unclassified 2547
905 Ga0207651_10156442 3300025960 Bacteria 1781
906 Ga0207651_10274330 3300025960 Bacteria 1390
907 Ga0207651_10331791 3300025960 Unclassified 1275
908 Ga0207651_10513033 3300025960 Unclassified 1038
909 Ga0207651_10540266 3300025960 Bacteria 1012
910 Ga0207651_10677082 3300025960 Unclassified 907
911 Ga0207651_10722213 3300025960 Bacteria 879
912 Ga0207712_10020206 3300025961 Bacteria 4360
913 Ga0207712_10025216 3300025961 Bacteria 3949
914 Ga0207712_10087933 3300025961 Bacteria 2280
915 Ga0207712_10131257 3300025961 Unclassified 1909
916 Ga0207712_10347558 3300025961 Bacteria 1232
917 Ga0207712_10447097 3300025961 Unclassified 1095
918 Ga0207712_11092920 3300025961 Unclassified 710
919 Ga0207712_11118843 3300025961 Bacteria 701
920 Ga0207712_11773909 3300025961 Unclassified 553
921 Ga0207668_10255299 3300025972 Bacteria 1426
922 Ga0207668_10347608 3300025972 Bacteria 1239
923 Ga0207668_10686280 3300025972 Bacteria 899
924 Ga0207668_10824329 3300025972 Bacteria 822
925 Ga0207668_11414219 3300025972 Bacteria 627
926 Ga0207668_11543854 3300025972 Bacteria 599
927 Ga0207640_10102475 3300025981 Bacteria 2010
928 Ga0207640_10965696 3300025981 Unclassified 748
929 Ga0207658_10069444 3300025986 Bacteria 2662
930 Ga0207658_10191923 3300025986 Bacteria 1699
931 Ga0207658_10219518 3300025986 Bacteria 1599
932 Ga0207658_10432497 3300025986 Bacteria 1162
933 Ga0207658_10590333 3300025986 Unclassified 997
934 Ga0207677_10055612 3300026023 Bacteria 2707
935 Ga0207677_10489755 3300026023 Bacteria 1061
936 Ga0207677_10781184 3300026023 Bacteria 853
937 Ga0207677_11029476 3300026023 Bacteria 748
938 Ga0207677_11574095 3300026023 Bacteria 608
939 Ga0207703_10009365 3300026035 Bacteria 7697
940 Ga0207703_10041677 3300026035 Bacteria 3680
941 Ga0207703_10109568 3300026035 Bacteria 2354
942 Ga0207703_10141957 3300026035 Bacteria 2085
943 Ga0207703_10825891 3300026035 Bacteria 886
944 Ga0207639_10066993 3300026041 Bacteria 2793
945 Ga0207678_10201267 3300026067 Unclassified 1703
946 Ga0207678_10867584 3300026067 Unclassified 798
947 Ga0207708_10008322 3300026075 Bacteria 7681
948 Ga0207708_10035461 3300026075 Bacteria 3796
949 Ga0207708_10112169 3300026075 Bacteria 2118
950 Ga0207708_10148739 3300026075 Bacteria 1842
951 Ga0207708_10262877 3300026075 Bacteria 1393
952 Ga0207708_10639095 3300026075 Unclassified 905
953 Ga0207708_10644522 3300026075 Bacteria 901
954 Ga0207708_10803718 3300026075 Bacteria 810
955 Ga0207708_10968341 3300026075 Bacteria 738
956 Ga0207641_10053541 3300026088 Unclassified 3421
957 Ga0207641_10148494 3300026088 Bacteria 2121
958 Ga0207641_10216711 3300026088 Bacteria 1773
959 Ga0207641_10388821 3300026088 Bacteria 1337
960 Ga0207641_11899274 3300026088 Bacteria 597
961 Ga0207641_12387757 3300026088 Bacteria 528
962 Ga0207648_10005096 3300026089 Bacteria 13314
963 Ga0207648_10009645 3300026089 Bacteria 9232
964 Ga0207648_10051234 3300026089 Bacteria 3608
965 Ga0207648_10102428 3300026089 Bacteria 2509
966 Ga0207648_10178752 3300026089 Unclassified 1877
967 Ga0207648_10270290 3300026089 Bacteria 1519
968 Ga0207648_10516875 3300026089 Archaea 1094
969 Ga0207648_10649501 3300026089 Unclassified 975
970 Ga0207648_10740261 3300026089 Unclassified 913
971 Ga0207648_11434418 3300026089 Bacteria 649
972 Ga0207648_12071355 3300026089 Unclassified 530
973 Ga0207676_10092775 3300026095 Bacteria 2484
974 Ga0207676_10175669 3300026095 Bacteria 1870
975 Ga0207676_10263626 3300026095 Unclassified 1557
976 Ga0207676_10540002 3300026095 Unclassified 1112
977 Ga0207676_11142258 3300026095 Bacteria 771
978 Ga0207674_10107420 3300026116 Bacteria 2768
979 Ga0207674_10108580 3300026116 Bacteria 2751
980 Ga0207674_10131336 3300026116 Bacteria 2467
981 Ga0207674_10158850 3300026116 Bacteria 2215
982 Ga0207674_10323039 3300026116 Bacteria 1493
983 Ga0207674_11064609 3300026116 Bacteria 778
984 Ga0207675_100005724 3300026118 Bacteria 11891
985 Ga0207675_100022564 3300026118 Bacteria 5860
986 Ga0207675_100070901 3300026118 Bacteria 3257
987 Ga0207675_100166549 3300026118 Bacteria 2105
988 Ga0207675_100429742 3300026118 Bacteria 1305
989 Ga0207675_100781734 3300026118 Bacteria 967
990 Ga0207675_101457217 3300026118 Bacteria 705
991 Ga0207675_101458169 3300026118 Unclassified 705
992 Ga0207675_102190776 3300026118 Bacteria 568
993 Ga0207683_10002140 3300026121 Bacteria 17343
994 Ga0207683_10036397 3300026121 Bacteria 4286
995 Ga0207683_10084807 3300026121 Bacteria 2816
996 Ga0207683_10129472 3300026121 Bacteria 2269
997 Ga0207683_10167894 3300026121 Bacteria 1986
998 Ga0207683_10171952 3300026121 Unclassified 1962
999 Ga0207683_10256952 3300026121 Bacteria 1595
1000 Ga0207683_10438629 3300026121 Unclassified 1204
1001 Ga0207683_10445439 3300026121 Bacteria 1194
1002 Ga0207683_11183201 3300026121 Bacteria 709
1003 Ga0207698_10215666 3300026142 Bacteria 1730
1004 Ga0207698_10266732 3300026142 Bacteria 1576
1005 Ga0207698_10401482 3300026142 Bacteria 1310
1006 Ga0207698_10527512 3300026142 Unclassified 1153
1007 Ga0207698_10565191 3300026142 Bacteria 1117
1008 Ga0209973_1018226 3300027252 Unclassified 909
1009 Ga0209969_1065712 3300027360 Bacteria 575
1010 Ga0209996_1063244 3300027395 Bacteria 570
1011 Ga0210000_1040959 3300027462 Bacteria 735
1012 Ga0209968_1006266 3300027526 Bacteria 1791
1013 Ga0209999_1031658 3300027543 Bacteria 982
1014 Ga0209982_1025828 3300027552 Bacteria 914
1015 Ga0209970_1014763 3300027614 Bacteria 1298
1016 Ga0210002_1026697 3300027617 Unclassified 948
1017 Ga0209983_1058324 3300027665 Bacteria 851
1018 Ga0209998_10095070 3300027717 Unclassified 734
1019 Ga0209813_10021164 3300027866 Bacteria 1826
1020 Ga0209974_10057113 3300027876 Bacteria 1318
1021 Ga0209974_10066894 3300027876 Bacteria 1221
1022 Ga0207428_10000349 3300027907 Bacteria 59671
1023 Ga0207428_10000712 3300027907 Bacteria 38459
1024 Ga0207428_10003385 3300027907 Bacteria 15501
1025 Ga0207428_10003621 3300027907 Bacteria 14905
1026 Ga0207428_10005253 3300027907 Bacteria 12100
1027 Ga0207428_10014253 3300027907 Bacteria 6916
1028 Ga0207428_10020924 3300027907 Bacteria 5546
1029 Ga0207428_10092864 3300027907 Unclassified 2342
1030 Ga0207428_10149291 3300027907 Bacteria 1780
1031 Ga0207428_10364693 3300027907 Bacteria 1061
1032 Ga0207428_10436585 3300027907 Bacteria 955
1033 Ga0207428_10518742 3300027907 Bacteria 864
1034 Ga0207428_10590962 3300027907 Unclassified 800
1035 Ga0207428_10692890 3300027907 Bacteria 729
1036 Ga0268266_11071921 3300028379 Bacteria 780
1037 Ga0268266_11283796 3300028379 Bacteria 707
1038 Ga0268265_10001193 3300028380 Bacteria 22642
1039 Ga0268265_10009264 3300028380 Bacteria 6654
1040 Ga0268265_10019011 3300028380 Bacteria 4770
1041 Ga0268265_10315492 3300028380 Bacteria 1413
1042 Ga0268265_10361483 3300028380 Bacteria 1329
1043 Ga0268265_10421163 3300028380 Unclassified 1240
1044 Ga0268265_10447961 3300028380 Bacteria 1205
1045 Ga0268265_10557341 3300028380 Bacteria 1089
1046 Ga0268265_10850355 3300028380 Bacteria 893
1047 Ga0268265_10990743 3300028380 Bacteria 830
1048 Ga0268264_10041346 3300028381 Bacteria 3813
1049 Ga0268264_10090200 3300028381 Unclassified 2641
1050 Ga0268264_10321033 3300028381 Unclassified 1464
1051 Ga0268264_10458881 3300028381 Unclassified 1236
1052 Ga0268264_10591113 3300028381 Bacteria 1093
1053 Ga0316178_1121891 3300030735 Bacteria 603
1054 Ga0316178_1125099 3300030735 Bacteria 536
1055 Ga0307408_100045422 3300031548 Bacteria 3137
1056 Ga0307408_100078654 3300031548 Bacteria 2459
1057 Ga0307408_100110251 3300031548 Bacteria 2113
1058 Ga0307408_100327780 3300031548 Bacteria 1292
1059 Ga0307408_100330602 3300031548 Unclassified 1287
1060 Ga0307408_100535976 3300031548 Bacteria 1031
1061 Ga0307408_100585827 3300031548 Bacteria 989
1062 Ga0307408_100740419 3300031548 Bacteria 887
1063 Ga0307408_100985467 3300031548 Bacteria 776
1064 Ga0307405_10036153 3300031731 Bacteria 2956
1065 Ga0307405_10103932 3300031731 Bacteria 1911
1066 Ga0307405_10279159 3300031731 Bacteria 1256
1067 Ga0307405_10433885 3300031731 Bacteria 1037
1068 Ga0307405_10530239 3300031731 Bacteria 949
1069 Ga0307413_10082909 3300031824 Bacteria 2061
1070 Ga0307413_10212256 3300031824 Unclassified 1407
1071 Ga0307413_10296776 3300031824 Bacteria 1224
1072 Ga0307413_10556385 3300031824 Unclassified 931
1073 Ga0307413_10771005 3300031824 Bacteria 806
1074 Ga0307413_11568089 3300031824 Bacteria 584
1075 Ga0307413_11854035 3300031824 Unclassified 541
1076 Ga0307410_10033548 3300031852 Bacteria 3315
1077 Ga0307410_10035916 3300031852 Bacteria 3223
1078 Ga0307410_10127209 3300031852 Bacteria 1867
1079 Ga0307410_10252476 3300031852 Bacteria 1372
1080 Ga0307410_10451403 3300031852 Unclassified 1049
1081 Ga0307410_10819182 3300031852 Bacteria 793
1082 Ga0307406_10028273 3300031901 Bacteria 3387
1083 Ga0307406_10032820 3300031901 Bacteria 3172
1084 Ga0307406_10258929 3300031901 Bacteria 1315
1085 Ga0307406_10306786 3300031901 Bacteria 1222
1086 Ga0307406_10376173 3300031901 Bacteria 1118
1087 Ga0307406_11163277 3300031901 Bacteria 668
1088 Ga0307406_11404059 3300031901 Unclassified 612
1089 Ga0307407_10009129 3300031903 Bacteria 4601
1090 Ga0307407_10069122 3300031903 Bacteria 2095
1091 Ga0307407_10437374 3300031903 Bacteria 946
1092 Ga0307407_10746492 3300031903 Unclassified 741
1093 Ga0307407_10818033 3300031903 Bacteria 710
1094 Ga0307407_10976059 3300031903 Bacteria 654
1095 Ga0307412_10021563 3300031911 Bacteria 3937
1096 Ga0307412_10072599 3300031911 Bacteria 2352
1097 Ga0307412_10248597 3300031911 Bacteria 1380
1098 Ga0307412_10287603 3300031911 Bacteria 1293
1099 Ga0307412_10325164 3300031911 Unclassified 1225
1100 Ga0307412_10461052 3300031911 Bacteria 1049
1101 Ga0307412_11031866 3300031911 Unclassified 728
1102 Ga0307412_11168664 3300031911 Archaea 688
1103 Ga0307412_12230138 3300031911 Bacteria 510
1104 Ga0307409_100011203 3300031995 Bacteria 5636
1105 Ga0307409_100022487 3300031995 Bacteria 4349
1106 Ga0307409_100026651 3300031995 Bacteria 4080
1107 Ga0307409_100098923 3300031995 Bacteria 2414
1108 Ga0307409_100184355 3300031995 Bacteria 1851
1109 Ga0307409_100207098 3300031995 Bacteria 1760
1110 Ga0307409_101677757 3300031995 Bacteria 664
1111 Ga0307409_102243049 3300031995 Unclassified 575
1112 Ga0307416_100001674 3300032002 Bacteria 12248
1113 Ga0307416_100009915 3300032002 Bacteria 6266
1114 Ga0307416_100026805 3300032002 Bacteria 4254
1115 Ga0307416_100056674 3300032002 Bacteria 3164
1116 Ga0307416_100131865 3300032002 Bacteria 2251
1117 Ga0307416_100153108 3300032002 Bacteria 2118
1118 Ga0307416_100160503 3300032002 Bacteria 2077
1119 Ga0307416_100620634 3300032002 Unclassified 1163
1120 Ga0307416_101043049 3300032002 Bacteria 921
1121 Ga0307416_101761539 3300032002 Unclassified 724
1122 Ga0307416_102224680 3300032002 Bacteria 649
1123 Ga0307416_102511534 3300032002 Unclassified 614
1124 Ga0307414_10358836 3300032004 Bacteria 1253
1125 Ga0307414_10674327 3300032004 Bacteria 934
