F495608
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1760 | 737 | 3520 | 400 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10000770|Ga0105238_1000077014 |
| Length | 423 |
| Sequence | MLNPGSGEVVCYHGSPFETGRAFGVVMFRRMLLAVLIVAAALPLGAHAQPIRIGELNSYKVFPAFLEPYRKGMELARDEVNAAGGVLGRPIEIVSRDDGGTPGDAVRVAEELVARERVAMLMGTYASNVGLAVADFAKQRRVLFLAAEPLTDKIVWDDGNAYTFRLRASTYMQTAMLVPEAAKLGKKRWAIVYPNYEYGQAATATFKQQMIARMGAGNVEFVEQATPLGKIEPGPVVQALLDAKPDAIFSSLFGPDLARFVREGELRGLFKDRPVVDLLGGEPEYLDPLKDEAPVGWLVTGYPWYSIETSEHRKFRAAYQAKFNDYPRLGSVVGYTAVKSAAAAIARAGSTDTDKLVAAMRDLPVDMPFGRIEFRAIDHQSTMGAYVGRTAVKDGKGIMVDWHYADGKDFLPPDDVVRKLRKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 14 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 88 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 89 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 90 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 98 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 99 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 100 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 101 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 102 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 103 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 105 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 106 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 108 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 109 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 110 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 111 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 112 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 116 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 117 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 118 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 119 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 121 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 122 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 123 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 124 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 125 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 126 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 127 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 128 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 129 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 130 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 132 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 133 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 134 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 135 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 136 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 137 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 164 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 168 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 169 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 172 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 173 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 174 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 175 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 176 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 183 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 184 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 187 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 269 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 270 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 272 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 273 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 280 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 282 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 284 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 288 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 289 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 290 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 291 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 292 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 293 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 294 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 295 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 296 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 297 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 298 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 299 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 300 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 301 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 302 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 303 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 304 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 305 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 306 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 307 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 308 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 309 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 310 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 311 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 312 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 313 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 314 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 315 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 316 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 317 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 318 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 319 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 320 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 321 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 322 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 323 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 324 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 325 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 326 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 327 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 328 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 329 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 330 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 331 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 332 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 333 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 334 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 335 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 336 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 337 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 338 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 339 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 340 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 341 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 342 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 343 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 344 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 345 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 346 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 347 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 348 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 349 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 350 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 351 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 352 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 353 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 354 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 355 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 356 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 357 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 358 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 359 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 360 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 361 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 362 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 363 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 364 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 365 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 366 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 367 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 368 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 369 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 370 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 371 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 372 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 373 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 374 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 375 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 376 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 377 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 378 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 379 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 441 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 443 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 444 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 445 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 446 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 447 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 448 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 449 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 450 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 451 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 452 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 453 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 454 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 455 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 456 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 457 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 458 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 459 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 460 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 461 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 462 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 463 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 464 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 492 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 493 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 494 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 495 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 497 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 498 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 499 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 500 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 501 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 502 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 503 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 504 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 511 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 512 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 513 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 514 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 519 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 520 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 521 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 522 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 523 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 524 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 525 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 526 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 527 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 528 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 529 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 530 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 531 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 532 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 533 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 534 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 535 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 536 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 537 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 538 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 539 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 540 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 541 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 542 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 543 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 544 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 545 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 546 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 547 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 548 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 549 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 550 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 551 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 552 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 553 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 554 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 555 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 556 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 557 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 558 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 559 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 560 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 561 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 562 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 563 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 564 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 565 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 566 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 567 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 568 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 569 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 570 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 571 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 572 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 573 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 574 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 575 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 576 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 577 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 578 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 579 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 580 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 581 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 582 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 583 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 584 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 585 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 586 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 587 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 