1126 Ga0307414_10959155 3300032004 Unclassified 786
1127 Ga0307414_11053250 3300032004 Bacteria 750
1128 Ga0307414_11675213 3300032004 Bacteria 593
1129 Ga0307411_10012530 3300032005 Bacteria 4633
1130 Ga0307411_10033406 3300032005 Bacteria 3191
1131 Ga0307411_10045602 3300032005 Bacteria 2821
1132 Ga0307411_10142666 3300032005 Bacteria 1768
1133 Ga0307411_10272078 3300032005 Unclassified 1344
1134 Ga0307411_10332286 3300032005 Bacteria 1232
1135 Ga0307411_10401465 3300032005 Unclassified 1133
1136 Ga0307411_10402475 3300032005 Bacteria 1132
1137 Ga0307411_10480110 3300032005 Bacteria 1046
1138 Ga0307411_10629031 3300032005 Bacteria 926
1139 Ga0307411_10659286 3300032005 Bacteria 907
1140 Ga0307411_10720879 3300032005 Bacteria 871
1141 Ga0307411_11909683 3300032005 Bacteria 553
1142 Ga0307415_100014778 3300032126 Bacteria 4602
1143 Ga0307415_100044852 3300032126 Bacteria 2959
1144 Ga0307415_100238149 3300032126 Bacteria 1470
1145 Ga0307415_102053544 3300032126 Bacteria 557
1146 Ga0373930_0056077 3300034816 Bacteria 870
1147 Ga0373930_0143019 3300034816 Bacteria 595
1148 Ga0373948_0096995 3300034817 Unclassified 690
1149 Ga0373950_0140565 3300034818 Bacteria 546
1150 Ga0373959_0008472 3300034820 Bacteria 1751
1151 Ga0373938_0086091 3300034957 Bacteria 771
1152 Ga0373938_0090990 3300034957 Unclassified 755
1153 Ga0373928_0048271 3300035084 Bacteria 998
1154 Ga0373934_0004468 3300035086 Bacteria 5165
1155 Ga0373934_0277115 3300035086 Bacteria 694
1156 Ga0373940_0119441 3300035088 Bacteria 816
1157 Ga0373949_0016508 3300035090 Bacteria 1656
1158 Ga0373949_0086483 3300035090 Unclassified 842
1159 Ga0373951_0024736 3300035091 Bacteria 1392
1160 Ga0373923_0337989 3300035111 Bacteria 717
1161 Ga0373923_0590249 3300035111 Unclassified 546
1162 Ga0373932_0006139 3300035112 Bacteria 2837
1163 Ga0373939_0050966 3300035114 Unclassified 1285
1164 Ga0373953_0046414 3300035117 Bacteria 1744
1165 Ga0373956_0022440 3300035119 Bacteria 2701
1166 Ga0373956_0615016 3300035119 Bacteria 519
1167 Ga0373957_0044026 3300035120 Bacteria 1688
1168 Ga0373943_0647648 3300035170 Bacteria 624
1169 Ga0373946_0143261 3300035171 Bacteria 1109
1170 Ga0373955_0008601 3300035172 Bacteria 4747
1171 Ga0373961_0033334 3300035241 Bacteria 1450
1172 Ga0373962_0010858 3300035242 Bacteria 2277
1173 Ga0373962_0061456 3300035242 Unclassified 1104
1174 Ga0373931_0010056 3300035691 Bacteria 4537
1175 Ga0373935_0117923 3300035692 Bacteria 1770
1176 Ga0373933_0004292 3300035724 Bacteria 7832
1177 Ga0373947_0021292 3300035725 Bacteria 3752
1178 Ga0373947_0186396 3300035725 Bacteria 1353
1179 Ga0373937_0000636 3300036401 Bacteria 30772
1180 Ga0373937_0026134 3300036401 Bacteria 5275
1181 Ga0373937_0085337 3300036401 Bacteria 2922
1182 Ga0373925_1046224 3300037068 Archaea 672
1183 Ga0373925_1428439 3300037068 Unclassified 567
1184 Ga0436365_0953110 3300039437 Bacteria 892
1185 Ga0439439_0078764 3300041406 Bacteria 889
1186 Ga0439439_0091287 3300041406 Bacteria 832
1187 Ga0439447_144857 3300041407 Bacteria 546
1188 Ga0439453_0002220 3300041408 Bacteria 2647
1189 Ga0439453_0073614 3300041408 Unclassified 726
1190 Ga0451800_1242213 3300041459 Unclassified 711
1191 Ga0451802_1299424 3300041460 Bacteria 706
1192 Ga0451804_0497166 3300041463 Bacteria 515
1193 Ga0451807_2002591 3300041486 Unclassified 554
1194 Ga0451839_1004516 3300041496 Bacteria 838
1195 Ga0451853_2851514 3300041512 Unclassified 652
1196 Ga0451853_3766231 3300041512 Bacteria 1004
1197 Ga0439433_0034595 3300041999 Bacteria 1163
1198 Ga0439433_0110546 3300041999 Archaea 687
1199 Ga0439433_0197986 3300041999 Unclassified 530
1200 Ga0439443_031403 3300042003 Unclassified 877
1201 Ga0439449_0053239 3300042007 Unclassified 1496
1202 Ga0439450_005909 3300042008 Bacteria 2177
1203 Ga0439451_104283 3300042009 Bacteria 574
1204 Ga0439454_013548 3300042011 Bacteria 1121
1205 Ga0439455_0114671 3300042012 Unclassified 752
1206 Ga0439462_0025023 3300042015 Unclassified 1570
1207 Ga0450921_035558 3300042123 Bacteria 520
1208 Ga0450923_017462 3300042125 Unclassified 1363
1209 Ga0450923_159847 3300042125 Bacteria 548
1210 Ga0450896_015177 3300042133 Unclassified 1102
1211 Ga0450910_011732 3300042147 Unclassified 1260
1212 Ga0439446_0003023 3300042156 Bacteria 4122
1213 Ga0439446_0021022 3300042156 Bacteria 1842
1214 Ga0439446_0084355 3300042156 Bacteria 987
1215 Ga0439434_0054175 3300042435 Bacteria 1247
1216 Ga0439434_0055441 3300042435 Bacteria 1234
1217 Ga0439434_0062109 3300042435 Bacteria 1169
1218 Ga0439434_0114700 3300042435 Bacteria 875
1219 Ga0439434_0311933 3300042435 Unclassified 545
1220 Ga0439435_0003643 3300042436 Bacteria 3229
1221 Ga0439435_0011938 3300042436 Bacteria 2092
1222 Ga0439435_0102358 3300042436 Bacteria 881
1223 Ga0439435_0203733 3300042436 Bacteria 653
1224 Ga0439435_0209413 3300042436 Bacteria 645
1225 Ga0439464_0046054 3300042439 Bacteria 1253
1226 Ga0439464_0167033 3300042439 Bacteria 693
1227 Ga0439460_0043518 3300042461 Bacteria 1327
1228 Ga0439460_0158880 3300042461 Unclassified 757
1229 Ga0439460_0333968 3300042461 Bacteria 533
1230 Ga0451577_0038896 3300042876 Bacteria 4276
1231 Ga0451577_0533990 3300042876 Bacteria 1065
1232 Ga0451577_1053720 3300042876 Unclassified 729
1233 Ga0451577_1576744 3300042876 Bacteria 580
1234 Ga0451577_1619139 3300042876 Unclassified 571
1235 Ga0439440_0027927 3300042993 Bacteria 1314
1236 Ga0439440_0099536 3300042993 Unclassified 790
1237 Ga0439440_0166330 3300042993 Bacteria 639
1238 Ga0453683_0091878 3300044673 Bacteria 1903
1239 Ga0453683_0528129 3300044673 Bacteria 767
1240 Ga0451576_0012634 3300045051 Bacteria 9481
1241 Ga0451576_0031403 3300045051 Bacteria 5662
1242 Ga0451576_0058861 3300045051 Bacteria 4012
1243 Ga0451576_0259416 3300045051 Bacteria 1816
1244 Ga0451576_0273634 3300045051 Bacteria 1765
1245 Ga0451576_0323658 3300045051 Bacteria 1614
1246 Ga0451576_0583309 3300045051 Unclassified 1175
1247 Ga0451576_0618807 3300045051 Bacteria 1138
1248 Ga0451576_0620486 3300045051 Unclassified 1136
1249 Ga0451576_0970371 3300045051 Bacteria 891
1250 Ga0466967_0595390 3300045976 Bacteria 1091
1251 Ga0495592_0175793 3300046454 Bacteria 1462
1252 Ga0495592_0214714 3300046454 Bacteria 1290
1253 Ga0495592_0322870 3300046454 Bacteria 997
1254 Ga0495603_0028716 3300046455 Bacteria 3356
1255 Ga0495603_0203919 3300046455 Bacteria 1143
1256 Ga0495603_0304534 3300046455 Bacteria 915
1257 Ga0495591_095428 3300046458 Bacteria 742
1258 Ga0495629_0010127 3300046459 Bacteria 6876
1259 Ga0495629_0432018 3300046459 Archaea 893
1260 Ga0495629_0566880 3300046459 Bacteria 761
1261 Ga0495641_0411295 3300046461 Bacteria 614
1262 Ga0495651_0086226 3300046462 Bacteria 2363
1263 Ga0495653_0465696 3300046463 Bacteria 793
1264 Ga0495580_0068165 3300046472 Unclassified 2488
1265 Ga0495582_0102419 3300046473 Bacteria 1604
1266 Ga0495639_0089871 3300046475 Bacteria 1440
1267 Ga0495584_0006908 3300046491 Bacteria 5930
1268 Ga0495594_0244993 3300046499 Bacteria 1021
1269 Ga0495594_0579791 3300046499 Bacteria 636
1270 Ga0495596_0248217 3300046500 Bacteria 691
1271 Ga0495628_0282618 3300046516 Bacteria 1232
1272 Ga0495628_0886300 3300046516 Bacteria 620
1273 Ga0495630_0355794 3300046517 Bacteria 1121
1274 Ga0495643_0002815 3300046522 Bacteria 13276
1275 Ga0495644_0010822 3300046523 Bacteria 3515
1276 Ga0495663_0045519 3300046525 Bacteria 1345
1277 Ga0495663_0058320 3300046525 Bacteria 1210
1278 Ga0495663_0184678 3300046525 Bacteria 723
1279 Ga0495642_0020701 3300046528 Unclassified 2585
1280 Ga0495642_0067859 3300046528 Bacteria 1488
1281 Ga0495665_0218846 3300046531 Bacteria 985
1282 Ga0495665_0234161 3300046531 Bacteria 948
1283 Ga0495640_0476707 3300046533 Unclassified 760
1284 Ga0495598_0007773 3300046537 Bacteria 2473
1285 Ga0495598_0024579 3300046537 Bacteria 1635
1286 Ga0495598_0036341 3300046537 Bacteria 1415
1287 Ga0495598_0150546 3300046537 Unclassified 812
1288 Ga0495609_0012011 3300046538 Bacteria 4112
1289 Ga0495609_0042546 3300046538 Bacteria 2040
1290 Ga0495621_0014062 3300046539 Unclassified 2527
1291 Ga0495621_0027383 3300046539 Bacteria 1930
1292 Ga0495621_0042478 3300046539 Bacteria 1600
1293 Ga0495621_0095893 3300046539 Bacteria 1124
1294 Ga0495621_0148753 3300046539 Bacteria 920
1295 Ga0495621_0177310 3300046539 Bacteria 849
1296 Ga0495621_0401471 3300046539 Bacteria 581
1297 Ga0495645_0152782 3300046543 Unclassified 1602
1298 Ga0495645_0700655 3300046543 Bacteria 615
1299 Ga0495633_0042236 3300046558 Bacteria 2167
1300 Ga0495633_0366956 3300046558 Unclassified 652
1301 Ga0495656_0013094 3300046615 Bacteria 3077
1302 Ga0495656_0174465 3300046615 Bacteria 1053
1303 Ga0495656_0480620 3300046615 Unclassified 657
1304 Ga0495634_0108588 3300046642 Bacteria 1786
1305 Ga0495659_0004263 3300046664 Bacteria 4508
1306 Ga0495659_0014786 3300046664 Bacteria 2559
1307 Ga0495659_0024829 3300046664 Bacteria 2047
1308 Ga0495659_0028143 3300046664 Bacteria 1943
1309 Ga0495659_0035778 3300046664 Bacteria 1751
1310 Ga0495659_0184986 3300046664 Bacteria 850
1311 Ga0495588_0185482 3300046674 Bacteria 1099
1312 Ga0495657_0228745 3300046675 Bacteria 1126
1313 Ga0495599_0158825 3300046678 Bacteria 1398
1314 Ga0495599_0301724 3300046678 Unclassified 967
1315 Ga0495599_0393328 3300046678 Bacteria 826
1316 Ga0495647_0193634 3300046681 Bacteria 889
1317 Ga0495658_0022875 3300046683 Bacteria 3311
1318 Ga0495658_0300792 3300046683 Bacteria 1015
1319 Ga0495658_0340284 3300046683 Bacteria 953
1320 Ga0495658_0624089 3300046683 Bacteria 690
1321 Ga0495669_0072519 3300046684 Bacteria 1571
1322 Ga0495669_0146586 3300046684 Bacteria 1116
1323 Ga0495613_0114988 3300046689 Unclassified 1936
1324 Ga0495613_0500522 3300046689 Bacteria 818
1325 Ga0495670_0011708 3300046691 Bacteria 4318
1326 Ga0495600_0309593 3300046809 Unclassified 995
1327 Ga0495636_0009944 3300047318 Bacteria 3747
1328 Ga0495636_0090396 3300047318 Bacteria 1329
1329 Ga0495636_0509187 3300047318 Unclassified 583
1330 Ga0495636_0634507 3300047318 Unclassified 524
1331 Ga0495636_0674064 3300047318 Bacteria 509
1332 Ga0495680_0134588 3300047322 Bacteria 1813
1333 Ga0495680_0399604 3300047322 Bacteria 949
1334 Ga0495677_0049108 3300047445 Bacteria 1550
1335 Ga0495677_0118788 3300047445 Bacteria 1007
1336 Ga0495685_031609 3300047447 Bacteria 1819
1337 Ga0495681_0319422 3300047470 Bacteria 597
1338 Ga0495684_0089234 3300047471 Unclassified 2336
1339 Ga0495684_0460863 3300047471 Unclassified 881
1340 Ga0495684_0505847 3300047471 Bacteria 830
1341 Ga0495615_0316624 3300048090 Bacteria 509
1342 Ga0496100_0121371 3300048903 Bacteria 1829
1343 Ga0496101_0195879 3300048904 Bacteria 1561
1344 Ga0496101_0679749 3300048904 Bacteria 813
1345 Ga0496102_0206051 3300048905 Bacteria 1854
1346 Ga0496102_0261172 3300048905 Bacteria 1633
1347 Ga0496102_0269420 3300048905 Bacteria 1605
1348 Ga0496102_0569143 3300048905 Bacteria 1056
1349 Ga0496102_1671889 3300048905 Unclassified 555
1350 Ga0496103_0095295 3300048906 Bacteria 1881