588 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 589 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 590 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 591 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 592 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 593 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 594 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 595 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 596 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 597 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 598 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 599 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 600 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 601 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 602 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 603 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 604 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 605 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 606 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 607 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 608 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 609 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 610 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 611 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 612 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 613 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 614 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 615 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 616 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 617 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 618 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 619 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 620 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 621 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 622 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 623 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 624 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 625 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 626 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 627 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 628 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 629 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 630 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 631 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 632 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 633 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 634 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 635 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 636 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 637 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 638 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 639 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 640 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 641 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 642 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 643 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 644 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 645 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 646 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 647 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 648 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 649 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 650 | 2904699407 | |||
| 651 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 652 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 653 | 2906610324 | |||
| 654 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 655 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 656 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 657 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 658 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 659 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 660 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 661 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 662 | 2922368715 | |||
| 663 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 664 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 665 | 2922425934 | |||
| 666 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 667 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 668 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 669 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 670 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 671 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 672 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 673 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 674 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 675 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 676 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 677 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 678 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 679 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 680 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 681 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 682 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 683 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 684 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 685 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 686 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 687 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 688 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 689 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 690 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 691 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 692 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 693 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 694 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 695 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 696 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 697 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 698 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 699 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 700 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 701 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 702 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 703 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 704 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 705 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 706 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 707 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 708 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 709 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 710 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 711 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 712 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 713 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 714 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 715 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 716 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 717 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 718 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 719 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 720 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 721 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 722 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 723 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 724 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 725 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 726 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 727 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 728 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 729 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 730 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 731 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 732 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 733 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 734 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 735 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 736 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 737 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.84 |
| Metatranscriptomes | 0.17 |
| Isolates | 10.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.28 |
| Nodule | 6.36 |
| Rhizoplane | 3.75 |
| Rhizosphere | 71.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105238_10000770 | 3300009551 | Bacteria | 33391 |
| 2 | JGI25155J39150_1000348 | 3300002704 | Bacteria | 14622 |
| 3 | JGI25155J39150_1000397 | 3300002704 | Bacteria | 12180 |
| 4 | JGI25156J39149_1000039 | 3300002705 | Bacteria | 107108 |
| 5 | JGI25154J39366_1000059 | 3300002738 | Bacteria | 107114 |
| 6 | JGI25154J39366_1000162 | 3300002738 | Bacteria | 51833 |
| 7 | JGI25157J39369_1000057 | 3300002741 | Bacteria | 107108 |
| 8 | JGI25152J39213_1003210 | 3300002773 | Bacteria | 5685 |
| 9 | JGI25150J39212_1001186 | 3300002774 | Bacteria | 7741 |
| 10 | JGI25159J45721_1000497 | 3300002987 | Bacteria | 18012 |
| 11 | JGI25159J45721_1003112 | 3300002987 | Bacteria | 5987 |
| 12 | JGI25159J45721_1017927 | 3300002987 | Bacteria | 1445 |
| 13 | JGI25151J46595_10001481 | 3300003187 | Bacteria | 15850 |
| 14 | JGI25151J46595_10004147 | 3300003187 | Bacteria | 7742 |
| 15 | JGI25151J46595_10004723 | 3300003187 | Bacteria | 7158 |
| 16 | JGI25153J46596_10004260 | 3300003215 | Bacteria | 7742 |
| 17 | JGI25153J46596_10006245 | 3300003215 | Bacteria | 6092 |
| 18 | JGI25160J50197_1000228 | 3300003354 | Bacteria | 44139 |
| 19 | JGI25160J50197_1004539 | 3300003354 | Bacteria | 5987 |
| 20 | JGI25161J50226_1000171 | 3300003374 | Bacteria | 44139 |
| 21 | JGI25161J50226_1006232 | 3300003374 | Bacteria | 2190 |
| 22 | Ga0006562J51391_1036868 | 3300003578 | Bacteria | 5740 |
| 23 | JGI25404J52841_10007941 | 3300003659 | Bacteria | 2251 |
| 24 | JGI25404J52841_10009477 | 3300003659 | Bacteria | 2082 |
| 25 | Ga0055532_1000018 | 3300003758 | Bacteria | 305466 |
| 26 | Ga0055535_1008422 | 3300003761 | Bacteria | 1864 |
| 27 | Ga0055526_1007445 | 3300003771 | Bacteria | 5685 |
| 28 | Ga0055537_1001030 | 3300003773 | Bacteria | 12595 |
| 29 | Ga0055537_1001074 | 3300003773 | Bacteria | 12117 |
| 30 | Ga0055537_1002754 | 3300003773 | Bacteria | 5685 |
| 31 | Ga0055524_1005449 | 3300003775 | Bacteria | 5685 |
| 32 | Ga0055536_1000981 | 3300003781 | Bacteria | 18125 |
| 33 | Ga0055536_1003501 | 3300003781 | Bacteria | 8412 |
| 34 | Ga0055536_1021260 | 3300003781 | Bacteria | 1974 |
| 35 | Ga0055534_1000371 | 3300003784 | Bacteria | 28124 |
| 36 | Ga0055534_1002905 | 3300003784 | Bacteria | 5685 |
| 37 | Ga0055528_1003578 | 3300003790 | Bacteria | 7742 |
| 38 | Ga0055528_1014888 | 3300003790 | Bacteria | 2844 |
| 39 | Ga0055530_10008883 | 3300003791 | Bacteria | 3951 |
| 40 | Ga0055540_1014156 | 3300003792 | Bacteria | 2394 |
| 41 | Ga0055531_10012862 | 3300003794 | Bacteria | 3900 |
| 42 | Ga0055531_10024389 | 3300003794 | Bacteria | 2234 |
| 43 | JGI25405J52794_10013526 | 3300003911 | Bacteria | 1584 |
| 44 | Ga0055543_1001492 | 3300004625 | Bacteria | 9204 |
| 45 | Ga0055543_1002183 | 3300004625 | Bacteria | 6722 |
| 46 | Ga0055543_1002866 | 3300004625 | Bacteria | 5433 |
| 47 | Ga0065165_1002034 | 3300005262 | Bacteria | 18805 |
| 48 | Ga0065165_1002156 | 3300005262 | Bacteria | 17812 |
| 49 | Ga0065165_1004137 | 3300005262 | Bacteria | 9320 |
| 50 | Ga0065714_10029414 | 3300005288 | Bacteria | 1899 |
| 51 | Ga0070658_10043586 | 3300005327 | Bacteria | 3624 |
| 52 | Ga0070658_10202646 | 3300005327 | Bacteria | 1674 |
| 53 | Ga0070676_10014784 | 3300005328 | Bacteria | 4294 |
| 54 | Ga0070676_10021242 | 3300005328 | Bacteria | 3633 |
| 55 | Ga0070683_100020403 | 3300005329 | Bacteria | 5897 |
| 56 | Ga0070683_100080691 | 3300005329 | Bacteria | 3045 |
| 57 | Ga0070690_100024193 | 3300005330 | Bacteria | 3733 |
| 58 | Ga0070670_100006216 | 3300005331 | Bacteria | 10099 |
| 59 | Ga0070670_100010932 | 3300005331 | Bacteria | 7753 |
| 60 | Ga0070670_100020925 | 3300005331 | Bacteria | 5627 |
| 61 | Ga0070670_100024850 | 3300005331 | Bacteria | 5154 |
| 62 | Ga0070670_100026734 | 3300005331 | Bacteria | 4963 |
| 63 | Ga0070670_100034308 | 3300005331 | Bacteria | 4367 |
| 64 | Ga0070670_100097687 | 3300005331 | Bacteria | 2526 |
| 65 | Ga0070670_100254077 | 3300005331 | Bacteria | 1532 |
| 66 | Ga0068869_100001034 | 3300005334 | Bacteria | 16191 |
| 67 | Ga0068869_100007415 | 3300005334 | Bacteria | 7008 |
| 68 | Ga0070666_10005594 | 3300005335 | Bacteria | 7712 |
| 69 | Ga0070666_10010734 | 3300005335 | Bacteria | 5731 |
| 70 | Ga0070666_10064662 | 3300005335 | Bacteria | 2481 |
| 71 | Ga0070680_100000789 | 3300005336 | Bacteria | 22263 |
| 72 | Ga0070680_100019987 | 3300005336 | Bacteria | 5309 |
| 73 | Ga0070680_100020435 | 3300005336 | Bacteria | 5256 |
| 74 | Ga0070682_100025351 | 3300005337 | Bacteria | 3537 |
| 75 | Ga0068868_100008066 | 3300005338 | Bacteria | 7532 |
| 76 | Ga0068868_100009673 | 3300005338 | Bacteria | 6958 |
| 77 | Ga0068868_100035445 | 3300005338 | Bacteria | 3857 |
| 78 | Ga0068868_100058041 | 3300005338 | Bacteria | 3059 |
| 79 | Ga0068868_100083366 | 3300005338 | Bacteria | 2566 |
| 80 | Ga0068868_100176045 | 3300005338 | Bacteria | 1773 |
| 81 | Ga0070660_100002643 | 3300005339 | Bacteria | 12320 |
| 82 | Ga0070660_100012054 | 3300005339 | Bacteria | 6169 |
| 83 | Ga0070660_100110595 | 3300005339 | Bacteria | 2185 |
| 84 | Ga0070689_100002767 | 3300005340 | Bacteria | 11507 |
| 85 | Ga0070691_10001775 | 3300005341 | Bacteria | 9374 |
| 86 | Ga0070661_100001036 | 3300005344 | Bacteria | 19652 |
| 87 | Ga0070661_100076907 | 3300005344 | Bacteria | 2460 |
| 88 | Ga0070661_100086187 | 3300005344 | Bacteria | 2322 |
| 89 | Ga0070692_10010384 | 3300005345 | Bacteria | 4234 |
| 90 | Ga0070668_100005979 | 3300005347 | Bacteria | 9030 |
| 91 | Ga0070668_100010299 | 3300005347 | Bacteria | 6942 |
| 92 | Ga0070668_100046663 | 3300005347 | Bacteria | 3328 |
| 93 | Ga0070668_100074690 | 3300005347 | Bacteria | 2645 |
| 94 | Ga0070668_100160684 | 3300005347 | Bacteria | 1823 |
| 95 | Ga0070669_100000706 | 3300005353 | Bacteria | 24466 |
| 96 | Ga0070669_100002383 | 3300005353 | Bacteria | 13599 |
| 97 | Ga0070669_100058804 | 3300005353 | Bacteria | 2822 |
| 98 | Ga0070669_100100200 | 3300005353 | Bacteria | 2184 |
| 99 | Ga0070675_100005756 | 3300005354 | Bacteria | 9481 |
| 100 | Ga0070675_100006313 | 3300005354 | Bacteria | 9098 |
| 101 | Ga0070675_100012135 | 3300005354 | Bacteria | 6756 |
| 102 | Ga0070675_100014622 | 3300005354 | Bacteria | 6189 |
| 103 | Ga0070675_100030287 | 3300005354 | Bacteria | 4368 |
| 104 | Ga0070675_100361590 | 3300005354 | Bacteria | 1289 |
| 105 | Ga0070671_100002238 | 3300005355 | Bacteria | 14934 |
| 106 | Ga0070671_100011061 | 3300005355 | Bacteria | 7245 |
| 107 | Ga0070671_100055325 | 3300005355 | Bacteria | 3301 |
| 108 | Ga0070671_100056246 | 3300005355 | Bacteria | 3273 |
| 109 | Ga0070671_100140698 | 3300005355 | Bacteria | 2036 |
| 110 | Ga0070671_100152595 | 3300005355 | Bacteria | 1951 |