1351 Ga0496103_0545996 3300048906 Bacteria 740
1352 Ga0496104_0174331 3300048907 Bacteria 2061
1353 Ga0496104_0460648 3300048907 Bacteria 1183
1354 Ga0496104_0738223 3300048907 Bacteria 892
1355 Ga0496104_0746304 3300048907 Bacteria 886
1356 Ga0496104_0970935 3300048907 Bacteria 754
1357 Ga0496105_0490804 3300048908 Bacteria 965
1358 Ga0496105_0744554 3300048908 Unclassified 749
1359 Ga0496106_0037675 3300048909 Bacteria 3618
1360 Ga0496106_0127079 3300048909 Bacteria 1997
1361 Ga0496106_0159753 3300048909 Bacteria 1782
1362 Ga0496106_0956915 3300048909 Bacteria 675
1363 Ga0496106_1354798 3300048909 Bacteria 551
1364 Ga0496106_1368031 3300048909 Unclassified 548
1365 Ga0496107_0060010 3300048910 Bacteria 2753
1366 Ga0496108_0801139 3300048911 Bacteria 813
1367 Ga0496108_0901811 3300048911 Bacteria 759
1368 Ga0496108_1104027 3300048911 Bacteria 674
1369 Ga0496109_0101586 3300048912 Bacteria 2669
1370 Ga0496109_0297960 3300048912 Bacteria 1520
1371 Ga0496109_0445681 3300048912 Unclassified 1223
1372 Ga0496110_0122855 3300048913 Bacteria 2341
1373 Ga0496110_0239227 3300048913 Bacteria 1652
1374 Ga0496111_0080696 3300048914 Bacteria 2374
1375 Ga0496112_0182869 3300048915 Bacteria 2060
1376 Ga0496112_0188578 3300048915 Bacteria 2024
1377 Ga0496112_0269256 3300048915 Bacteria 1652
1378 Ga0496112_0354959 3300048915 Bacteria 1408
1379 Ga0496112_0474935 3300048915 Bacteria 1187
1380 Ga0496113_0048818 3300048916 Bacteria 3150
1381 Ga0496113_0191155 3300048916 Bacteria 1625
1382 Ga0496113_0736987 3300048916 Bacteria 785
1383 Ga0496113_1322015 3300048916 Bacteria 560
1384 Ga0496114_0055265 3300048917 Bacteria 3312
1385 Ga0496114_0448148 3300048917 Unclassified 1143
1386 Ga0501292_067102 3300049515 Bacteria 661
1387 Ga0501298_045014 3300049521 Bacteria 902
1388 Ga0501299_087856 3300049522 Bacteria 701
1389 Ga0501031_0038545 3300049568 Bacteria 3119
1390 Ga0501031_0141434 3300049568 Unclassified 1573
1391 Ga0501031_0251274 3300049568 Bacteria 1149
1392 Ga0501031_0448789 3300049568 Bacteria 833
1393 Ga0501031_0601906 3300049568 Bacteria 707
1394 Ga0501031_0723589 3300049568 Unclassified 639
1395 Ga0501031_1003046 3300049568 Unclassified 534
1396 Ga0501032_0384007 3300049569 Bacteria 903
1397 Ga0501032_0493440 3300049569 Bacteria 783
1398 Ga0501033_1029612 3300049570 Unclassified 549
1399 Ga0501034_0015608 3300049571 Bacteria 7802
1400 Ga0501036_0028391 3300049572 Bacteria 4729
1401 Ga0501036_0061087 3300049572 Bacteria 3192
1402 Ga0501036_0061802 3300049572 Bacteria 3173
1403 Ga0501036_0110384 3300049572 Bacteria 2324
1404 Ga0501036_0171280 3300049572 Bacteria 1829
1405 Ga0501036_0278905 3300049572 Bacteria 1399
1406 Ga0501036_1060526 3300049572 Unclassified 662
1407 Ga0501038_0099437 3300049574 Unclassified 2425
1408 Ga0501038_0250481 3300049574 Bacteria 1403
1409 Ga0501038_0639775 3300049574 Bacteria 801
1410 Ga0501039_0053404 3300049575 Bacteria 3127
1411 Ga0501039_0078127 3300049575 Bacteria 2574
1412 Ga0501039_0167072 3300049575 Bacteria 1730
1413 Ga0501039_0212573 3300049575 Bacteria 1521
1414 Ga0501039_0504810 3300049575 Unclassified 950
1415 Ga0501039_1226203 3300049575 Bacteria 580
1416 Ga0501040_0030080 3300049576 Bacteria 3666
1417 Ga0501040_0038103 3300049576 Bacteria 3268
1418 Ga0501040_0060087 3300049576 Unclassified 2612
1419 Ga0501040_0116438 3300049576 Bacteria 1872
1420 Ga0501040_0226057 3300049576 Bacteria 1332
1421 Ga0501040_0255070 3300049576 Unclassified 1251
1422 Ga0501040_0498434 3300049576 Bacteria 878
1423 Ga0501040_0699699 3300049576 Bacteria 733
1424 Ga0501040_0987307 3300049576 Bacteria 610
1425 Ga0501041_0015406 3300049577 Bacteria 4539
1426 Ga0501041_0054344 3300049577 Bacteria 2443
1427 Ga0501041_0083530 3300049577 Bacteria 1968
1428 Ga0501041_0103906 3300049577 Bacteria 1760
1429 Ga0501041_0111791 3300049577 Bacteria 1695
1430 Ga0501041_0237919 3300049577 Bacteria 1144
1431 Ga0501041_0254373 3300049577 Unclassified 1104
1432 Ga0501041_0557464 3300049577 Bacteria 730
1433 Ga0501041_0864701 3300049577 Bacteria 580
1434 Ga0501042_0004352 3300049578 Bacteria 9032
1435 Ga0501042_0006294 3300049578 Bacteria 7701
1436 Ga0501042_0049639 3300049578 Bacteria 2994
1437 Ga0501042_0076956 3300049578 Bacteria 2388
1438 Ga0501042_0079656 3300049578 Bacteria 2347
1439 Ga0501042_0201100 3300049578 Bacteria 1437
1440 Ga0501042_0300280 3300049578 Bacteria 1160
1441 Ga0501042_0316617 3300049578 Unclassified 1127
1442 Ga0501042_0619301 3300049578 Bacteria 787
1443 Ga0501042_0854305 3300049578 Unclassified 663
1444 Ga0501042_0899896 3300049578 Bacteria 645
1445 Ga0501042_1196565 3300049578 Bacteria 554
1446 Ga0501042_1247838 3300049578 Bacteria 542
1447 Ga0501046_0077616 3300049580 Unclassified 2571
1448 Ga0501046_0144572 3300049580 Bacteria 1797
1449 Ga0501046_0203832 3300049580 Bacteria 1471
1450 Ga0501046_0365586 3300049580 Bacteria 1046
1451 Ga0501046_0490987 3300049580 Bacteria 880
1452 Ga0501046_0580604 3300049580 Bacteria 797
1453 Ga0501046_0854914 3300049580 Bacteria 636
1454 Ga0501046_0881826 3300049580 Bacteria 625
1455 Ga0501046_0975397 3300049580 Bacteria 589
1456 Ga0501048_0041238 3300049582 Bacteria 3307
1457 Ga0501048_0190242 3300049582 Bacteria 1454
1458 Ga0501048_0227370 3300049582 Unclassified 1324
1459 Ga0501067_0218144 3300049583 Bacteria 1062
1460 Ga0501067_0551759 3300049583 Bacteria 645
1461 Ga0501068_0416688 3300049584 Bacteria 867
1462 Ga0501068_0575080 3300049584 Bacteria 733
1463 Ga0501068_0820407 3300049584 Bacteria 610
1464 Ga0501068_0967867 3300049584 Unclassified 561
1465 Ga0501069_0016549 3300049585 Bacteria 3962
1466 Ga0501069_0397933 3300049585 Bacteria 815
1467 Ga0501070_0655922 3300049586 Bacteria 833
1468 Ga0501071_0031633 3300049587 Bacteria 3753
1469 Ga0501071_0048323 3300049587 Bacteria 3060
1470 Ga0501071_0063771 3300049587 Bacteria 2672
1471 Ga0501071_0081426 3300049587 Unclassified 2369
1472 Ga0501071_0107221 3300049587 Bacteria 2063
1473 Ga0501071_0109853 3300049587 Bacteria 2037
1474 Ga0501071_0242716 3300049587 Bacteria 1358
1475 Ga0501071_0306179 3300049587 Bacteria 1205
1476 Ga0501071_0347803 3300049587 Bacteria 1128
1477 Ga0501071_0354867 3300049587 Bacteria 1116
1478 Ga0501071_0432787 3300049587 Bacteria 1006
1479 Ga0501071_0523538 3300049587 Bacteria 910
1480 Ga0501071_0670146 3300049587 Unclassified 798
1481 Ga0501071_0996713 3300049587 Unclassified 647
1482 Ga0501072_0029646 3300049588 Bacteria 4275
1483 Ga0501072_0041729 3300049588 Bacteria 3604
1484 Ga0501072_0044490 3300049588 Bacteria 3491
1485 Ga0501072_0048029 3300049588 Bacteria 3361
1486 Ga0501072_0048343 3300049588 Bacteria 3350
1487 Ga0501072_0089431 3300049588 Bacteria 2444
1488 Ga0501072_0431023 3300049588 Unclassified 1045
1489 Ga0501072_0472281 3300049588 Bacteria 993
1490 Ga0501072_0501968 3300049588 Bacteria 960
1491 Ga0501073_0213239 3300049589 Unclassified 1334
1492 Ga0501073_0215792 3300049589 Bacteria 1326
1493 Ga0501073_0865991 3300049589 Unclassified 622
1494 Ga0501073_0884497 3300049589 Bacteria 615
1495 Ga0501073_0984686 3300049589 Bacteria 580
1496 Ga0501074_0035716 3300049590 Bacteria 3601
1497 Ga0501074_0092250 3300049590 Unclassified 2169
1498 Ga0501074_0102598 3300049590 Bacteria 2048
1499 Ga0501074_0258520 3300049590 Bacteria 1238
1500 Ga0501074_0479483 3300049590 Bacteria 882
1501 Ga0501074_1040128 3300049590 Bacteria 575
1502 Ga0501075_0001534 3300049591 Bacteria 15063
1503 Ga0501075_0049516 3300049591 Bacteria 3158
1504 Ga0501075_0054943 3300049591 Bacteria 2996
1505 Ga0501075_0096446 3300049591 Bacteria 2244
1506 Ga0501075_0121378 3300049591 Bacteria 1989
1507 Ga0501075_0230007 3300049591 Bacteria 1414
1508 Ga0501075_0248926 3300049591 Bacteria 1354
1509 Ga0501075_0342117 3300049591 Unclassified 1140
1510 Ga0501075_0580187 3300049591 Bacteria 855
1511 Ga0501075_0682699 3300049591 Bacteria 783
1512 Ga0501075_0818579 3300049591 Bacteria 709
1513 Ga0501075_0949379 3300049591 Unclassified 653
1514 Ga0501075_1521763 3300049591 Bacteria 506
1515 Ga0501076_0019323 3300049592 Bacteria 5207
1516 Ga0501076_0038764 3300049592 Bacteria 3741
1517 Ga0501076_0075398 3300049592 Bacteria 2703
1518 Ga0501076_0096096 3300049592 Bacteria 2386
1519 Ga0501076_0137576 3300049592 Bacteria 1983
1520 Ga0501076_0182934 3300049592 Bacteria 1709
1521 Ga0501076_0207182 3300049592 Bacteria 1602
1522 Ga0501076_0212453 3300049592 Bacteria 1581
1523 Ga0501076_0237592 3300049592 Bacteria 1490
1524 Ga0501076_0241434 3300049592 Bacteria 1478
1525 Ga0501076_0551030 3300049592 Bacteria 951
1526 Ga0501076_0557294 3300049592 Unclassified 945
1527 Ga0501076_0698563 3300049592 Bacteria 837
1528 Ga0501076_1632557 3300049592 Unclassified 529
1529 Ga0501077_0089699 3300049593 Bacteria 1948
1530 Ga0501077_0134659 3300049593 Bacteria 1567
1531 Ga0501077_0393406 3300049593 Bacteria 886
1532 Ga0501077_0457684 3300049593 Bacteria 817
1533 Ga0501077_0530309 3300049593 Unclassified 755
1534 Ga0501077_0719995 3300049593 Unclassified 641
1535 Ga0501077_0873736 3300049593 Unclassified 578
1536 Ga0501202_092255 3300049652 Unclassified 726
1537 Ga0501216_061920 3300049660 Bacteria 756
1538 Ga0501227_112764 3300049665 Unclassified 730
1539 Ga0501249_061747 3300049679 Unclassified 869
1540 Ga0501257_271935 3300049686 Unclassified 508
1541 Ga0501225_0073986 3300049705 Bacteria 971
1542 Ga0501245_038230 3300049708 Bacteria 817
1543 Ga0501079_0027535 3300049741 Bacteria 4359
1544 Ga0501079_0131308 3300049741 Bacteria 1949
1545 Ga0501079_0148554 3300049741 Bacteria 1827
1546 Ga0501079_0228858 3300049741 Unclassified 1452
1547 Ga0501079_0234487 3300049741 Unclassified 1434
1548 Ga0501079_0234523 3300049741 Bacteria 1434
1549 Ga0501079_0325735 3300049741 Bacteria 1203
1550 Ga0501079_0332332 3300049741 Bacteria 1190
1551 Ga0501079_0405745 3300049741 Bacteria 1069
1552 Ga0501079_0464341 3300049741 Bacteria 994
1553 Ga0501079_0505695 3300049741 Unclassified 950
1554 Ga0501079_0635786 3300049741 Bacteria 840
1555 Ga0501079_1397826 3300049741 Unclassified 551
1556 Ga0501079_1499221 3300049741 Unclassified 530
1557 Ga0501080_0027010 3300049742 Bacteria 5338
1558 Ga0501080_0148803 3300049742 Bacteria 2165
1559 Ga0501080_0171834 3300049742 Bacteria 1999
1560 Ga0501080_0232516 3300049742 Bacteria 1685
1561 Ga0501080_0591806 3300049742 Unclassified 985
1562 Ga0501080_0689315 3300049742 Bacteria 902
1563 Ga0501080_0732812 3300049742 Bacteria 870
1564 Ga0501080_0823799 3300049742 Unclassified 813
1565 Ga0501081_0000708 3300049743 Bacteria 19308
1566 Ga0501081_0076474 3300049743 Bacteria 2338
1567 Ga0501081_0118553 3300049743 Bacteria 1883
1568 Ga0501081_0172852 3300049743 Unclassified 1560
1569 Ga0501081_0255552 3300049743 Bacteria 1280
1570 Ga0501081_0398103 3300049743 Bacteria 1019
1571 Ga0501081_0523685 3300049743 Bacteria 884
1572 Ga0501081_0554181 3300049743 Unclassified 859
1573 Ga0501081_1103045 3300049743 Unclassified 601
1574 Ga0501081_1177872 3300049743 Unclassified 580
1575 Ga0501083_0208336 3300049744 Bacteria 1275
1576 Ga0501083_0288049 3300049744 Bacteria 1068
1577 Ga0501265_092295 3300049762 Unclassified 542
1578 Ga0501273_048209 3300049770 Bacteria 646
1579 Ga0501035_0353546 3300049822 Bacteria 1229
1580 Ga0501035_0387322 3300049822 Bacteria 1165
1581 Ga0501035_0520082 3300049822 Bacteria 978
1582 Ga0501035_0530483 3300049822 Unclassified 966
1583 Ga0501035_0743217 3300049822 Bacteria 788
1584 Ga0501045_0015789 3300049824 Bacteria 5356
1585 Ga0501045_0064388 3300049824 Bacteria 2691
1586 Ga0501045_0079907 3300049824 Bacteria 2411
1587 Ga0501045_0363578 3300049824 Bacteria 1077
1588 Ga0501045_0366621 3300049824 Bacteria 1072
1589 Ga0501045_0527886 3300049824 Bacteria 876
1590 Ga0501045_0531618 3300049824 Bacteria 873
1591 Ga0501045_0650461 3300049824 Unclassified 779
1592 Ga0501045_0688110 3300049824 Unclassified 755
1593 Ga0501045_0869495 3300049824 Bacteria 663
1594 nmdc:mga03n38_266970_c1 3300050490 Bacteria 909
1595 nmdc:mga0yw44_52317_c1 3300050492 Bacteria 2475
1596 nmdc:mga0k408_15652_c1 3300050493 Bacteria 4198
1597 nmdc:mga06z11_141222_c1 3300050494 Unclassified 1362
1598 nmdc:mga04h51_34990_c1 3300050495 Bacteria 1608
1599 nmdc:mga07m45_795385_c1 3300050496 Unclassified 542
1600 nmdc:mga05p37_106692_c1 3300050507 Bacteria 3446
1601 nmdc:mga05p37_1504302_c1 3300050507 Bacteria 670
1602 nmdc:mga05p37_154728_c1 3300050507 Bacteria 2803
1603 nmdc:mga05p37_171660_c1 3300050507 Bacteria 2644
1604 nmdc:mga05p37_1804323_c1 3300050507 Bacteria 590
1605 nmdc:mga05p37_1976_c1 3300050507 Bacteria 23897
1606 nmdc:mga05p37_197987_c1 3300050507 Bacteria 2435
1607 nmdc:mga05p37_199120_c1 3300050507 Bacteria 2427
1608 nmdc:mga05p37_223620_c1 3300050507 Bacteria 2271
1609 nmdc:mga05p37_2275317_c1 3300050507 Unclassified 500
1610 nmdc:mga05p37_2706_c1 3300050507 Bacteria 20600
1611 nmdc:mga05p37_317756_c1 3300050507 Bacteria 1844
1612 nmdc:mga05p37_337377_c1 3300050507 Bacteria 1778
1613 nmdc:mga05p37_526088_c1 3300050507 Unclassified 1352
1614 nmdc:mga05p37_585099_c1 3300050507 Bacteria 1263
1615 nmdc:mga05p37_59257_c1 3300050507 Bacteria 4715
1616 nmdc:mga05p37_68798_c1 3300050507 Bacteria 4354
1617 nmdc:mga05p37_701855_c1 3300050507 Bacteria 1124
1618 nmdc:mga05p37_93129_c1 3300050507 Bacteria 3713
1619 nmdc:mga05p37_974318_c1 3300050507 Bacteria 904
1620 nmdc:mga09592_1170006_c1 3300050508 Bacteria 637
1621 nmdc:mga09592_1186048_c1 3300050508 Unclassified 632
1622 nmdc:mga09592_1243835_c1 3300050508 Bacteria 614
1623 nmdc:mga09592_23365_c1 3300050508 Bacteria 5107
1624 nmdc:mga09592_27002_c1 3300050508 Bacteria 4761
1625 nmdc:mga09592_355668_c1 3300050508 Unclassified 1267
1626 nmdc:mga09592_381873_c1 3300050508 Bacteria 1218
1627 nmdc:mga09592_4784_c1 3300050508 Bacteria 10966
1628 nmdc:mga09592_5871_c1 3300050508 Bacteria 10020
1629 nmdc:mga09592_6156_c1 3300050508 Bacteria 9765
1630 nmdc:mga09592_62474_c1 3300050508 Bacteria 3151
1631 nmdc:mga09592_8217_c1 3300050508 Bacteria 8486
1632 nmdc:mga09592_9092_c1 3300050508 Bacteria 8077
1633 nmdc:mga0qj67_1128930_c1 3300050509 Bacteria 612
1634 nmdc:mga0qj67_1161620_c1 3300050509 Unclassified 601
1635 nmdc:mga0qj67_123623_c1 3300050509 Bacteria 2093
1636 nmdc:mga0qj67_14732_c1 3300050509 Bacteria 5910
1637 nmdc:mga0qj67_148525_c1 3300050509 Bacteria 1901
1638 nmdc:mga0qj67_1512_c1 3300050509 Bacteria 16310
1639 nmdc:mga0qj67_196722_c1 3300050509 Bacteria 1638
1640 nmdc:mga0qj67_205756_c1 3300050509 Unclassified 1599
1641 nmdc:mga0qj67_23280_c1 3300050509 Bacteria 4763
1642 nmdc:mga0qj67_299002_c1 3300050509 Bacteria 1304
1643 nmdc:mga0qj67_363959_c1 3300050509 Bacteria 1168
1644 nmdc:mga0qj67_43412_c1 3300050509 Bacteria 3541
1645 nmdc:mga0qj67_52665_c1 3300050509 Bacteria 3222
1646 nmdc:mga0qj67_615366_c1 3300050509 Bacteria 868
1647 nmdc:mga06r32_1028982_c1 3300050510 Bacteria 775
1648 nmdc:mga06r32_104941_c1 3300050510 Bacteria 2776
1649 nmdc:mga06r32_13471_c1 3300050510 Bacteria 7409
1650 nmdc:mga06r32_15765_c1 3300050510 Bacteria 6869
1651 nmdc:mga06r32_16110_c1 3300050510 Bacteria 6806
1652 nmdc:mga06r32_178119_c1 3300050510 Bacteria 2111
1653 nmdc:mga06r32_237906_c1 3300050510 Bacteria 1809
1654 nmdc:mga06r32_349348_c1 3300050510 Bacteria 1463
1655 nmdc:mga06r32_3881_c1 3300050510 Bacteria 13387
1656 nmdc:mga06r32_407277_c1 3300050510 Bacteria 1342
1657 nmdc:mga06r32_407433_c1 3300050510 Unclassified 1342
1658 nmdc:mga06r32_41924_c1 3300050510 Bacteria 4350
1659 nmdc:mga06r32_506831_c1 3300050510 Bacteria 1183
1660 nmdc:mga06r32_529084_c1 3300050510 Unclassified 1154
1661 nmdc:mga06r32_558884_c1 3300050510 Bacteria 1118
1662 nmdc:mga08y16_12708_c1 3300050511 Bacteria 8859
1663 nmdc:mga08y16_1710_c1 3300050511 Bacteria 22264
1664 nmdc:mga08y16_2030909_c1 3300050511 Unclassified 524
1665 nmdc:mga08y16_225793_c1 3300050511 Bacteria 1938
1666 nmdc:mga08y16_23899_c1 3300050511 Bacteria 6455
1667 nmdc:mga08y16_242504_c1 3300050511 Bacteria 1863
1668 nmdc:mga08y16_25391_c1 3300050511 Bacteria 6249
1669 nmdc:mga08y16_262941_c1 3300050511 Bacteria 1782
1670 nmdc:mga08y16_38458_c1 3300050511 Bacteria 5024
1671 nmdc:mga08y16_48960_c1 3300050511 Bacteria 4423
1672 nmdc:mga08y16_512312_c1 3300050511 Bacteria 1218
1673 nmdc:mga08y16_58928_c1 3300050511 Bacteria 4012
1674 nmdc:mga08y16_61068_c1 3300050511 Bacteria 3936
1675 nmdc:mga08y16_611_c1 3300050511 Bacteria 33310
1676 nmdc:mga08y16_661563_c1 3300050511 Bacteria 1048
1677 nmdc:mga08y16_680507_c1 3300050511 Bacteria 1030
1678 nmdc:mga08y16_92341_c1 3300050511 Bacteria 3154
1679 nmdc:mga0n895_136748_c1 3300050512 Unclassified 2477
1680 nmdc:mga0n895_1679667_c1 3300050512 Unclassified 598
1681 nmdc:mga0n895_1711348_c1 3300050512 Bacteria 591
1682 nmdc:mga0n895_266830_c1 3300050512 Bacteria 1737
1683 nmdc:mga0n895_267989_c1 3300050512 Bacteria 1733
1684 nmdc:mga0n895_409293_c1 3300050512 Unclassified 1372
1685 nmdc:mga0n895_45123_c1 3300050512 Bacteria 4300
1686 nmdc:mga0n895_46172_c1 3300050512 Bacteria 4254
1687 nmdc:mga0n895_5739_c1 3300050512 Bacteria 10416
1688 nmdc:mga0n895_65562_c1 3300050512 Bacteria 3595
1689 nmdc:mga0n895_70695_c1 3300050512 Bacteria 3459
1690 nmdc:mga0n895_796655_c1 3300050512 Bacteria 936
1691 nmdc:mga0n895_87579_c1 3300050512 Bacteria 3112
1692 nmdc:mga0n895_916967_c1 3300050512 Unclassified 861
1693 nmdc:mga0rr50_108495_c1 3300050513 Bacteria 2193
1694 nmdc:mga0rr50_12095_c1 3300050513 Bacteria 5560
1695 nmdc:mga0rr50_13165_c1 3300050513 Bacteria 5375
1696 nmdc:mga0rr50_13953_c1 3300050513 Bacteria 5250
1697 nmdc:mga0rr50_290916_c1 3300050513 Bacteria 1365
1698 nmdc:mga0rr50_33925_c1 3300050513 Bacteria 3650
1699 nmdc:mga0rr50_393479_c1 3300050513 Unclassified 1170
1700 nmdc:mga0rr50_41835_c1 3300050513 Bacteria 3342
1701 nmdc:mga0rr50_430192_c1 3300050513 Bacteria 1117
1702 nmdc:mga08x19_558855_c1 3300050514 Unclassified 810
1703 nmdc:mga08x19_780647_c1 3300050514 Unclassified 678
1704 nmdc:mga0a205_139238_c1 3300050515 Bacteria 2327
1705 nmdc:mga0a205_146048_c1 3300050515 Unclassified 2265
1706 nmdc:mga0a205_197617_c1 3300050515 Unclassified 1902
1707 nmdc:mga0a205_265250_c1 3300050515 Unclassified 1595
1708 nmdc:mga0a205_2970_c1 3300050515 Bacteria 15044
1709 nmdc:mga0a205_34005_c1 3300050515 Bacteria 4890
1710 nmdc:mga0a205_44696_c1 3300050515 Bacteria 4271
1711 nmdc:mga0a205_475349_c1 3300050515 Bacteria 1108
1712 nmdc:mga0a205_492_c1 3300050515 Bacteria 30923
1713 nmdc:mga0a205_53372_c1 3300050515 Bacteria 3902
1714 nmdc:mga0a205_60215_c1 3300050515 Unclassified 3667
1715 nmdc:mga0a205_81248_c1 3300050515 Bacteria 3131
1716 nmdc:mga0a205_88597_c2 3300050515 Bacteria 2400
1717 nmdc:mga0a205_90545_c1 3300050515 Bacteria 2956
1718 nmdc:mga0a205_986_c1 3300050515 Bacteria 23556
1719 Ga0495601_0209666 3300053077 Bacteria 1273
1720 Ga0495595_0078472 3300053084 Bacteria 1570
1721 Ga0500627_0236848 3300053158 Unclassified 811
1722 Ga0501084_0023866 3300054114 Bacteria 5101
1723 Ga0501084_0040229 3300054114 Bacteria 3910
1724 Ga0501084_0084650 3300054114 Bacteria 2662
1725 Ga0501084_0183348 3300054114 Bacteria 1767
1726 Ga0501084_0189565 3300054114 Bacteria 1735
1727 Ga0501084_0229065 3300054114 Bacteria 1568
1728 Ga0501084_0427270 3300054114 Unclassified 1120
1729 Ga0501084_0506312 3300054114 Bacteria 1020
1730 Ga0501084_0852898 3300054114 Unclassified 767
1731 Ga0501084_1438926 3300054114 Unclassified 577
1732 Ga0590071_000034 3300059421 Bacteria 36259
1733 Ga0590071_000282 3300059421 Bacteria 14815
1734 Ga0590071_070774 3300059421 Bacteria 859
1735 Ga0590074_001566 3300059423 Bacteria 3716
1736 Ga0590074_021132 3300059423 Bacteria 1121
1737 Ga0590074_059239 3300059423 Unclassified 710
1738 Ga0590074_086406 3300059423 Unclassified 603
1739 Ga0590075_000025 3300059424 Bacteria 39755
1740 Ga0590075_000872 3300059424 Bacteria 7892
1741 Ga0590077_000006 3300059426 Bacteria 42966
1742 Ga0590077_000238 3300059426 Bacteria 15670
1743 Ga0590077_043048 3300059426 Bacteria 1006
1744 Ga0501082_0020583 3300060353 Bacteria 5687
1745 Ga0501082_0021769 3300060353 Bacteria 5528
1746 Ga0501082_0121692 3300060353 Bacteria 2262
1747 Ga0501082_0176603 3300060353 Unclassified 1857
1748 Ga0501082_0286730 3300060353 Unclassified 1433
1749 Ga0501082_0333163 3300060353 Bacteria 1322
1750 Ga0501082_0378492 3300060353 Bacteria 1235
1751 Ga0501082_0506550 3300060353 Bacteria 1055
1752 Ga0501082_0555722 3300060353 Bacteria 1004
1753 Ga0501082_0629369 3300060353 Bacteria 939
1754 Ga0501082_0635418 3300060353 Bacteria 934
1755 Ga0501082_0929052 3300060353 Bacteria 761
1756 Ga0501082_1780991 3300060353 Bacteria 537
1757 Ga0530510_0001780 3300061734 Bacteria 14689
1758 Ga0530510_0001988 3300061734 Bacteria 14024
1759 Ga0530510_0018377 3300061734 Unclassified 4957
1760 Ga0530510_0225442 3300061734 Bacteria 1394
1761 Ga0530510_0341993 3300061734 Bacteria 1123
1762 Ga0530510_0438268 3300061734 Unclassified 987
1763 Ga0530510_0640768 3300061734 Bacteria 809
1764 Ga0530510_0649331 3300061734 Bacteria 803
1765 Ga0530510_0806683 3300061734 Bacteria 716
1766 Ga0530510_0863117 3300061734 Unclassified 691
1767 Ga0451807_2680370
1768 ARcpr5yngRDRAFT_c013371
1769 JGI24739J22299_10189834
1770 JGI24750J21931_1005644
1771 JGI24745J21846_1045819
1772 JGI24748J21848_1039180
1773 JGI24749J21850_1022447
1774 JGI24751J29686_10036310
1775 Ga0058863_11932409
1776 Ga0065704_10123446
1777 Ga0065704_10181414
1778 Ga0065704_10705596
1779 Ga0065712_10022428
1780 Ga0065712_10051606
1781 Ga0065712_10072906
1782 Ga0065712_10284836
1783 Ga0065712_10307811
1784 Ga0065712_10312330
1785 Ga0065712_10358855
1786 Ga0065712_10420257
1787 Ga0065712_10587368
1788 Ga0065712_10725601
1789 Ga0065715_10097777
1790 Ga0065715_10191708
1791 Ga0065715_10370516
1792 Ga0065715_10406936
1793 Ga0065715_10497280
1794 Ga0065715_10868974
1795 Ga0065715_11158852
1796 Ga0065707_10005876
1797 Ga0065707_10009901
1798 Ga0065707_10149926
1799 Ga0065707_10155199
1800 Ga0065707_10176388
1801 Ga0065707_10309646
1802 Ga0065707_10456554
1803 Ga0065707_10490249
1804 Ga0070676_10055794