| 111 | Ga0070674_100012268 | 3300005356 | Bacteria | 5259 |
| 112 | Ga0070674_100110275 | 3300005356 | Bacteria | 2019 |
| 113 | Ga0070673_100001120 | 3300005364 | Bacteria | 15374 |
| 114 | Ga0070673_100002595 | 3300005364 | Bacteria | 11039 |
| 115 | Ga0070673_100002922 | 3300005364 | Bacteria | 10528 |
| 116 | Ga0070673_100007394 | 3300005364 | Bacteria | 7239 |
| 117 | Ga0070673_100008204 | 3300005364 | Bacteria | 6931 |
| 118 | Ga0070673_100028980 | 3300005364 | Bacteria | 4124 |
| 119 | Ga0070673_100042964 | 3300005364 | Bacteria | 3489 |
| 120 | Ga0070688_100022547 | 3300005365 | Bacteria | 3693 |
| 121 | Ga0070659_100000182 | 3300005366 | Bacteria | 48054 |
| 122 | Ga0070659_100193834 | 3300005366 | Bacteria | 1671 |
| 123 | Ga0070659_100264107 | 3300005366 | Bacteria | 1429 |
| 124 | Ga0070667_100004260 | 3300005367 | Bacteria | 12083 |
| 125 | Ga0070667_100005889 | 3300005367 | Bacteria | 10212 |
| 126 | Ga0070667_100073642 | 3300005367 | Bacteria | 2912 |
| 127 | Ga0070667_100076324 | 3300005367 | Bacteria | 2861 |
| 128 | Ga0070667_100105822 | 3300005367 | Bacteria | 2435 |
| 129 | Ga0070667_100180403 | 3300005367 | Bacteria | 1867 |
| 130 | Ga0070667_100184200 | 3300005367 | Bacteria | 1848 |
| 131 | Ga0070667_100200102 | 3300005367 | Bacteria | 1772 |
| 132 | Ga0070667_100208869 | 3300005367 | Bacteria | 1735 |
| 133 | Ga0070709_10030069 | 3300005434 | Bacteria | 3256 |
| 134 | Ga0070709_10125521 | 3300005434 | Bacteria | 1745 |
| 135 | Ga0070714_100015456 | 3300005435 | Bacteria | 6142 |
| 136 | Ga0070714_100053815 | 3300005435 | Bacteria | 3437 |
| 137 | Ga0070713_100000097 | 3300005436 | Bacteria | 55735 |
| 138 | Ga0070713_100018700 | 3300005436 | Bacteria | 5269 |
| 139 | Ga0070713_100357050 | 3300005436 | Bacteria | 1357 |
| 140 | Ga0070710_10003116 | 3300005437 | Bacteria | 7854 |
| 141 | Ga0070710_10016099 | 3300005437 | Bacteria | 3799 |
| 142 | Ga0070701_10027118 | 3300005438 | Bacteria | 2802 |
| 143 | Ga0070711_100004189 | 3300005439 | Bacteria | 8475 |
| 144 | Ga0070711_100026980 | 3300005439 | Bacteria | 3767 |
| 145 | Ga0070711_100040688 | 3300005439 | Bacteria | 3136 |
| 146 | Ga0070705_100001008 | 3300005440 | Bacteria | 15668 |
| 147 | Ga0070705_100002250 | 3300005440 | Bacteria | 9775 |
| 148 | Ga0070700_100000507 | 3300005441 | Bacteria | 19399 |
| 149 | Ga0070700_100009539 | 3300005441 | Bacteria | 5336 |
| 150 | Ga0070700_100139578 | 3300005441 | Bacteria | 1645 |
| 151 | Ga0070694_100001273 | 3300005444 | Bacteria | 14642 |
| 152 | Ga0070694_100023987 | 3300005444 | Bacteria | 3932 |
| 153 | Ga0070694_100036132 | 3300005444 | Bacteria | 3271 |
| 154 | Ga0070708_100036981 | 3300005445 | Bacteria | 4257 |
| 155 | Ga0070708_100047590 | 3300005445 | Bacteria | 3789 |
| 156 | Ga0070663_100007054 | 3300005455 | Bacteria | 6812 |
| 157 | Ga0070663_100012111 | 3300005455 | Bacteria | 5444 |
| 158 | Ga0070663_100028572 | 3300005455 | Bacteria | 3798 |
| 159 | Ga0070663_100041202 | 3300005455 | Bacteria | 3238 |
| 160 | Ga0070663_100048993 | 3300005455 | Bacteria | 2998 |
| 161 | Ga0070663_100110399 | 3300005455 | Bacteria | 2065 |
| 162 | Ga0070678_100001572 | 3300005456 | Bacteria | 12234 |
| 163 | Ga0070678_100062917 | 3300005456 | Bacteria | 2743 |
| 164 | Ga0070678_100075042 | 3300005456 | Bacteria | 2543 |
| 165 | Ga0070678_100103116 | 3300005456 | Bacteria | 2215 |
| 166 | Ga0070662_100000120 | 3300005457 | Bacteria | 43782 |
| 167 | Ga0070662_100025661 | 3300005457 | Bacteria | 4072 |
| 168 | Ga0070662_100045286 | 3300005457 | Bacteria | 3155 |
| 169 | Ga0070662_100173022 | 3300005457 | Bacteria | 1697 |
| 170 | Ga0070681_10000235 | 3300005458 | Bacteria | 43570 |
| 171 | Ga0070681_10052911 | 3300005458 | Bacteria | 4048 |
| 172 | Ga0070681_10098937 | 3300005458 | Bacteria | 2863 |
| 173 | Ga0070681_10163907 | 3300005458 | Bacteria | 2146 |
| 174 | Ga0070681_10189790 | 3300005458 | Bacteria | 1975 |
| 175 | Ga0068867_100000699 | 3300005459 | Bacteria | 22369 |
| 176 | Ga0068867_100001479 | 3300005459 | Bacteria | 16259 |
| 177 | Ga0068867_100022330 | 3300005459 | Bacteria | 4524 |
| 178 | Ga0068867_100031990 | 3300005459 | Bacteria | 3801 |
| 179 | Ga0068867_100042529 | 3300005459 | Bacteria | 3324 |
| 180 | Ga0070685_10068444 | 3300005466 | Bacteria | 2097 |
| 181 | Ga0070706_100005279 | 3300005467 | Bacteria | 12318 |
| 182 | Ga0070706_100026812 | 3300005467 | Bacteria | 5301 |
| 183 | Ga0070706_100065693 | 3300005467 | Bacteria | 3355 |
| 184 | Ga0070706_100160570 | 3300005467 | Bacteria | 2098 |
| 185 | Ga0070707_100014058 | 3300005468 | Bacteria | 7500 |
| 186 | Ga0070707_100172193 | 3300005468 | Bacteria | 2110 |
| 187 | Ga0070707_100231857 | 3300005468 | Bacteria | 1797 |
| 188 | Ga0070698_100000346 | 3300005471 | Bacteria | 47866 |
| 189 | Ga0070698_100030448 | 3300005471 | Bacteria | 5594 |
| 190 | Ga0070699_100008587 | 3300005518 | Bacteria | 8852 |
| 191 | Ga0070699_100097488 | 3300005518 | Bacteria | 2575 |
| 192 | Ga0070679_100008198 | 3300005530 | Bacteria | 9822 |
| 193 | Ga0070679_100067454 | 3300005530 | Bacteria | 3568 |
| 194 | Ga0070679_100138837 | 3300005530 | Bacteria | 2411 |
| 195 | Ga0070679_100243192 | 3300005530 | Bacteria | 1757 |
| 196 | Ga0070684_100012356 | 3300005535 | Bacteria | 6840 |
| 197 | Ga0070684_100053346 | 3300005535 | Bacteria | 3519 |
| 198 | Ga0070684_100100932 | 3300005535 | Bacteria | 2578 |
| 199 | Ga0070697_100038951 | 3300005536 | Bacteria | 3841 |
| 200 | Ga0070697_100080330 | 3300005536 | Bacteria | 2686 |
| 201 | Ga0068853_100001080 | 3300005539 | Bacteria | 19275 |
| 202 | Ga0068853_100012124 | 3300005539 | Bacteria | 7011 |
| 203 | Ga0068853_100065882 | 3300005539 | Bacteria | 3144 |
| 204 | Ga0068853_100148707 | 3300005539 | Bacteria | 2107 |
| 205 | Ga0068853_100249045 | 3300005539 | Bacteria | 1630 |
| 206 | Ga0068853_100289906 | 3300005539 | Bacteria | 1511 |
| 207 | Ga0070672_100008837 | 3300005543 | Bacteria | 6918 |
| 208 | Ga0070672_100011179 | 3300005543 | Bacteria | 6254 |
| 209 | Ga0070672_100012802 | 3300005543 | Bacteria | 5906 |
| 210 | Ga0070672_100033629 | 3300005543 | Bacteria | 3884 |
| 211 | Ga0070672_100035679 | 3300005543 | Bacteria | 3781 |
| 212 | Ga0070672_100044056 | 3300005543 | Bacteria | 3445 |
| 213 | Ga0070672_100124753 | 3300005543 | Bacteria | 2111 |
| 214 | Ga0070672_100136229 | 3300005543 | Bacteria | 2022 |
| 215 | Ga0070686_100000451 | 3300005544 | Bacteria | 25364 |
| 216 | Ga0070695_100000113 | 3300005545 | Bacteria | 35966 |
| 217 | Ga0070695_100004445 | 3300005545 | Bacteria | 8235 |
| 218 | Ga0070695_100059389 | 3300005545 | Bacteria | 2476 |
| 219 | Ga0070695_100100914 | 3300005545 | Bacteria | 1943 |
| 220 | Ga0070696_100001794 | 3300005546 | Bacteria | 14067 |
| 221 | Ga0070696_100029810 | 3300005546 | Bacteria | 3732 |
| 222 | Ga0070693_100006920 | 3300005547 | Bacteria | 5514 |
| 223 | Ga0070665_100002511 | 3300005548 | Bacteria | 20168 |
| 224 | Ga0070665_100005013 | 3300005548 | Bacteria | 13734 |
| 225 | Ga0070665_100020157 | 3300005548 | Bacteria | 6694 |
| 226 | Ga0070665_100024935 | 3300005548 | Bacteria | 6028 |
| 227 | Ga0070665_100054839 | 3300005548 | Bacteria | 3997 |
| 228 | Ga0070665_100083512 | 3300005548 | Bacteria | 3199 |
| 229 | Ga0070665_100090011 | 3300005548 | Bacteria | 3074 |
| 230 | Ga0070665_100259817 | 3300005548 | Bacteria | 1738 |
| 231 | Ga0070704_100001744 | 3300005549 | Bacteria | 11877 |
| 232 | Ga0070704_100031607 | 3300005549 | Bacteria | 3563 |
| 233 | Ga0070704_100104705 | 3300005549 | Bacteria | 2140 |
| 234 | Ga0068855_100003059 | 3300005563 | Bacteria | 20475 |
| 235 | Ga0068855_100004880 | 3300005563 | Bacteria | 16367 |
| 236 | Ga0068855_100044092 | 3300005563 | Bacteria | 5280 |
| 237 | Ga0068855_100116191 | 3300005563 | Bacteria | 3067 |
| 238 | Ga0068855_100133255 | 3300005563 | Bacteria | 2836 |
| 239 | Ga0070664_100000226 | 3300005564 | Bacteria | 40249 |
| 240 | Ga0070664_100006946 | 3300005564 | Bacteria | 9122 |
| 241 | Ga0070664_100008588 | 3300005564 | Bacteria | 8264 |
| 242 | Ga0070664_100068450 | 3300005564 | Bacteria | 3035 |
| 243 | Ga0070664_100082392 | 3300005564 | Bacteria | 2774 |
| 244 | Ga0070664_100093702 | 3300005564 | Bacteria | 2603 |
| 245 | Ga0070664_100205357 | 3300005564 | Bacteria | 1759 |
| 246 | Ga0068857_100009219 | 3300005577 | Bacteria | 8561 |
| 247 | Ga0068857_100012359 | 3300005577 | Bacteria | 7430 |
| 248 | Ga0068857_100017621 | 3300005577 | Bacteria | 6262 |
| 249 | Ga0068854_100004976 | 3300005578 | Bacteria | 8377 |
| 250 | Ga0068854_100091425 | 3300005578 | Bacteria | 2265 |
| 251 | Ga0068856_100002965 | 3300005614 | Bacteria | 17396 |
| 252 | Ga0068856_100004533 | 3300005614 | Bacteria | 13815 |
| 253 | Ga0068856_100006452 | 3300005614 | Bacteria | 11507 |
| 254 | Ga0068856_100034528 | 3300005614 | Bacteria | 4954 |
| 255 | Ga0068856_100035978 | 3300005614 | Bacteria | 4855 |
| 256 | Ga0068856_100046152 | 3300005614 | Bacteria | 4292 |
| 257 | Ga0068856_100060037 | 3300005614 | Bacteria | 3757 |
| 258 | Ga0068856_100108343 | 3300005614 | Bacteria | 2774 |
| 259 | Ga0068856_100132592 | 3300005614 | Bacteria | 2496 |
| 260 | Ga0068856_100197998 | 3300005614 | Bacteria | 2023 |
| 261 | Ga0068856_100204117 | 3300005614 | Bacteria | 1991 |
| 262 | Ga0068856_100342019 | 3300005614 | Bacteria | 1514 |
| 263 | Ga0070702_100000240 | 3300005615 | Bacteria | 18563 |
| 264 | Ga0070702_100108560 | 3300005615 | Bacteria | 1716 |
| 265 | Ga0068852_100000458 | 3300005616 | Bacteria | 26975 |
| 266 | Ga0068852_100002866 | 3300005616 | Bacteria | 11957 |
| 267 | Ga0068852_100003345 | 3300005616 | Bacteria | 11194 |
| 268 | Ga0068852_100044052 | 3300005616 | Bacteria | 3787 |
| 269 | Ga0068852_100050792 | 3300005616 | Bacteria | 3555 |
| 270 | Ga0068852_100361619 | 3300005616 | Bacteria | 1420 |
| 271 | Ga0068859_100001046 | 3300005617 | Bacteria | 28371 |
| 272 | Ga0068859_100004628 | 3300005617 | Bacteria | 14018 |
| 273 | Ga0068859_100005100 | 3300005617 | Bacteria | 13340 |
| 274 | Ga0068859_100011777 | 3300005617 | Bacteria | 8788 |
| 275 | Ga0068859_100131360 | 3300005617 | Bacteria | 2576 |
| 276 | Ga0068859_100371126 | 3300005617 | Bacteria | 1526 |
| 277 | Ga0068859_100432532 | 3300005617 | Bacteria | 1412 |
| 278 | Ga0068864_100001845 | 3300005618 | Bacteria | 17426 |
| 279 | Ga0068864_100006755 | 3300005618 | Bacteria | 9398 |
| 280 | Ga0068864_100033625 | 3300005618 | Bacteria | 4360 |
| 281 | Ga0068864_100060757 | 3300005618 | Bacteria | 3272 |
| 282 | Ga0068864_100100205 | 3300005618 | Bacteria | 2567 |
| 283 | Ga0068866_10000744 | 3300005718 | Bacteria | 14729 |
| 284 | Ga0068866_10022984 | 3300005718 | Bacteria | 2894 |
| 285 | Ga0068861_100000550 | 3300005719 | Bacteria | 22119 |
| 286 | Ga0068861_100009710 | 3300005719 | Bacteria | 6653 |
| 287 | Ga0068861_100011045 | 3300005719 | Bacteria | 6275 |
| 288 | Ga0068861_100012089 | 3300005719 | Bacteria | 6016 |
| 289 | Ga0068861_100016696 | 3300005719 | Bacteria | 5200 |
| 290 | Ga0068861_100197378 | 3300005719 | Bacteria | 1687 |
| 291 | Ga0068851_10004220 | 3300005834 | Bacteria | 6466 |
| 292 | Ga0068870_10014703 | 3300005840 | Bacteria | 3702 |
| 293 | Ga0068863_100003310 | 3300005841 | Bacteria | 15908 |
| 294 | Ga0068863_100004932 | 3300005841 | Bacteria | 13155 |
| 295 | Ga0068863_100024146 | 3300005841 | Bacteria | 5800 |
| 296 | Ga0068863_100026315 | 3300005841 | Bacteria | 5551 |
| 297 | Ga0068863_100056419 | 3300005841 | Bacteria | 3719 |
| 298 | Ga0068863_100162307 | 3300005841 | Bacteria | 2141 |
| 299 | Ga0068858_100001886 | 3300005842 | Bacteria | 21412 |
| 300 | Ga0068858_100009824 | 3300005842 | Bacteria | 9102 |
| 301 | Ga0068858_100054622 | 3300005842 | Bacteria | 3693 |
| 302 | Ga0068858_100059335 | 3300005842 | Bacteria | 3536 |
| 303 | Ga0068858_100115612 | 3300005842 | Bacteria | 2507 |
| 304 | Ga0068860_100000995 | 3300005843 | Bacteria | 31354 |
| 305 | Ga0068860_100002455 | 3300005843 | Bacteria | 19466 |
| 306 | Ga0068860_100004676 | 3300005843 | Bacteria | 13977 |
| 307 | Ga0068860_100006826 | 3300005843 | Bacteria | 11441 |
| 308 | Ga0068860_100011997 | 3300005843 | Bacteria | 8534 |
| 309 | Ga0068860_100017959 | 3300005843 | Bacteria | 6890 |
| 310 | Ga0068860_100027734 | 3300005843 | Bacteria | 5454 |
| 311 | Ga0068860_100043605 | 3300005843 | Bacteria | 4279 |
| 312 | Ga0068862_100001897 | 3300005844 | Bacteria | 18976 |
| 313 | Ga0068862_100007683 | 3300005844 | Bacteria | 8923 |
| 314 | Ga0068862_100011352 | 3300005844 | Bacteria | 7356 |
| 315 | Ga0068862_100018082 | 3300005844 | Bacteria | 5871 |
| 316 | Ga0068862_100023649 | 3300005844 | Bacteria | 5150 |
| 317 | Ga0068862_100048060 | 3300005844 | Bacteria | 3642 |
| 318 | Ga0068862_100060608 | 3300005844 | Bacteria | 3251 |
| 319 | Ga0068862_100062934 | 3300005844 | Bacteria | 3192 |
| 320 | Ga0068862_100070581 | 3300005844 | Bacteria | 3015 |
| 321 | Ga0081455_10002128 | 3300005937 | Bacteria | 23616 |
| 322 | Ga0081455_10005931 | 3300005937 | Bacteria | 13260 |
| 323 | Ga0081455_10007164 | 3300005937 | Bacteria | 11793 |
| 324 | Ga0081455_10008105 | 3300005937 | Bacteria | 10967 |
| 325 | Ga0081455_10056129 | 3300005937 | Bacteria | 3346 |
| 326 | Ga0081455_10067942 | 3300005937 | Bacteria | 2968 |
| 327 | Ga0081538_10062089 | 3300005981 | Bacteria | 2133 |
| 328 | Ga0081540_1008063 | 3300005983 | Bacteria | 7404 |
| 329 | Ga0081540_1010718 | 3300005983 | Bacteria | 6177 |
| 330 | Ga0081540_1011457 | 3300005983 | Bacteria | 5923 |
| 331 | Ga0081540_1027323 | 3300005983 | Bacteria | 3236 |
| 332 | Ga0081540_1081211 | 3300005983 | Bacteria | 1459 |
| 333 | Ga0081539_10000199 | 3300005985 | Bacteria | 139305 |
| 334 | Ga0081539_10008807 | 3300005985 | Bacteria | 8643 |
| 335 | Ga0081539_10035474 | 3300005985 | Bacteria | 2997 |
| 336 | Ga0070717_10226606 | 3300006028 | Bacteria | 1644 |
| 337 | Ga0075365_10081210 | 3300006038 | Bacteria | 2196 |
| 338 | Ga0075365_10120135 | 3300006038 | Bacteria | 1812 |
| 339 | Ga0075368_10049277 | 3300006042 | Bacteria | 1671 |
| 340 | Ga0075363_100033317 | 3300006048 | Bacteria | 2681 |
| 341 | Ga0075363_100038226 | 3300006048 | Bacteria | 2523 |
| 342 | Ga0075364_10000449 | 3300006051 | Bacteria | 20713 |
| 343 | Ga0075364_10001306 | 3300006051 | Bacteria | 13411 |
| 344 | Ga0075364_10041388 | 3300006051 | Bacteria | 2992 |
| 345 | Ga0075364_10041828 | 3300006051 | Bacteria | 2976 |
| 346 | Ga0075432_10004252 | 3300006058 | Bacteria | 4876 |
| 347 | Ga0070715_10007524 | 3300006163 | Bacteria | 3753 |
| 348 | Ga0070716_100025770 | 3300006173 | Bacteria | 3142 |
| 349 | Ga0070712_100005468 | 3300006175 | Bacteria | 7868 |
| 350 | Ga0070712_100025225 | 3300006175 | Bacteria | 3949 |
| 351 | Ga0075362_10007655 | 3300006177 | Bacteria | 4103 |
| 352 | Ga0075362_10017916 | 3300006177 | Bacteria | 2924 |
| 353 | Ga0075362_10036312 | 3300006177 | Bacteria | 2155 |
| 354 | Ga0075367_10022998 | 3300006178 | Bacteria | 3502 |
| 355 | Ga0075367_10058895 | 3300006178 | Bacteria | 2286 |
| 356 | Ga0075367_10091962 | 3300006178 | Bacteria | 1846 |
| 357 | Ga0075369_10039228 | 3300006186 | Bacteria | 2022 |
| 358 | Ga0075366_10003108 | 3300006195 | Bacteria | 8682 |
| 359 | Ga0075366_10020960 | 3300006195 | Bacteria | 3798 |
| 360 | Ga0075366_10034499 | 3300006195 | Bacteria | 2980 |
| 361 | Ga0075366_10048359 | 3300006195 | Bacteria | 2522 |
| 362 | Ga0075366_10090760 | 3300006195 | Bacteria | 1830 |
| 363 | Ga0075366_10101532 | 3300006195 | Bacteria | 1726 |