1805 Ga0070676_10366078
1806 Ga0070676_10465465
1807 Ga0070676_10636259
1808 Ga0070676_10886955
1809 Ga0070683_100083153
1810 Ga0070683_102261996
1811 Ga0070690_100004426
1812 Ga0070690_100024878
1813 Ga0070690_100031293
1814 Ga0070690_100078050
1815 Ga0070690_100217284
1816 Ga0070690_100805614
1817 Ga0070690_100947732
1818 Ga0070670_100010332
1819 Ga0070670_100021798
1820 Ga0070670_100067562
1821 Ga0070670_100138925
1822 Ga0070670_100145557
1823 Ga0070670_100206851
1824 Ga0070670_100215657
1825 Ga0070670_100257732
1826 Ga0070670_100561449
1827 Ga0070670_100908009
1828 Ga0070670_101035724
1829 Ga0070677_10000884
1830 Ga0070677_10018427
1831 Ga0070677_10171655
1832 Ga0070677_10246799
1833 Ga0070677_10333486
1834 Ga0070677_10767286
1835 Ga0068869_100001834
1836 Ga0068869_100016747
1837 Ga0068869_100035043
1838 Ga0068869_100074252
1839 Ga0068869_100112130
1840 Ga0068869_100195197
1841 Ga0068869_100419506
1842 Ga0068869_100610616
1843 Ga0068869_100632074
1844 Ga0068869_101006269
1845 Ga0070666_10007259
1846 Ga0070666_10055453
1847 Ga0070666_10122016
1848 Ga0070680_100038026
1849 Ga0070680_100262987
1850 Ga0070680_100316919
1851 Ga0070680_100613790
1852 Ga0070682_100074373
1853 Ga0070682_100399590
1854 Ga0070682_100479706
1855 Ga0068868_100005344
1856 Ga0068868_100105464
1857 Ga0068868_100276025
1858 Ga0068868_100811086
1859 Ga0068868_101236692
1860 Ga0070660_101053646
1861 Ga0070689_100018035
1862 Ga0070689_100053398
1863 Ga0070689_100163068
1864 Ga0070689_100383040
1865 Ga0070689_100757329
1866 Ga0070689_100759053
1867 Ga0070691_10060648
1868 Ga0070691_10616899
1869 Ga0070691_10783735
1870 Ga0070687_100008085
1871 Ga0070687_100028758
1872 Ga0070687_100047930
1873 Ga0070687_100187908
1874 Ga0070687_100507436
1875 Ga0070687_100621441
1876 Ga0070661_100003293
1877 Ga0070661_100065094
1878 Ga0070661_100299993
1879 Ga0070661_100441860
1880 Ga0070661_101061208
1881 Ga0070661_101556266
1882 Ga0070692_10032075
1883 Ga0070692_10174014
1884 Ga0070692_10360788
1885 Ga0070692_11045566
1886 Ga0070668_100016902
1887 Ga0070668_100020560
1888 Ga0070668_100114614
1889 Ga0070668_100518597
1890 Ga0070668_100936212
1891 Ga0070668_102128561
1892 Ga0070669_100006473
1893 Ga0070669_100075588
1894 Ga0070669_100106995
1895 Ga0070669_100234238
1896 Ga0070669_100436878
1897 Ga0070669_100829868
1898 Ga0070669_101016108
1899 Ga0070675_100002608
1900 Ga0070675_100032679
1901 Ga0070675_100076918
1902 Ga0070675_100113663
1903 Ga0070675_100132260
1904 Ga0070675_100191156
1905 Ga0070675_100195388
1906 Ga0070675_100240873
1907 Ga0070675_100292474
1908 Ga0070675_100569030
1909 Ga0070675_100783741
1910 Ga0070675_100816705
1911 Ga0070675_101188934
1912 Ga0070675_101211555
1913 Ga0070675_101618484
1914 Ga0070671_100040632
1915 Ga0070671_100136584
1916 Ga0070671_100184331
1917 Ga0070671_100265156
1918 Ga0070671_100775060
1919 Ga0070674_100203861
1920 Ga0070674_100385609
1921 Ga0070674_100454843
1922 Ga0070674_100524896
1923 Ga0070674_100863699
1924 Ga0070674_101237510
1925 Ga0070674_101484658
1926 Ga0070674_101719120
1927 Ga0070673_100007144
1928 Ga0070673_100046488
1929 Ga0070673_100123040
1930 Ga0070673_100129990
1931 Ga0070673_100173104
1932 Ga0070673_100252368
1933 Ga0070673_100397622
1934 Ga0070673_100464947
1935 Ga0070673_100506564
1936 Ga0070673_100865848
1937 Ga0070673_100875310
1938 Ga0070673_101385688
1939 Ga0070688_100013286
1940 Ga0070688_100031261
1941 Ga0070688_100044774
1942 Ga0070688_100102851
1943 Ga0070688_100120357
1944 Ga0070688_100142136
1945 Ga0070688_100186678
1946 Ga0070688_100760263
1947 Ga0070688_101223791
1948 Ga0070659_100114324
1949 Ga0070659_100135095
1950 Ga0070659_100357828
1951 Ga0070659_100470646
1952 Ga0070659_100997148
1953 Ga0070659_101211509
1954 Ga0070667_100182205
1955 Ga0070667_100270530
1956 Ga0070667_100272075
1957 Ga0070667_100707800
1958 Ga0070667_101857765
1959 Ga0070703_10016665
1960 Ga0070703_10203076
1961 Ga0070703_10280877
1962 Ga0070713_100848750
1963 Ga0070701_10009628
1964 Ga0070701_10045217
1965 Ga0070701_10082718
1966 Ga0070701_10083747
1967 Ga0070701_10186172
1968 Ga0070701_10521090
1969 Ga0070701_10587751
1970 Ga0070705_100000353
1971 Ga0070705_100008965
1972 Ga0070705_100029016
1973 Ga0070705_100079069
1974 Ga0070705_100144556
1975 Ga0070705_100791174
1976 Ga0070705_100930933
1977 Ga0070705_101050257
1978 Ga0070700_100032037
1979 Ga0070700_100098789
1980 Ga0070700_100218161
1981 Ga0070700_100393770
1982 Ga0070700_100506595
1983 Ga0070700_100684244
1984 Ga0070700_100733301
1985 Ga0070700_101044979
1986 Ga0070700_101107382
1987 Ga0070700_101202054
1988 Ga0070700_101325164
1989 Ga0070694_100001728
1990 Ga0070694_100008513
1991 Ga0070694_100010015
1992 Ga0070694_100082599
1993 Ga0070694_100375284
1994 Ga0070694_100820701
1995 Ga0070708_100071937
1996 Ga0070708_100135240
1997 Ga0070708_100305645
1998 Ga0070708_100675580
1999 Ga0070708_100708629
2000 Ga0070663_100084753
2001 Ga0070663_100737867
2002 Ga0070663_100855807
2003 Ga0070663_101759492
2004 Ga0070678_100041874
2005 Ga0070678_100065613
2006 Ga0070678_100099831
2007 Ga0070678_100106736
2008 Ga0070678_100219733
2009 Ga0070678_101533113
2010 Ga0070678_101602946
2011 Ga0070678_101644769
2012 Ga0070678_102209454
2013 Ga0070662_100006426
2014 Ga0070662_100019273
2015 Ga0070662_100046389
2016 Ga0070662_100125965
2017 Ga0070662_100710678
2018 Ga0070681_10002446
2019 Ga0070681_10217991
2020 Ga0070681_10735226
2021 Ga0068867_100019216
2022 Ga0068867_100063872
2023 Ga0068867_100129518
2024 Ga0068867_100435637
2025 Ga0068867_100759648
2026 Ga0070685_10015733
2027 Ga0070685_10031142
2028 Ga0070685_10050188
2029 Ga0070685_10203579
2030 Ga0070685_10399757
2031 Ga0070685_10440110
2032 Ga0070685_10534829
2033 Ga0070706_100169304
2034 Ga0070706_100555807
2035 Ga0070706_101801291
2036 Ga0070707_100201317
2037 Ga0070707_100289816
2038 Ga0070707_101337589
2039 Ga0070707_101439161
2040 Ga0070707_101627374
2041 Ga0070698_100005270
2042 Ga0070698_100029738
2043 Ga0070698_100100980
2044 Ga0070698_100153539
2045 Ga0070698_100583610
2046 Ga0070698_100623961
2047 Ga0070698_100976120
2048 Ga0070698_101260595
2049 Ga0070698_101566007
2050 Ga0070699_100003285
2051 Ga0070699_100007386
2052 Ga0070699_100022796
2053 Ga0070699_100525976
2054 Ga0070699_100629527
2055 Ga0070679_100597545
2056 Ga0070679_101518941
2057 Ga0070684_100099393
2058 Ga0070684_100175655
2059 Ga0070684_100748943
2060 Ga0070684_101215353
2061 Ga0070697_100084866
2062 Ga0070697_100313326
2063 Ga0070697_101935200
2064 Ga0068853_101085069
2065 Ga0070672_100006955
2066 Ga0070672_100009505
2067 Ga0070672_100043637
2068 Ga0070672_100043840
2069 Ga0070672_100061587
2070 Ga0070672_100621509
2071 Ga0070672_100977589
2072 Ga0070672_101023322
2073 Ga0070672_101504782
2074 Ga0070686_100006474
2075 Ga0070686_100045869
2076 Ga0070686_100345857
2077 Ga0070686_100375750
2078 Ga0070686_100627161
2079 Ga0070686_101071031
2080 Ga0070686_101165057
2081 Ga0070695_100003268
2082 Ga0070695_100020676
2083 Ga0070695_100060865
2084 Ga0070695_100306956
2085 Ga0070696_100000751
2086 Ga0070696_100013141
2087 Ga0070696_100039033
2088 Ga0070696_100120202
2089 Ga0070696_100172919
2090 Ga0070696_100406628
2091 Ga0070696_100673499
2092 Ga0070696_101002298
2093 Ga0070696_101005789
2094 Ga0070693_100032579
2095 Ga0070665_100090893
2096 Ga0070665_100252021
2097 Ga0070665_101023731
2098 Ga0070665_101691191
2099 Ga0070704_100002185
2100 Ga0070704_100014281
2101 Ga0070704_100047016
2102 Ga0070704_100073926
2103 Ga0070704_100075821
2104 Ga0070704_100115315
2105 Ga0070704_100175061
2106 Ga0070704_100223686
2107 Ga0070704_100354916
2108 Ga0070704_100717534
2109 Ga0070704_101547348
2110 Ga0068855_100621950
2111 Ga0070664_100018194
2112 Ga0070664_100039531
2113 Ga0070664_100053084
2114 Ga0070664_100175999
2115 Ga0070664_100272927
2116 Ga0070664_100363263
2117 Ga0070664_100476796
2118 Ga0070664_100591079
2119 Ga0070664_100722184
2120 Ga0070664_101082640
2121 Ga0070664_101381278
2122 Ga0068857_100202629
2123 Ga0068857_100326042
2124 Ga0068857_100544462
2125 Ga0068857_101196268
2126 Ga0068854_100058261
2127 Ga0068856_100182009
2128 Ga0070702_100057017
2129 Ga0070702_100696521
2130 Ga0070702_101201197
2131 Ga0068852_100025184
2132 Ga0068852_100051784
2133 Ga0068852_100582464
2134 Ga0068852_100761046
2135 Ga0068859_100006095
2136 Ga0068859_100039000
2137 Ga0068859_100045758
2138 Ga0068859_100089189
2139 Ga0068859_100117279
2140 Ga0068859_100186560
2141 Ga0068859_100549484
2142 Ga0068859_100813849
2143 Ga0068859_100816269
2144 Ga0068859_101009129
2145 Ga0068859_101535945
2146 Ga0068859_101572149
2147 Ga0068859_101673644
2148 Ga0068864_100047439
2149 Ga0068864_100102782
2150 Ga0068864_100197663
2151 Ga0068864_100305474
2152 Ga0068864_100356891
2153 Ga0068864_100618902
2154 Ga0068864_100765314
2155 Ga0068864_100930031
2156 Ga0068864_102178903
2157 Ga0068864_102451046
2158 Ga0068866_10011566
2159 Ga0068866_10559458
2160 Ga0068866_11035447
2161 Ga0068861_100012791
2162 Ga0068861_100032640
2163 Ga0068861_100359379
2164 Ga0068861_100487645
2165 Ga0068861_100646235
2166 Ga0068861_100946562
2167 Ga0068861_102032757
2168 Ga0068851_10130199
2169 Ga0068870_10013998
2170 Ga0068870_10018525
2171 Ga0068870_10080772
2172 Ga0068870_10396623
2173 Ga0068870_10477245
2174 Ga0068870_10544109
2175 Ga0068870_10590487
2176 Ga0068870_10955347
2177 Ga0068870_11361482
2178 Ga0068863_100002899
2179 Ga0068863_100025702
2180 Ga0068863_100046141
2181 Ga0068863_100124010
2182 Ga0068863_101007924
2183 Ga0068858_100007484
2184 Ga0068858_100018524
2185 Ga0068858_100052461
2186 Ga0068858_100192947
2187 Ga0068858_100641104
2188 Ga0068858_101377077
2189 Ga0068860_100014383
2190 Ga0068860_100038249
2191 Ga0068860_100059770
2192 Ga0068860_100185323
2193 Ga0068860_100623832
2194 Ga0068860_101003170
2195 Ga0068860_101200032
2196 Ga0068862_100002073
2197 Ga0068862_100008919
2198 Ga0068862_100025434
2199 Ga0068862_100111241
2200 Ga0068862_100186842
2201 Ga0068862_100704301
2202 Ga0068862_100705369
2203 Ga0068862_100922615
2204 Ga0068862_101052701
2205 Ga0068862_101221321
2206 Ga0081538_10151793
2207 Ga0081539_10000291
2208 Ga0081539_10000295
2209 Ga0081539_10006823
2210 Ga0081539_10079711
2211 Ga0070717_10631548
2212 Ga0075368_10016927
2213 Ga0075363_100212204
2214 Ga0075364_11206725
2215 Ga0070716_100271392
2216 Ga0070712_100606567
2217 Ga0075367_10008193
2218 Ga0075367_10703668
2219 Ga0075427_10026819
2220 Ga0075366_10018803
2221 Ga0075366_10590950
2222 Ga0097621_100439385
2223 Ga0097621_100800049
2224 Ga0097621_100910532
2225 Ga0068871_100159793
2226 Ga0068871_100233077
2227 Ga0068871_100310837
2228 Ga0068871_101051709
2229 Ga0068871_101120908
2230 Ga0068871_101368067
2231 Ga0068871_101643937
2232 Ga0075428_100001205
2233 Ga0075428_100011446
2234 Ga0075428_100012226
2235 Ga0075428_100021842
2236 Ga0075428_100030863
2237 Ga0075428_100042724
2238 Ga0075428_100113028
2239 Ga0075428_100315122
2240 Ga0075428_100523099
2241 Ga0075428_101279983
2242 Ga0075428_102510936
2243 Ga0075430_100063682