| 364 | Ga0097621_100181066 | 3300006237 | Bacteria | 1821 |
| 365 | Ga0097621_100235597 | 3300006237 | Bacteria | 1599 |
| 366 | Ga0097621_100362827 | 3300006237 | Bacteria | 1291 |
| 367 | Ga0075370_10016491 | 3300006353 | Bacteria | 3975 |
| 368 | Ga0075370_10016870 | 3300006353 | Bacteria | 3937 |
| 369 | Ga0075370_10016996 | 3300006353 | Bacteria | 3923 |
| 370 | Ga0075370_10039884 | 3300006353 | Bacteria | 2647 |
| 371 | Ga0075370_10091130 | 3300006353 | Bacteria | 1758 |
| 372 | Ga0075370_10107767 | 3300006353 | Bacteria | 1616 |
| 373 | Ga0068871_100001073 | 3300006358 | Bacteria | 18331 |
| 374 | Ga0068871_100026391 | 3300006358 | Bacteria | 4532 |
| 375 | Ga0068871_100051176 | 3300006358 | Bacteria | 3344 |
| 376 | Ga0068871_100101091 | 3300006358 | Bacteria | 2416 |
| 377 | Ga0068871_100119593 | 3300006358 | Bacteria | 2224 |
| 378 | Ga0068871_100126027 | 3300006358 | Bacteria | 2167 |
| 379 | Ga0068871_100255065 | 3300006358 | Bacteria | 1529 |
| 380 | Ga0075428_100001002 | 3300006844 | Bacteria | 29936 |
| 381 | Ga0075428_100010339 | 3300006844 | Bacteria | 10356 |
| 382 | Ga0075428_100018888 | 3300006844 | Bacteria | 7624 |
| 383 | Ga0075428_100195292 | 3300006844 | Bacteria | 2189 |
| 384 | Ga0075428_100410183 | 3300006844 | Bacteria | 1452 |
| 385 | Ga0075430_100008058 | 3300006846 | Bacteria | 8906 |
| 386 | Ga0075431_100000071 | 3300006847 | Bacteria | 59366 |
| 387 | Ga0075431_100007105 | 3300006847 | Bacteria | 11124 |
| 388 | Ga0075431_100046776 | 3300006847 | Bacteria | 4463 |
| 389 | Ga0075431_100245954 | 3300006847 | Bacteria | 1818 |
| 390 | Ga0075433_10100040 | 3300006852 | Bacteria | 2567 |
| 391 | Ga0075434_100000004 | 3300006871 | Bacteria | 112839 |
| 392 | Ga0075434_100001086 | 3300006871 | Bacteria | 22255 |
| 393 | Ga0075434_100003417 | 3300006871 | Bacteria | 14208 |
| 394 | Ga0075434_100081205 | 3300006871 | Bacteria | 3239 |
| 395 | Ga0075434_100081590 | 3300006871 | Bacteria | 3231 |
| 396 | Ga0075434_100123733 | 3300006871 | Bacteria | 2603 |
| 397 | Ga0075429_100000051 | 3300006880 | Bacteria | 55896 |
| 398 | Ga0075429_100009199 | 3300006880 | Bacteria | 8578 |
| 399 | Ga0075429_100063395 | 3300006880 | Bacteria | 3220 |
| 400 | Ga0068865_100001146 | 3300006881 | Bacteria | 15365 |
| 401 | Ga0068865_100013695 | 3300006881 | Bacteria | 5135 |
| 402 | Ga0068865_100043597 | 3300006881 | Bacteria | 3067 |
| 403 | Ga0068865_100077454 | 3300006881 | Bacteria | 2376 |
| 404 | Ga0068865_100197862 | 3300006881 | Bacteria | 1558 |
| 405 | Ga0075436_100000331 | 3300006914 | Bacteria | 30168 |
| 406 | Ga0075436_100031681 | 3300006914 | Bacteria | 3642 |
| 407 | Ga0097620_100001046 | 3300006931 | Bacteria | 28371 |
| 408 | Ga0097620_100004627 | 3300006931 | Bacteria | 14018 |
| 409 | Ga0097620_100005100 | 3300006931 | Bacteria | 13340 |
| 410 | Ga0097620_100011776 | 3300006931 | Bacteria | 8788 |
| 411 | Ga0097620_100131360 | 3300006931 | Bacteria | 2576 |
| 412 | Ga0097620_100371106 | 3300006931 | Bacteria | 1526 |
| 413 | Ga0097620_100432534 | 3300006931 | Bacteria | 1412 |
| 414 | Ga0099825_1027213 | 3300006941 | Bacteria | 2935 |
| 415 | Ga0099824_1014858 | 3300006942 | Bacteria | 7583 |
| 416 | Ga0099822_1003531 | 3300006943 | Bacteria | 20044 |
| 417 | Ga0099826_10017935 | 3300006948 | Bacteria | 5347 |
| 418 | Ga0075435_100000313 | 3300007076 | Bacteria | 29845 |
| 419 | Ga0075435_100018126 | 3300007076 | Bacteria | 5343 |
| 420 | Ga0075435_100028667 | 3300007076 | Bacteria | 4367 |
| 421 | Ga0075435_100102689 | 3300007076 | Bacteria | 2370 |
| 422 | Ga0075435_100118661 | 3300007076 | Bacteria | 2205 |
| 423 | Ga0075435_100122701 | 3300007076 | Bacteria | 2169 |
| 424 | Ga0075435_100239513 | 3300007076 | Bacteria | 1543 |
| 425 | Ga0099794_10023907 | 3300007265 | Bacteria | 2800 |
| 426 | Ga0105251_10025368 | 3300009011 | Bacteria | 3033 |
| 427 | Ga0105244_10004646 | 3300009036 | Bacteria | 9378 |
| 428 | Ga0105240_10000250 | 3300009093 | Bacteria | 107111 |
| 429 | Ga0105240_10005077 | 3300009093 | Bacteria | 19731 |
| 430 | Ga0105240_10005554 | 3300009093 | Bacteria | 18768 |
| 431 | Ga0105240_10035358 | 3300009093 | Bacteria | 6440 |
| 432 | Ga0105240_10167477 | 3300009093 | Bacteria | 2605 |
| 433 | Ga0105240_10229755 | 3300009093 | Bacteria | 2157 |
| 434 | Ga0105240_10318126 | 3300009093 | Bacteria | 1775 |
| 435 | Ga0111539_10003132 | 3300009094 | Bacteria | 21897 |
| 436 | Ga0111539_10010804 | 3300009094 | Bacteria | 11495 |
| 437 | Ga0111539_10047411 | 3300009094 | Bacteria | 5134 |
| 438 | Ga0111539_10052402 | 3300009094 | Bacteria | 4857 |
| 439 | Ga0111539_10076125 | 3300009094 | Bacteria | 3952 |
| 440 | Ga0111539_10113136 | 3300009094 | Bacteria | 3184 |
| 441 | Ga0105245_10014889 | 3300009098 | Bacteria | 6774 |
| 442 | Ga0105245_10054950 | 3300009098 | Bacteria | 3576 |
| 443 | Ga0105247_10010424 | 3300009101 | Bacteria | 5618 |
| 444 | Ga0105247_10027421 | 3300009101 | Bacteria | 3444 |
| 445 | Ga0105247_10130989 | 3300009101 | Bacteria | 1635 |
| 446 | Ga0114129_10000009 | 3300009147 | Bacteria | 149356 |
| 447 | Ga0114129_10000337 | 3300009147 | Bacteria | 54884 |
| 448 | Ga0114129_10120173 | 3300009147 | Bacteria | 3618 |
| 449 | Ga0105243_10000915 | 3300009148 | Bacteria | 27703 |
| 450 | Ga0105243_10001591 | 3300009148 | Bacteria | 19795 |
| 451 | Ga0105243_10027411 | 3300009148 | Bacteria | 4365 |
| 452 | Ga0105243_10137416 | 3300009148 | Bacteria | 2081 |
| 453 | Ga0105243_10186934 | 3300009148 | Bacteria | 1806 |
| 454 | Ga0105241_10002214 | 3300009174 | Bacteria | 14629 |
| 455 | Ga0105241_10011671 | 3300009174 | Bacteria | 6448 |
| 456 | Ga0105242_10000945 | 3300009176 | Bacteria | 22671 |
| 457 | Ga0105242_10095819 | 3300009176 | Bacteria | 2506 |
| 458 | Ga0105248_10004085 | 3300009177 | Bacteria | 16142 |
| 459 | Ga0105248_10014014 | 3300009177 | Bacteria | 8821 |
| 460 | Ga0105248_10036026 | 3300009177 | Bacteria | 5534 |
| 461 | Ga0105237_10000806 | 3300009545 | Bacteria | 42774 |
| 462 | Ga0105237_10037340 | 3300009545 | Bacteria | 4912 |
| 463 | Ga0105237_10068354 | 3300009545 | Bacteria | 3546 |
| 464 | Ga0105237_10083206 | 3300009545 | Bacteria | 3192 |
| 465 | Ga0105237_10091804 | 3300009545 | Bacteria | 3026 |
| 466 | Ga0105237_10112524 | 3300009545 | Bacteria | 2714 |
| 467 | Ga0105237_10202255 | 3300009545 | Bacteria | 1986 |
| 468 | Ga0105238_10014862 | 3300009551 | Bacteria | 7875 |
| 469 | Ga0105238_10073324 | 3300009551 | Bacteria | 3418 |
| 470 | Ga0105238_10077770 | 3300009551 | Bacteria | 3309 |
| 471 | Ga0105249_10000975 | 3300009553 | Bacteria | 25356 |
| 472 | Ga0105249_10006665 | 3300009553 | Bacteria | 10054 |
| 473 | Ga0105249_10274324 | 3300009553 | Bacteria | 1681 |
| 474 | Ga0105249_10313131 | 3300009553 | Bacteria | 1579 |
| 475 | Ga0105249_10389405 | 3300009553 | Bacteria | 1422 |
| 476 | Ga0105239_10000292 | 3300010375 | Bacteria | 73809 |
| 477 | Ga0105239_10055870 | 3300010375 | Bacteria | 4331 |
| 478 | Ga0105239_10065549 | 3300010375 | Bacteria | 3989 |
| 479 | Ga0105239_10078771 | 3300010375 | Bacteria | 3626 |
| 480 | Ga0105239_10099166 | 3300010375 | Bacteria | 3220 |
| 481 | Ga0105239_10354637 | 3300010375 | Bacteria | 1656 |
| 482 | Ga0105239_10419615 | 3300010375 | Bacteria | 1516 |
| 483 | Ga0105246_10056261 | 3300011119 | Bacteria | 2718 |
| 484 | Ga0105246_10093617 | 3300011119 | Bacteria | 2171 |
| 485 | Ga0105246_10094888 | 3300011119 | Bacteria | 2159 |
| 486 | Ga0105246_10181185 | 3300011119 | Bacteria | 1622 |
| 487 | Ga0157373_10008298 | 3300013100 | Bacteria | 7717 |
| 488 | Ga0157373_10009650 | 3300013100 | Bacteria | 7123 |
| 489 | Ga0157373_10035104 | 3300013100 | Bacteria | 3601 |
| 490 | Ga0157371_10000769 | 3300013102 | Bacteria | 37033 |
| 491 | Ga0157370_10008286 | 3300013104 | Bacteria | 11216 |