2244 Ga0075430_100089047
2245 Ga0075430_100127878
2246 Ga0075430_100188316
2247 Ga0075430_100193055
2248 Ga0075430_100206542
2249 Ga0075430_100212369
2250 Ga0075430_100251135
2251 Ga0075430_100290736
2252 Ga0075430_100327315
2253 Ga0075430_100441278
2254 Ga0075430_100460028
2255 Ga0075430_100688712
2256 Ga0075431_100005109
2257 Ga0075431_100010681
2258 Ga0075431_100018733
2259 Ga0075431_100053307
2260 Ga0075431_100068317
2261 Ga0075431_100102439
2262 Ga0075431_100183629
2263 Ga0075431_100428397
2264 Ga0075431_100484231
2265 Ga0075431_100579921
2266 Ga0075431_100661215
2267 Ga0075431_100671892
2268 Ga0075431_100747466
2269 Ga0075431_100850090
2270 Ga0075431_101075246
2271 Ga0075433_10001675
2272 Ga0075433_10001688
2273 Ga0075433_10018246
2274 Ga0075433_10042019
2275 Ga0075433_10050964
2276 Ga0075433_10055219
2277 Ga0075433_10069629
2278 Ga0075433_10129709
2279 Ga0075433_10243939
2280 Ga0075433_10348333
2281 Ga0075433_10526575
2282 Ga0075433_10605558
2283 Ga0075433_11064861
2284 Ga0075434_100002545
2285 Ga0075434_100005218
2286 Ga0075434_100028400
2287 Ga0075434_100033741
2288 Ga0075434_100035306
2289 Ga0075434_100064826
2290 Ga0075434_100158188
2291 Ga0075434_100228243
2292 Ga0075434_100474284
2293 Ga0075434_100718790
2294 Ga0075434_101250246
2295 Ga0075434_101515317
2296 Ga0075434_101584952
2297 Ga0075429_100005715
2298 Ga0075429_100023129
2299 Ga0075429_100025834
2300 Ga0075429_100051940
2301 Ga0075429_100073043
2302 Ga0075429_100117682
2303 Ga0075429_100205088
2304 Ga0075429_100422501
2305 Ga0075429_100629963
2306 Ga0075429_101239515
2307 Ga0068865_100053704
2308 Ga0068865_100202386
2309 Ga0068865_100295905
2310 Ga0068865_100377330
2311 Ga0068865_100442578
2312 Ga0068865_100561968
2313 Ga0068865_100576935
2314 Ga0068865_100718063
2315 Ga0068865_100976064
2316 Ga0068865_101741953
2317 Ga0075436_100733731
2318 Ga0097620_100006095
2319 Ga0097620_100039000
2320 Ga0097620_100045760
2321 Ga0097620_100089193
2322 Ga0097620_100117285
2323 Ga0097620_100186561
2324 Ga0097620_100549460
2325 Ga0097620_100813782
2326 Ga0097620_100816270
2327 Ga0097620_101009298
2328 Ga0097620_101536739
2329 Ga0097620_101572300
2330 Ga0097620_101673356
2331 Ga0075435_100002880
2332 Ga0075435_100010137
2333 Ga0075435_100058881
2334 Ga0075435_100065154
2335 Ga0075435_100178693
2336 Ga0075435_100371504
2337 Ga0075435_100479813
2338 Ga0075435_100917712
2339 Ga0105244_10271737
2340 Ga0111539_10000542
2341 Ga0111539_10018201
2342 Ga0111539_10022938
2343 Ga0111539_10029838
2344 Ga0111539_10055826
2345 Ga0111539_10103964
2346 Ga0111539_10197442
2347 Ga0111539_10197900
2348 Ga0111539_10216760
2349 Ga0111539_10229720
2350 Ga0111539_10255737
2351 Ga0111539_10619556
2352 Ga0111539_10739421
2353 Ga0111539_11007936
2354 Ga0111539_12361096
2355 Ga0111539_12542578
2356 Ga0105245_10116409
2357 Ga0105247_11742608
2358 Ga0114129_10001659
2359 Ga0114129_10002530
2360 Ga0114129_10003888
2361 Ga0114129_10007226
2362 Ga0114129_10016436
2363 Ga0114129_10033249
2364 Ga0114129_10086038
2365 Ga0114129_10116266
2366 Ga0114129_10223067
2367 Ga0114129_10296290
2368 Ga0114129_10305021
2369 Ga0114129_10394086
2370 Ga0114129_10484547
2371 Ga0114129_10540513
2372 Ga0114129_10800058
2373 Ga0114129_11401400
2374 Ga0114129_11829108
2375 Ga0114129_12217607
2376 Ga0114129_12794571
2377 Ga0105243_10050813
2378 Ga0105243_10093757
2379 Ga0105243_10158402
2380 Ga0105243_10740098
2381 Ga0105243_11607989
2382 Ga0105243_11969344
2383 Ga0105243_12028349
2384 Ga0105241_10327782
2385 Ga0105242_10065331
2386 Ga0105242_10244483
2387 Ga0105242_11084179
2388 Ga0105242_12831945
2389 Ga0105242_12833620
2390 Ga0105248_10016814
2391 Ga0105248_10051872
2392 Ga0105248_10199006
2393 Ga0105248_10346905
2394 Ga0105248_10350036
2395 Ga0105248_10396219
2396 Ga0105248_10499315
2397 Ga0105248_10977960
2398 Ga0105248_12605035
2399 Ga0105238_10700108
2400 Ga0105249_10000672
2401 Ga0105249_10001821
2402 Ga0105249_10018156
2403 Ga0105249_10118253
2404 Ga0105249_10157278
2405 Ga0105249_10252825
2406 Ga0105249_10946030
2407 Ga0105249_11171369
2408 Ga0105249_11230770
2409 Ga0105249_11285126
2410 Ga0105249_12553917
2411 Ga0105239_10799423
2412 Ga0105246_10364554
2413 Ga0105246_10681296
2414 Ga0157321_1003202
2415 Ga0157313_1032810
2416 Ga0157373_10850033
2417 Ga0157374_10185254
2418 Ga0157374_11254284
2419 Ga0157378_10137274
2420 Ga0157378_10158732
2421 Ga0157378_10513867
2422 Ga0163162_10007803
2423 Ga0163162_10033381
2424 Ga0163162_10087199
2425 Ga0163162_12395422
2426 Ga0157372_10077056
2427 Ga0157375_10011615
2428 Ga0157375_10015562
2429 Ga0157375_10166603
2430 Ga0157375_10320781
2431 Ga0157375_10397378
2432 Ga0157375_10422420
2433 Ga0157375_11005624
2434 Ga0163163_10000005
2435 Ga0163163_10098812
2436 Ga0163163_10247540
2437 Ga0163163_10569774
2438 Ga0163163_11206194
2439 Ga0163163_11691809
2440 Ga0163163_12133385
2441 Ga0157380_10067669
2442 Ga0157380_10166625
2443 Ga0157380_10196563
2444 Ga0157380_10236903
2445 Ga0157380_10252800
2446 Ga0157380_10311064
2447 Ga0157380_10412115
2448 Ga0157380_10437948
2449 Ga0157380_10458235
2450 Ga0157380_10539319
2451 Ga0157380_10631087
2452 Ga0157380_10663926
2453 Ga0157380_10843307
2454 Ga0157377_10042179
2455 Ga0157377_10044023
2456 Ga0157377_10096840
2457 Ga0157377_10117014
2458 Ga0157377_10171699
2459 Ga0157377_10449125
2460 Ga0157379_10013361
2461 Ga0157379_10392981
2462 Ga0157379_11528393
2463 Ga0157376_10051020
2464 Ga0157376_10083020
2465 Ga0157376_10362594
2466 Ga0157376_10415068
2467 Ga0157376_10475218
2468 Ga0157376_10844177
2469 Ga0182007_10407725
2470 Ga0163161_10114895
2471 Ga0163161_10488411
2472 Ga0207666_1006342
2473 Ga0207673_1001644
2474 Ga0207697_10000027
2475 Ga0207697_10027070
2476 Ga0207697_10046882
2477 Ga0207697_10140340
2478 Ga0207697_10306687
2479 Ga0207656_10133562
2480 Ga0207653_10040120
2481 Ga0207653_10213155
2482 Ga0207682_10004644
2483 Ga0207682_10008666
2484 Ga0207682_10016389
2485 Ga0207682_10243992
2486 Ga0207682_10250462
2487 Ga0207682_10256282
2488 Ga0207682_10317813
2489 Ga0207682_10345322
2490 Ga0207642_10061947
2491 Ga0207642_10258510
2492 Ga0207688_10000041
2493 Ga0207688_10028006
2494 Ga0207688_10134788
2495 Ga0207688_10237014
2496 Ga0207688_10796349
2497 Ga0207688_10917629
2498 Ga0207680_10020405
2499 Ga0207680_10023926
2500 Ga0207680_10293039
2501 Ga0207647_10025156
2502 Ga0207647_10370539
2503 Ga0207645_10000227
2504 Ga0207645_10002713
2505 Ga0207645_10205039
2506 Ga0207645_10307239
2507 Ga0207645_10327622
2508 Ga0207645_11235142
2509 Ga0207643_10005161
2510 Ga0207643_10023237
2511 Ga0207643_10038219
2512 Ga0207643_10092900
2513 Ga0207643_10195992
2514 Ga0207643_10234962
2515 Ga0207643_10411311
2516 Ga0207643_10793075
2517 Ga0207643_10919221
2518 Ga0207643_10935585
2519 Ga0207684_10095825
2520 Ga0207684_10220997
2521 Ga0207684_10518557
2522 Ga0207684_10920302
2523 Ga0207684_11023530
2524 Ga0207654_10158211
2525 Ga0207707_10030021
2526 Ga0207693_10032205
2527 Ga0207693_10741698
2528 Ga0207660_10166418
2529 Ga0207660_10184365
2530 Ga0207660_10384042
2531 Ga0207660_10451738
2532 Ga0207660_11460858
2533 Ga0207662_10003200
2534 Ga0207662_10030980
2535 Ga0207662_10156944
2536 Ga0207662_10160812
2537 Ga0207662_10194251
2538 Ga0207662_10237935
2539 Ga0207662_10470489
2540 Ga0207657_10295678
2541 Ga0207657_10798209
2542 Ga0207649_10018539
2543 Ga0207649_10157926
2544 Ga0207649_10601098
2545 Ga0207649_10639142
2546 Ga0207652_10189796
2547 Ga0207646_10120102
2548 Ga0207646_10166324
2549 Ga0207646_10288753
2550 Ga0207646_10390394
2551 Ga0207646_11755045
2552 Ga0207681_10003610
2553 Ga0207681_10010850
2554 Ga0207681_10153791
2555 Ga0207681_10253884
2556 Ga0207681_10390341
2557 Ga0207681_10534268
2558 Ga0207681_10958236
2559 Ga0207681_11087563
2560 Ga0207681_11486801
2561 Ga0207694_11386903
2562 Ga0207650_10028707
2563 Ga0207650_10060265
2564 Ga0207650_10141949
2565 Ga0207650_10194492
2566 Ga0207650_10216404
2567 Ga0207650_10221723
2568 Ga0207650_10536255
2569 Ga0207650_10624260
2570 Ga0207650_10983689
2571 Ga0207650_11133404
2572 Ga0207650_11268438
2573 Ga0207659_10010993
2574 Ga0207659_10043481
2575 Ga0207659_10067577
2576 Ga0207659_10147189
2577 Ga0207659_10153099
2578 Ga0207659_10381905
2579 Ga0207659_10424576
2580 Ga0207659_10425176
2581 Ga0207659_10461407
2582 Ga0207659_10502597
2583 Ga0207659_10503555
2584 Ga0207659_10607906
2585 Ga0207659_10868420
2586 Ga0207659_11014355
2587 Ga0207659_11087766
2588 Ga0207659_11088966
2589 Ga0207687_10405824
2590 Ga0207687_10822312
2591 Ga0207687_10996575
2592 Ga0207700_10005256
2593 Ga0207644_10018034
2594 Ga0207644_10452454
2595 Ga0207644_10630925
2596 Ga0207644_11208531
2597 Ga0207690_10046001
2598 Ga0207690_10121160
2599 Ga0207690_10177085
2600 Ga0207690_10610160
2601 Ga0207690_10799958
2602 Ga0207690_11035729
2603 Ga0207706_10005190
2604 Ga0207706_10044964
2605 Ga0207706_10156986
2606 Ga0207706_10756872
2607 Ga0207706_11007593
2608 Ga0207686_10251325
2609 Ga0207686_10254623
2610 Ga0207686_10284028
2611 Ga0207686_10737134
2612 Ga0207709_10015105
2613 Ga0207709_10049606
2614 Ga0207709_11612661
2615 Ga0207670_10032315
2616 Ga0207670_10139766
2617 Ga0207670_10155653
2618 Ga0207670_10182884
2619 Ga0207670_10830035
2620 Ga0207670_11013481
2621 Ga0207670_11910668
2622 Ga0207669_10037520
2623 Ga0207669_10135020
2624 Ga0207669_10172455
2625 Ga0207669_10516967
2626 Ga0207704_10057827
2627 Ga0207704_10085927
2628 Ga0207704_10092318
2629 Ga0207704_10173570
2630 Ga0207704_10447504
2631 Ga0207704_10984942
2632 Ga0207665_10822309
2633 Ga0207691_10000239
2634 Ga0207691_10036868
2635 Ga0207691_10043175
2636 Ga0207691_10046646
2637 Ga0207691_10051379
2638 Ga0207691_10295663
2639 Ga0207691_10360409
2640 Ga0207691_10869975
2641 Ga0207691_11609732
2642 Ga0207711_10021329
2643 Ga0207711_10031939
2644 Ga0207711_10204662
2645 Ga0207711_10268590
2646 Ga0207711_10349380
2647 Ga0207711_10691829
2648 Ga0207711_11193478
2649 Ga0207711_12144345
2650 Ga0207689_10003638
2651 Ga0207689_10014641
2652 Ga0207689_10029381
2653 Ga0207689_10035267
2654 Ga0207689_10084114
2655 Ga0207689_10133601
2656 Ga0207689_10336412
2657 Ga0207689_10723935
2658 Ga0207661_11810926
2659 Ga0207679_10026957
2660 Ga0207679_10056775
2661 Ga0207679_10061779
2662 Ga0207679_10237538
2663 Ga0207679_10240027
2664 Ga0207679_10359356
2665 Ga0207679_10429603
2666 Ga0207679_10905811
2667 Ga0207679_11979131
2668 Ga0207667_10511748
2669 Ga0207651_10047431
2670 Ga0207651_10065560
2671 Ga0207651_10156442
2672 Ga0207651_10274330
2673 Ga0207651_10331791
2674 Ga0207651_10513033
2675 Ga0207651_10540266
2676 Ga0207651_10677082
2677 Ga0207651_10722213
2678 Ga0207712_10020206
2679 Ga0207712_10025216
2680 Ga0207712_10087933
2681 Ga0207712_10131257
2682 Ga0207712_10347558
2683 Ga0207712_10447097
2684 Ga0207712_11092920
2685 Ga0207712_11118843
2686 Ga0207712_11773909
2687 Ga0207668_10255299
2688 Ga0207668_10347608
2689 Ga0207668_10686280
2690 Ga0207668_10824329
2691 Ga0207668_11414219
2692 Ga0207668_11543854
2693 Ga0207640_10102475
2694 Ga0207640_10965696
2695 Ga0207658_10069444
2696 Ga0207658_10191923
2697 Ga0207658_10219518
2698 Ga0207658_10432497
2699 Ga0207658_10590333
2700 Ga0207677_10055612
2701 Ga0207677_10489755
2702 Ga0207677_10781184
2703 Ga0207677_11029476
2704 Ga0207677_11574095
2705 Ga0207703_10009365
2706 Ga0207703_10041677
2707 Ga0207703_10109568
2708 Ga0207703_10141957
2709 Ga0207703_10825891
2710 Ga0207639_10066993
2711 Ga0207678_10201267
2712 Ga0207678_10867584
2713 Ga0207708_10008322
2714 Ga0207708_10035461
2715 Ga0207708_10112169
2716 Ga0207708_10148739
2717 Ga0207708_10262877
2718 Ga0207708_10639095
2719 Ga0207708_10644522
2720 Ga0207708_10803718
2721 Ga0207708_10968341
2722 Ga0207641_10053541
2723 Ga0207641_10148494
2724 Ga0207641_10216711
2725 Ga0207641_10388821
2726 Ga0207641_11899274
2727 Ga0207641_12387757
2728 Ga0207648_10005096
2729 Ga0207648_10009645
2730 Ga0207648_10051234
2731 Ga0207648_10102428
2732 Ga0207648_10178752
2733 Ga0207648_10270290
2734 Ga0207648_10516875
2735 Ga0207648_10649501
2736 Ga0207648_10740261
2737 Ga0207648_11434418
2738 Ga0207648_12071355
2739 Ga0207676_10092775
2740 Ga0207676_10175669
2741 Ga0207676_10263626
2742 Ga0207676_10540002
2743 Ga0207676_11142258
2744 Ga0207674_10107420
2745 Ga0207674_10108580
2746 Ga0207674_10131336
2747 Ga0207674_10158850
2748 Ga0207674_10323039
2749 Ga0207674_11064609
2750 Ga0207675_100005724
2751 Ga0207675_100022564
2752 Ga0207675_100070901
2753 Ga0207675_100166549
2754 Ga0207675_100429742
2755 Ga0207675_100781734
2756 Ga0207675_101457217
2757 Ga0207675_101458169
2758 Ga0207675_102190776
2759 Ga0207683_10002140
2760 Ga0207683_10036397
2761 Ga0207683_10084807
2762 Ga0207683_10129472
2763 Ga0207683_10167894
2764 Ga0207683_10171952
2765 Ga0207683_10256952
2766 Ga0207683_10438629
2767 Ga0207683_10445439
2768 Ga0207683_11183201
2769 Ga0207698_10215666
2770 Ga0207698_10266732
2771 Ga0207698_10401482
2772 Ga0207698_10527512
2773 Ga0207698_10565191
2774 Ga0209973_1018226
2775 Ga0209969_1065712
2776 Ga0209996_1063244
2777 Ga0210000_1040959
2778 Ga0209968_1006266
2779 Ga0209999_1031658
2780 Ga0209982_1025828
2781 Ga0209970_1014763
2782 Ga0210002_1026697
2783 Ga0209983_1058324
2784 Ga0209998_10095070
2785 Ga0209813_10021164
2786 Ga0209974_10057113
2787 Ga0209974_10066894
2788 Ga0207428_10000349
2789 Ga0207428_10000712
2790 Ga0207428_10003385
2791 Ga0207428_10003621
2792 Ga0207428_10005253
2793 Ga0207428_10014253
2794 Ga0207428_10020924
2795 Ga0207428_10092864
2796 Ga0207428_10149291
2797 Ga0207428_10364693
2798 Ga0207428_10436585
2799 Ga0207428_10518742
2800 Ga0207428_10590962
2801 Ga0207428_10692890
2802 Ga0268266_11071921
2803 Ga0268266_11283796
2804 Ga0268265_10001193
2805 Ga0268265_10009264
2806 Ga0268265_10019011
2807 Ga0268265_10315492
2808 Ga0268265_10361483
2809 Ga0268265_10421163
2810 Ga0268265_10447961
2811 Ga0268265_10557341
2812 Ga0268265_10850355
2813 Ga0268265_10990743
2814 Ga0268264_10041346
2815 Ga0268264_10090200
2816 Ga0268264_10321033
2817 Ga0268264_10458881
2818 Ga0268264_10591113
2819 Ga0316178_1121891
2820 Ga0316178_1125099
2821 Ga0307408_100045422
2822 Ga0307408_100078654
2823 Ga0307408_100110251
2824 Ga0307408_100327780
2825 Ga0307408_100330602
2826 Ga0307408_100535976
2827 Ga0307408_100585827
2828 Ga0307408_100740419
2829 Ga0307408_100985467
2830 Ga0307405_10036153
2831 Ga0307405_10103932
2832 Ga0307405_10279159
2833 Ga0307405_10433885
2834 Ga0307405_10530239
2835 Ga0307413_10082909
2836 Ga0307413_10212256
2837 Ga0307413_10296776
2838 Ga0307413_10556385
2839 Ga0307413_10771005
2840 Ga0307413_11568089
2841 Ga0307413_11854035
2842 Ga0307410_10033548
2843 Ga0307410_10035916
2844 Ga0307410_10127209
2845 Ga0307410_10252476
2846 Ga0307410_10451403
2847 Ga0307410_10819182
2848 Ga0307406_10028273
2849 Ga0307406_10032820
2850 Ga0307406_10258929
2851 Ga0307406_10306786
2852 Ga0307406_10376173
2853 Ga0307406_11163277
2854 Ga0307406_11404059
2855 Ga0307407_10009129
2856 Ga0307407_10069122
2857 Ga0307407_10437374
2858 Ga0307407_10746492
2859 Ga0307407_10818033
2860 Ga0307407_10976059
2861 Ga0307412_10021563
2862 Ga0307412_10072599
2863 Ga0307412_10248597
2864 Ga0307412_10287603
2865 Ga0307412_10325164
2866 Ga0307412_10461052
2867 Ga0307412_11031866
2868 Ga0307412_11168664
2869 Ga0307412_12230138
2870 Ga0307409_100011203
2871 Ga0307409_100022487
2872 Ga0307409_100026651
2873 Ga0307409_100098923
2874 Ga0307409_100184355
2875 Ga0307409_100207098
2876 Ga0307409_101677757
2877 Ga0307409_102243049
2878 Ga0307416_100001674
2879 Ga0307416_100009915
2880 Ga0307416_100026805
2881 Ga0307416_100056674
2882 Ga0307416_100131865
2883 Ga0307416_100153108
2884 Ga0307416_100160503
2885 Ga0307416_100620634
2886 Ga0307416_101043049
2887 Ga0307416_101761539
2888 Ga0307416_102224680
2889 Ga0307416_102511534
2890 Ga0307414_10358836
2891 Ga0307414_10674327
2892 Ga0307414_10959155
2893 Ga0307414_11053250
2894 Ga0307414_11675213
2895 Ga0307411_10012530
2896 Ga0307411_10033406
2897 Ga0307411_10045602
2898 Ga0307411_10142666
2899 Ga0307411_10272078
2900 Ga0307411_10332286
2901 Ga0307411_10401465
2902 Ga0307411_10402475
2903 Ga0307411_10480110
2904 Ga0307411_10629031
2905 Ga0307411_10659286
2906 Ga0307411_10720879
2907 Ga0307411_11909683
2908 Ga0307415_100014778
2909 Ga0307415_100044852
2910 Ga0307415_100238149
2911 Ga0307415_102053544
2912 Ga0373930_0056077
2913 Ga0373930_0143019
2914 Ga0373948_0096995
2915 Ga0373950_0140565
2916 Ga0373959_0008472
2917 Ga0373938_0086091
2918 Ga0373938_0090990
2919 Ga0373928_0048271
2920 Ga0373934_0004468
2921 Ga0373934_0277115
2922 Ga0373940_0119441
2923 Ga0373949_0016508
2924 Ga0373949_0086483
2925 Ga0373951_0024736
2926 Ga0373923_0337989
2927 Ga0373923_0590249
2928 Ga0373932_0006139
2929 Ga0373939_0050966
2930 Ga0373953_0046414
2931 Ga0373956_0022440
2932 Ga0373956_0615016
2933 Ga0373957_0044026
2934 Ga0373943_0647648
2935 Ga0373946_0143261
2936 Ga0373955_0008601
2937 Ga0373961_0033334
2938 Ga0373962_0010858
2939 Ga0373962_0061456
2940 Ga0373931_0010056
2941 Ga0373935_0117923
2942 Ga0373933_0004292
2943 Ga0373947_0021292
2944 Ga0373947_0186396
2945 Ga0373937_0000636
2946 Ga0373937_0026134
2947 Ga0373937_0085337
2948 Ga0373925_1046224
2949 Ga0373925_1428439
2950 Ga0436365_0953110
2951 Ga0439439_0078764
2952 Ga0439439_0091287
2953 Ga0439447_144857
2954 Ga0439453_0002220
2955 Ga0439453_0073614
2956 Ga0451800_1242213
2957 Ga0451802_1299424
2958 Ga0451804_0497166
2959 Ga0451807_2002591
2960 Ga0451839_1004516
2961 Ga0451853_2851514
2962 Ga0451853_3766231
2963 Ga0439433_0034595
2964 Ga0439433_0110546
2965 Ga0439433_0197986
2966 Ga0439443_031403
2967 Ga0439449_0053239
2968 Ga0439450_005909
2969 Ga0439451_104283
2970 Ga0439454_013548
2971 Ga0439455_0114671
2972 Ga0439462_0025023
2973 Ga0450921_035558
2974 Ga0450923_017462
2975 Ga0450923_159847
2976 Ga0450896_015177
2977 Ga0450910_011732
2978 Ga0439446_0003023
2979 Ga0439446_0021022
2980 Ga0439446_0084355
2981 Ga0439434_0054175
2982 Ga0439434_0055441
2983 Ga0439434_0062109
2984 Ga0439434_0114700
2985 Ga0439434_0311933
2986 Ga0439435_0003643
2987 Ga0439435_0011938
2988 Ga0439435_0102358
2989 Ga0439435_0203733
2990 Ga0439435_0209413
2991 Ga0439464_0046054
2992 Ga0439464_0167033
2993 Ga0439460_0043518
2994 Ga0439460_0158880
2995 Ga0439460_0333968
2996 Ga0451577_0038896
2997 Ga0451577_0533990
2998 Ga0451577_1053720
2999 Ga0451577_1576744
3000 Ga0451577_1619139
3001 Ga0439440_0027927
3002 Ga0439440_0099536
3003 Ga0439440_0166330
3004 Ga0453683_0091878
3005 Ga0453683_0528129
3006 Ga0451576_0012634
3007 Ga0451576_0031403
3008 Ga0451576_0058861
3009 Ga0451576_0259416
3010 Ga0451576_0273634
3011 Ga0451576_0323658
3012 Ga0451576_0583309
3013 Ga0451576_0618807
3014 Ga0451576_0620486
3015 Ga0451576_0970371
3016 Ga0466967_0595390
3017 Ga0495592_0175793
3018 Ga0495592_0214714
3019 Ga0495592_0322870
3020 Ga0495603_0028716
3021 Ga0495603_0203919
3022 Ga0495603_0304534
3023 Ga0495591_095428
3024 Ga0495629_0010127
3025 Ga0495629_0432018
3026 Ga0495629_0566880
3027 Ga0495641_0411295
3028 Ga0495651_0086226
3029 Ga0495653_0465696
3030 Ga0495580_0068165
3031 Ga0495582_0102419
3032 Ga0495639_0089871
3033 Ga0495584_0006908
3034 Ga0495594_0244993
3035 Ga0495594_0579791
3036 Ga0495596_0248217
3037 Ga0495628_0282618
3038 Ga0495628_0886300
3039 Ga0495630_0355794
3040 Ga0495643_0002815
3041 Ga0495644_0010822
3042 Ga0495663_0045519
3043 Ga0495663_0058320
3044 Ga0495663_0184678
3045 Ga0495642_0020701
3046 Ga0495642_0067859
3047 Ga0495665_0218846
3048 Ga0495665_0234161
3049 Ga0495640_0476707
3050 Ga0495598_0007773
3051 Ga0495598_0024579
3052 Ga0495598_0036341
3053 Ga0495598_0150546
3054 Ga0495609_0012011
3055 Ga0495609_0042546
3056 Ga0495621_0014062
3057 Ga0495621_0027383
3058 Ga0495621_0042478
3059 Ga0495621_0095893
3060 Ga0495621_0148753
3061 Ga0495621_0177310
3062 Ga0495621_0401471
3063 Ga0495645_0152782
3064 Ga0495645_0700655
3065 Ga0495633_0042236
3066 Ga0495633_0366956
3067 Ga0495656_0013094
3068 Ga0495656_0174465
3069 Ga0495656_0480620
3070 Ga0495634_0108588
3071 Ga0495659_0004263
3072 Ga0495659_0014786
3073 Ga0495659_0024829
3074 Ga0495659_0028143
3075 Ga0495659_0035778
3076 Ga0495659_0184986
3077 Ga0495588_0185482
3078 Ga0495657_0228745
3079 Ga0495599_0158825
3080 Ga0495599_0301724
3081 Ga0495599_0393328
3082 Ga0495647_0193634
3083 Ga0495658_0022875
3084 Ga0495658_0300792
3085 Ga0495658_0340284
3086 Ga0495658_0624089
3087 Ga0495669_0072519
3088 Ga0495669_0146586
3089 Ga0495613_0114988
3090 Ga0495613_0500522
3091 Ga0495670_0011708
3092 Ga0495600_0309593
3093 Ga0495636_0009944
3094 Ga0495636_0090396
3095 Ga0495636_0509187
3096 Ga0495636_0634507
3097 Ga0495636_0674064
3098 Ga0495680_0134588
3099 Ga0495680_0399604
3100 Ga0495677_0049108
3101 Ga0495677_0118788
3102 Ga0495685_031609
3103 Ga0495681_0319422
3104 Ga0495684_0089234
3105 Ga0495684_0460863
3106 Ga0495684_0505847
3107 Ga0495615_0316624
3108 Ga0496100_0121371
3109 Ga0496101_0195879
3110 Ga0496101_0679749
3111 Ga0496102_0206051
3112 Ga0496102_0261172
3113 Ga0496102_0269420
3114 Ga0496102_0569143
3115 Ga0496102_1671889
3116 Ga0496103_0095295
3117 Ga0496103_0545996
3118 Ga0496104_0174331
3119 Ga0496104_0460648
3120 Ga0496104_0738223
3121 Ga0496104_0746304
3122 Ga0496104_0970935
3123 Ga0496105_0490804
3124 Ga0496105_0744554
3125 Ga0496106_0037675
3126 Ga0496106_0127079
3127 Ga0496106_0159753
3128 Ga0496106_0956915
3129 Ga0496106_1354798
3130 Ga0496106_1368031
3131 Ga0496107_0060010
3132 Ga0496108_0801139
3133 Ga0496108_0901811
3134 Ga0496108_1104027
3135 Ga0496109_0101586
3136 Ga0496109_0297960
3137 Ga0496109_0445681
3138 Ga0496110_0122855
3139 Ga0496110_0239227
3140 Ga0496111_0080696
3141 Ga0496112_0182869
3142 Ga0496112_0188578
3143 Ga0496112_0269256
3144 Ga0496112_0354959
3145 Ga0496112_0474935
3146 Ga0496113_0048818
3147 Ga0496113_0191155
3148 Ga0496113_0736987
3149 Ga0496113_1322015
3150 Ga0496114_0055265
3151 Ga0496114_0448148
3152 Ga0501292_067102
3153 Ga0501298_045014
3154 Ga0501299_087856
3155 Ga0501031_0038545
3156 Ga0501031_0141434
3157 Ga0501031_0251274
3158 Ga0501031_0448789
3159 Ga0501031_0601906
3160 Ga0501031_0723589
3161 Ga0501031_1003046
3162 Ga0501032_0384007
3163 Ga0501032_0493440
3164 Ga0501033_1029612
3165 Ga0501034_0015608
3166 Ga0501036_0028391
3167 Ga0501036_0061087
3168 Ga0501036_0061802
3169 Ga0501036_0110384
3170 Ga0501036_0171280
3171 Ga0501036_0278905
3172 Ga0501036_1060526
3173 Ga0501038_0099437
3174 Ga0501038_0250481
3175 Ga0501038_0639775
3176 Ga0501039_0053404
3177 Ga0501039_0078127
3178 Ga0501039_0167072
3179 Ga0501039_0212573
3180 Ga0501039_0504810
3181 Ga0501039_1226203
3182 Ga0501040_0030080
3183 Ga0501040_0038103
3184 Ga0501040_0060087
3185 Ga0501040_0116438
3186 Ga0501040_0226057
3187 Ga0501040_0255070
3188 Ga0501040_0498434
3189 Ga0501040_0699699
3190 Ga0501040_0987307
3191 Ga0501041_0015406
3192 Ga0501041_0054344
3193 Ga0501041_0083530
3194 Ga0501041_0103906
3195 Ga0501041_0111791
3196 Ga0501041_0237919
3197 Ga0501041_0254373
3198 Ga0501041_0557464
3199 Ga0501041_0864701
3200 Ga0501042_0004352
3201 Ga0501042_0006294
3202 Ga0501042_0049639
3203 Ga0501042_0076956
3204 Ga0501042_0079656
3205 Ga0501042_0201100
3206 Ga0501042_0300280
3207 Ga0501042_0316617
3208 Ga0501042_0619301
3209 Ga0501042_0854305
3210 Ga0501042_0899896
3211 Ga0501042_1196565
3212 Ga0501042_1247838
3213 Ga0501046_0077616
3214 Ga0501046_0144572
3215 Ga0501046_0203832
3216 Ga0501046_0365586
3217 Ga0501046_0490987
3218 Ga0501046_0580604
3219 Ga0501046_0854914
3220 Ga0501046_0881826
3221 Ga0501046_0975397
3222 Ga0501048_0041238
3223 Ga0501048_0190242
3224 Ga0501048_0227370
3225 Ga0501067_0218144
3226 Ga0501067_0551759
3227 Ga0501068_0416688
3228 Ga0501068_0575080
3229 Ga0501068_0820407
3230 Ga0501068_0967867
3231 Ga0501069_0016549
3232 Ga0501069_0397933
3233 Ga0501070_0655922
3234 Ga0501071_0031633
3235 Ga0501071_0048323
3236 Ga0501071_0063771
3237 Ga0501071_0081426
3238 Ga0501071_0107221
3239 Ga0501071_0109853
3240 Ga0501071_0242716
3241 Ga0501071_0306179
3242 Ga0501071_0347803
3243 Ga0501071_0354867
3244 Ga0501071_0432787
3245 Ga0501071_0523538
3246 Ga0501071_0670146
3247 Ga0501071_0996713
3248 Ga0501072_0029646
3249 Ga0501072_0041729
3250 Ga0501072_0044490
3251 Ga0501072_0048029
3252 Ga0501072_0048343
3253 Ga0501072_0089431
3254 Ga0501072_0431023
3255 Ga0501072_0472281
3256 Ga0501072_0501968
3257 Ga0501073_0213239
3258 Ga0501073_0215792
3259 Ga0501073_0865991
3260 Ga0501073_0884497
3261 Ga0501073_0984686
3262 Ga0501074_0035716
3263 Ga0501074_0092250
3264 Ga0501074_0102598
3265 Ga0501074_0258520
3266 Ga0501074_0479483
3267 Ga0501074_1040128
3268 Ga0501075_0001534
3269 Ga0501075_0049516
3270 Ga0501075_0054943
3271 Ga0501075_0096446
3272 Ga0501075_0121378
3273 Ga0501075_0230007
3274 Ga0501075_0248926
3275 Ga0501075_0342117
3276 Ga0501075_0580187
3277 Ga0501075_0682699
3278 Ga0501075_0818579
3279 Ga0501075_0949379
3280 Ga0501075_1521763
3281 Ga0501076_0019323
3282 Ga0501076_0038764
3283 Ga0501076_0075398
3284 Ga0501076_0096096
3285 Ga0501076_0137576
3286 Ga0501076_0182934
3287 Ga0501076_0207182
3288 Ga0501076_0212453
3289 Ga0501076_0237592
3290 Ga0501076_0241434
3291 Ga0501076_0551030
3292 Ga0501076_0557294
3293 Ga0501076_0698563
3294 Ga0501076_1632557
3295 Ga0501077_0089699
3296 Ga0501077_0134659
3297 Ga0501077_0393406
3298 Ga0501077_0457684
3299 Ga0501077_0530309
3300 Ga0501077_0719995
3301 Ga0501077_0873736
3302 Ga0501202_092255
3303 Ga0501216_061920
3304 Ga0501227_112764
3305 Ga0501249_061747
3306 Ga0501257_271935
3307 Ga0501225_0073986
3308 Ga0501245_038230
3309 Ga0501079_0027535
3310 Ga0501079_0131308
3311 Ga0501079_0148554
3312 Ga0501079_0228858
3313 Ga0501079_0234487
3314 Ga0501079_0234523
3315 Ga0501079_0325735
3316 Ga0501079_0332332
3317 Ga0501079_0405745
3318 Ga0501079_0464341
3319 Ga0501079_0505695
3320 Ga0501079_0635786
3321 Ga0501079_1397826
3322 Ga0501079_1499221
3323 Ga0501080_0027010
3324 Ga0501080_0148803
3325 Ga0501080_0171834
3326 Ga0501080_0232516
3327 Ga0501080_0591806
3328 Ga0501080_0689315
3329 Ga0501080_0732812
3330 Ga0501080_0823799
3331 Ga0501081_0000708
3332 Ga0501081_0076474
3333 Ga0501081_0118553
3334 Ga0501081_0172852
3335 Ga0501081_0255552
3336 Ga0501081_0398103
3337 Ga0501081_0523685
3338 Ga0501081_0554181
3339 Ga0501081_1103045
3340 Ga0501081_1177872
3341 Ga0501083_0208336
3342 Ga0501083_0288049
3343 Ga0501265_092295
3344 Ga0501273_048209
3345 Ga0501035_0353546
3346 Ga0501035_0387322
3347 Ga0501035_0520082
3348 Ga0501035_0530483
3349 Ga0501035_0743217
3350 Ga0501045_0015789
3351 Ga0501045_0064388
3352 Ga0501045_0079907
3353 Ga0501045_0363578
3354 Ga0501045_0366621
3355 Ga0501045_0527886
3356 Ga0501045_0531618
3357 Ga0501045_0650461
3358 Ga0501045_0688110
3359 Ga0501045_0869495
3360 nmdc:mga03n38_266970_c1
3361 nmdc:mga0yw44_52317_c1
3362 nmdc:mga0k408_15652_c1
3363 nmdc:mga06z11_141222_c1
3364 nmdc:mga04h51_34990_c1
3365 nmdc:mga07m45_795385_c1
3366 nmdc:mga05p37_106692_c1
3367 nmdc:mga05p37_1504302_c1
3368 nmdc:mga05p37_154728_c1
3369 nmdc:mga05p37_171660_c1
3370 nmdc:mga05p37_1804323_c1
3371 nmdc:mga05p37_1976_c1
3372 nmdc:mga05p37_197987_c1
3373 nmdc:mga05p37_199120_c1
3374 nmdc:mga05p37_223620_c1
3375 nmdc:mga05p37_2275317_c1
3376 nmdc:mga05p37_2706_c1
3377 nmdc:mga05p37_317756_c1
3378 nmdc:mga05p37_337377_c1
3379 nmdc:mga05p37_526088_c1
3380 nmdc:mga05p37_585099_c1
3381 nmdc:mga05p37_59257_c1
3382 nmdc:mga05p37_68798_c1
3383 nmdc:mga05p37_701855_c1
3384 nmdc:mga05p37_93129_c1
3385 nmdc:mga05p37_974318_c1
3386 nmdc:mga09592_1170006_c1
3387 nmdc:mga09592_1186048_c1
3388 nmdc:mga09592_1243835_c1
3389 nmdc:mga09592_23365_c1
3390 nmdc:mga09592_27002_c1
3391 nmdc:mga09592_355668_c1
3392 nmdc:mga09592_381873_c1
3393 nmdc:mga09592_4784_c1
3394 nmdc:mga09592_5871_c1
3395 nmdc:mga09592_6156_c1
3396 nmdc:mga09592_62474_c1
3397 nmdc:mga09592_8217_c1
3398 nmdc:mga09592_9092_c1
3399 nmdc:mga0qj67_1128930_c1
3400 nmdc:mga0qj67_1161620_c1
3401 nmdc:mga0qj67_123623_c1
3402 nmdc:mga0qj67_14732_c1
3403 nmdc:mga0qj67_148525_c1
3404 nmdc:mga0qj67_1512_c1
3405 nmdc:mga0qj67_196722_c1
3406 nmdc:mga0qj67_205756_c1
3407 nmdc:mga0qj67_23280_c1
3408 nmdc:mga0qj67_299002_c1
3409 nmdc:mga0qj67_363959_c1
3410 nmdc:mga0qj67_43412_c1
3411 nmdc:mga0qj67_52665_c1
3412 nmdc:mga0qj67_615366_c1
3413 nmdc:mga06r32_1028982_c1
3414 nmdc:mga06r32_104941_c1
3415 nmdc:mga06r32_13471_c1
3416 nmdc:mga06r32_15765_c1
3417 nmdc:mga06r32_16110_c1
3418 nmdc:mga06r32_178119_c1
3419 nmdc:mga06r32_237906_c1
3420 nmdc:mga06r32_349348_c1
3421 nmdc:mga06r32_3881_c1
3422 nmdc:mga06r32_407277_c1
3423 nmdc:mga06r32_407433_c1
3424 nmdc:mga06r32_41924_c1
3425 nmdc:mga06r32_506831_c1
3426 nmdc:mga06r32_529084_c1
3427 nmdc:mga06r32_558884_c1
3428 nmdc:mga08y16_12708_c1
3429 nmdc:mga08y16_1710_c1
3430 nmdc:mga08y16_2030909_c1
3431 nmdc:mga08y16_225793_c1
3432 nmdc:mga08y16_23899_c1
3433 nmdc:mga08y16_242504_c1
3434 nmdc:mga08y16_25391_c1
3435 nmdc:mga08y16_262941_c1
3436 nmdc:mga08y16_38458_c1
3437 nmdc:mga08y16_48960_c1
3438 nmdc:mga08y16_512312_c1
3439 nmdc:mga08y16_58928_c1
3440 nmdc:mga08y16_61068_c1
3441 nmdc:mga08y16_611_c1
3442 nmdc:mga08y16_661563_c1
3443 nmdc:mga08y16_680507_c1
3444 nmdc:mga08y16_92341_c1
3445 nmdc:mga0n895_136748_c1
3446 nmdc:mga0n895_1679667_c1
3447 nmdc:mga0n895_1711348_c1
3448 nmdc:mga0n895_266830_c1
3449 nmdc:mga0n895_267989_c1
3450 nmdc:mga0n895_409293_c1
3451 nmdc:mga0n895_45123_c1
3452 nmdc:mga0n895_46172_c1
3453 nmdc:mga0n895_5739_c1
3454 nmdc:mga0n895_65562_c1
3455 nmdc:mga0n895_70695_c1
3456 nmdc:mga0n895_796655_c1
3457 nmdc:mga0n895_87579_c1
3458 nmdc:mga0n895_916967_c1
3459 nmdc:mga0rr50_108495_c1
3460 nmdc:mga0rr50_12095_c1
3461 nmdc:mga0rr50_13165_c1
3462 nmdc:mga0rr50_13953_c1
3463 nmdc:mga0rr50_290916_c1
3464 nmdc:mga0rr50_33925_c1
3465 nmdc:mga0rr50_393479_c1
3466 nmdc:mga0rr50_41835_c1
3467 nmdc:mga0rr50_430192_c1
3468 nmdc:mga08x19_558855_c1
3469 nmdc:mga08x19_780647_c1
3470 nmdc:mga0a205_139238_c1
3471 nmdc:mga0a205_146048_c1
3472 nmdc:mga0a205_197617_c1
3473 nmdc:mga0a205_265250_c1
3474 nmdc:mga0a205_2970_c1
3475 nmdc:mga0a205_34005_c1
3476 nmdc:mga0a205_44696_c1
3477 nmdc:mga0a205_475349_c1
3478 nmdc:mga0a205_492_c1
3479 nmdc:mga0a205_53372_c1
3480 nmdc:mga0a205_60215_c1
3481 nmdc:mga0a205_81248_c1
3482 nmdc:mga0a205_88597_c2
3483 nmdc:mga0a205_90545_c1
3484 nmdc:mga0a205_986_c1
3485 Ga0495601_0209666
3486 Ga0495595_0078472
3487 Ga0500627_0236848
3488 Ga0501084_0023866
3489 Ga0501084_0040229
3490 Ga0501084_0084650
3491 Ga0501084_0183348
3492 Ga0501084_0189565
3493 Ga0501084_0229065
3494 Ga0501084_0427270
3495 Ga0501084_0506312
3496 Ga0501084_0852898
3497 Ga0501084_1438926
3498 Ga0590071_000034
3499 Ga0590071_000282
3500 Ga0590071_070774
3501 Ga0590074_001566
3502 Ga0590074_021132
3503 Ga0590074_059239
3504 Ga0590074_086406
3505 Ga0590075_000025
3506 Ga0590075_000872
3507 Ga0590077_000006
3508 Ga0590077_000238
3509 Ga0590077_043048
3510 Ga0501082_0020583
3511 Ga0501082_0021769
3512 Ga0501082_0121692
3513 Ga0501082_0176603
3514 Ga0501082_0286730
3515 Ga0501082_0333163
3516 Ga0501082_0378492
3517 Ga0501082_0506550
3518 Ga0501082_0555722
3519 Ga0501082_0629369
3520 Ga0501082_0635418
3521 Ga0501082_0929052
3522 Ga0501082_1780991
3523 Ga0530510_0001780
3524 Ga0530510_0001988
3525 Ga0530510_0018377
3526 Ga0530510_0225442
3527 Ga0530510_0341993
3528 Ga0530510_0438268
3529 Ga0530510_0640768
3530 Ga0530510_0649331
3531 Ga0530510_0806683
3532 Ga0530510_0863117

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

2

107

0.94

PF13466

STAS_2

STAS domain

19

95

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f43-assembly1.cif.gz_A-2 crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution 0.9372 3 110
4qtp-assembly3.cif.gz_C crystal structure of an anti-sigma factor antagonist from mycobacterium paratuberculosis 0.9311 2 110
6m36-assembly1.cif.gz_H the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9304 2 102
4hyl-assembly1.cif.gz_A the crystal structure of an anti-sigma-factor antagonist from haliangium ochraceum dsm 14365 0.9182 2 113
1th8-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.9165 2 112
ID Description Score Start End Superfamily
af_A0A0N7KGR6_2_88_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9563 42 111 3.30.750.24
af_A0A0R0KL09_2_75_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9312 53 111 3.30.750.24
4qtpB00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9226 2 110 3.30.750.24
3f43A01 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.918 6 112 3.30.750.24
af_Q10QI4_508_648_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9164 6 110 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A1F2TGN8-F1-model_v4 STAS domain-containing protein 0.9912 1 112 GO:0043856
AF-A0A2V7XEN0-F1-model_v4 Anti-sigma factor antagonist 0.9899 2 110 GO:0043856
AF-A0A2V7XAJ0-F1-model_v4 Anti-sigma factor antagonist 0.9868 1 112 GO:0043856
AF-A0A2V7VRZ4-F1-model_v4 Anti-sigma factor antagonist 0.9854 1 113 GO:0043856
AF-A0A2V7XFS2-F1-model_v4 STAS domain-containing protein 0.9851 1 112 GO:0043856

Map