| 492 | Ga0157370_10008739 | 3300013104 | Bacteria | 10892 |
| 493 | Ga0157370_10010979 | 3300013104 | Bacteria | 9500 |
| 494 | Ga0157370_10012141 | 3300013104 | Bacteria | 8959 |
| 495 | Ga0157370_10029684 | 3300013104 | Bacteria | 5363 |
| 496 | Ga0157370_10056276 | 3300013104 | Bacteria | 3743 |
| 497 | Ga0157370_10078446 | 3300013104 | Bacteria | 3110 |
| 498 | Ga0157370_10176423 | 3300013104 | Bacteria | 1986 |
| 499 | Ga0157369_10008103 | 3300013105 | Bacteria | 12040 |
| 500 | Ga0157369_10044792 | 3300013105 | Bacteria | 4814 |
| 501 | Ga0157369_10077758 | 3300013105 | Bacteria | 3556 |
| 502 | Ga0157369_10156297 | 3300013105 | Bacteria | 2409 |
| 503 | Ga0157369_10298009 | 3300013105 | Bacteria | 1678 |
| 504 | Ga0157374_10001486 | 3300013296 | Bacteria | 19795 |
| 505 | Ga0157374_10006780 | 3300013296 | Bacteria | 9737 |
| 506 | Ga0157374_10046727 | 3300013296 | Bacteria | 4011 |
| 507 | Ga0157374_10080670 | 3300013296 | Bacteria | 3086 |
| 508 | Ga0157374_10356313 | 3300013296 | Bacteria | 1454 |
| 509 | Ga0157378_10000844 | 3300013297 | Bacteria | 28388 |
| 510 | Ga0157378_10079380 | 3300013297 | Bacteria | 2963 |
| 511 | Ga0157378_10092014 | 3300013297 | Bacteria | 2758 |
| 512 | Ga0157378_10192977 | 3300013297 | Bacteria | 1922 |
| 513 | Ga0157378_10197493 | 3300013297 | Bacteria | 1901 |
| 514 | Ga0163162_10005722 | 3300013306 | Bacteria | 12018 |
| 515 | Ga0163162_10018632 | 3300013306 | Bacteria | 6802 |
| 516 | Ga0163162_10074028 | 3300013306 | Bacteria | 3464 |
| 517 | Ga0163162_10079077 | 3300013306 | Bacteria | 3355 |
| 518 | Ga0163162_10140144 | 3300013306 | Bacteria | 2531 |
| 519 | Ga0163162_10177704 | 3300013306 | Bacteria | 2254 |
| 520 | Ga0163162_10251441 | 3300013306 | Bacteria | 1899 |
| 521 | Ga0157372_10004681 | 3300013307 | Bacteria | 14529 |
| 522 | Ga0157372_10006187 | 3300013307 | Bacteria | 12722 |
| 523 | Ga0157372_10007871 | 3300013307 | Bacteria | 11328 |
| 524 | Ga0157372_10024035 | 3300013307 | Bacteria | 6612 |
| 525 | Ga0157372_10229700 | 3300013307 | Bacteria | 2151 |
| 526 | Ga0157372_10360707 | 3300013307 | Bacteria | 1693 |
| 527 | Ga0157375_10002482 | 3300013308 | Bacteria | 15973 |
| 528 | Ga0157375_10021511 | 3300013308 | Bacteria | 5916 |
| 529 | Ga0157375_10030198 | 3300013308 | Bacteria | 5108 |
| 530 | Ga0157375_10031394 | 3300013308 | Bacteria | 5022 |
| 531 | Ga0157375_10055972 | 3300013308 | Bacteria | 3891 |
| 532 | Ga0157375_10073768 | 3300013308 | Bacteria | 3432 |
| 533 | Ga0157375_10096977 | 3300013308 | Bacteria | 3022 |
| 534 | Ga0157375_10373761 | 3300013308 | Bacteria | 1592 |
| 535 | Ga0163163_10003555 | 3300014325 | Bacteria | 13230 |
| 536 | Ga0163163_10007010 | 3300014325 | Bacteria | 9900 |
| 537 | Ga0163163_10016615 | 3300014325 | Bacteria | 6842 |
| 538 | Ga0163163_10028233 | 3300014325 | Bacteria | 5386 |
| 539 | Ga0163163_10056064 | 3300014325 | Bacteria | 3895 |
| 540 | Ga0163163_10103916 | 3300014325 | Bacteria | 2866 |
| 541 | Ga0163163_10200477 | 3300014325 | Bacteria | 2044 |
| 542 | Ga0157380_10002048 | 3300014326 | Bacteria | 13485 |
| 543 | Ga0157380_10032105 | 3300014326 | Bacteria | 4036 |
| 544 | Ga0157380_10032106 | 3300014326 | Bacteria | 4036 |
| 545 | Ga0157380_10075159 | 3300014326 | Bacteria | 2745 |
| 546 | Ga0157380_10093331 | 3300014326 | Bacteria | 2488 |
| 547 | Ga0157380_10113689 | 3300014326 | Bacteria | 2280 |
| 548 | Ga0182008_10021837 | 3300014497 | Bacteria | 3285 |
| 549 | Ga0182008_10032465 | 3300014497 | Bacteria | 2623 |
| 550 | Ga0182008_10049084 | 3300014497 | Bacteria | 2095 |
| 551 | Ga0157377_10057796 | 3300014745 | Bacteria | 2207 |
| 552 | Ga0157379_10000542 | 3300014968 | Bacteria | 30483 |
| 553 | Ga0157379_10003892 | 3300014968 | Bacteria | 12729 |
| 554 | Ga0157379_10045142 | 3300014968 | Bacteria | 3934 |
| 555 | Ga0157379_10131429 | 3300014968 | Bacteria | 2253 |
| 556 | Ga0157379_10151476 | 3300014968 | Bacteria | 2092 |
| 557 | Ga0157379_10306548 | 3300014968 | Bacteria | 1448 |
| 558 | Ga0157376_10010104 | 3300014969 | Bacteria | 6892 |
| 559 | Ga0157376_10060761 | 3300014969 | Bacteria | 3175 |
| 560 | Ga0157376_10065423 | 3300014969 | Bacteria | 3070 |
| 561 | Ga0182006_1003114 | 3300015261 | Bacteria | 8686 |
| 562 | Ga0183362_10004 | 3300015683 | Bacteria | 569303 |
| 563 | Ga0163161_10000198 | 3300017792 | Bacteria | 55260 |
| 564 | Ga0163161_10004824 | 3300017792 | Bacteria | 9395 |
| 565 | Ga0163161_10054872 | 3300017792 | Bacteria | 2892 |
| 566 | Ga0163161_10087527 | 3300017792 | Bacteria | 2301 |
| 567 | Ga0163161_10103861 | 3300017792 | Bacteria | 2118 |
| 568 | Ga0163161_10124173 | 3300017792 | Bacteria | 1942 |
| 569 | Ga0163161_10131830 | 3300017792 | Bacteria | 1886 |
| 570 | Ga0197907_11408047 | 3300020069 | Bacteria | 1540 |
| 571 | Ga0213874_10027747 | 3300021377 | Bacteria | 1613 |
| 572 | Ga0213876_10067981 | 3300021384 | Bacteria | 1882 |
| 573 | Ga0213871_10004080 | 3300021441 | Bacteria | 2886 |
| 574 | Ga0224712_10020465 | 3300022467 | Bacteria | 2247 |
| 575 | Ga0209435_100007 | 3300025206 | Bacteria | 516857 |
| 576 | Ga0209436_105003 | 3300025208 | Bacteria | 3152 |
| 577 | Ga0209147_100017 | 3300025229 | Bacteria | 516857 |
| 578 | Ga0209563_101866 | 3300025230 | Bacteria | 5126 |
| 579 | Ga0209437_100272 | 3300025233 | Bacteria | 77336 |
| 580 | Ga0209258_100297 | 3300025242 | Bacteria | 81353 |
| 581 | Ga0207425_1000697 | 3300025245 | Bacteria | 18206 |
| 582 | Ga0209646_1000061 | 3300025246 | Bacteria | 255495 |
| 583 | Ga0209646_1000096 | 3300025246 | Bacteria | 182388 |
| 584 | Ga0209026_1000052 | 3300025250 | Bacteria | 248897 |
| 585 | Ga0209026_1002209 | 3300025250 | Bacteria | 7522 |
| 586 | Ga0209677_102108 | 3300025253 | Bacteria | 7820 |
| 587 | Ga0209677_105443 | 3300025253 | Bacteria | 3318 |
| 588 | Ga0209148_1000500 | 3300025254 | Bacteria | 39994 |
| 589 | Ga0209759_1000174 | 3300025256 | Bacteria | 107149 |
| 590 | Ga0209759_1000537 | 3300025256 | Bacteria | 39856 |
| 591 | Ga0209129_1000168 | 3300025258 | Bacteria | 96922 |
| 592 | Ga0209129_1001716 | 3300025258 | Bacteria | 11808 |
| 593 | Ga0209233_1001496 | 3300025261 | Bacteria | 9193 |
| 594 | Ga0209233_1012236 | 3300025261 | Bacteria | 2493 |
| 595 | Ga0209565_1000078 | 3300025263 | Bacteria | 160838 |
| 596 | Ga0209565_1000350 | 3300025263 | Bacteria | 40579 |
| 597 | Ga0209565_1000992 | 3300025263 | Bacteria | 14592 |
| 598 | Ga0209455_1006056 | 3300025272 | Bacteria | 3634 |
| 599 | Ga0209455_1009658 | 3300025272 | Bacteria | 2513 |
| 600 | Ga0209673_1000516 | 3300025273 | Bacteria | 63268 |
| 601 | Ga0209673_1000627 | 3300025273 | Bacteria | 53883 |
| 602 | Ga0209673_1010584 | 3300025273 | Bacteria | 3873 |
| 603 | Ga0209130_1000440 | 3300025284 | Bacteria | 44209 |
| 604 | Ga0209130_1000798 | 3300025284 | Bacteria | 26769 |
| 605 | Ga0209130_1001805 | 3300025284 | Bacteria | 12467 |
| 606 | Ga0209130_1008121 | 3300025284 | Bacteria | 3139 |
| 607 | Ga0209675_1000355 | 3300025291 | Bacteria | 39556 |
| 608 | Ga0209675_1000916 | 3300025291 | Bacteria | 18805 |
| 609 | Ga0209675_1000925 | 3300025291 | Bacteria | 18727 |
| 610 | Ga0209675_1002231 | 3300025291 | Bacteria | 10121 |
| 611 | Ga0209675_1005267 | 3300025291 | Bacteria | 5458 |
| 612 | Ga0209676_1000312 | 3300025292 | Bacteria | 95234 |
| 613 | Ga0209676_1000403 | 3300025292 | Bacteria | 78171 |
| 614 | Ga0209676_1003118 | 3300025292 | Bacteria | 10641 |
| 615 | Ga0209676_1041466 | 3300025292 | Bacteria | 1286 |
| 616 | Ga0209025_1000242 | 3300025294 | Bacteria | 128169 |
| 617 | Ga0209025_1000378 | 3300025294 | Bacteria | 92632 |
| 618 | Ga0209025_1001004 | 3300025294 | Bacteria | 41792 |
| 619 | Ga0209025_1065104 | 3300025294 | Bacteria | 1333 |
| 620 | Ga0209564_1000157 | 3300025295 | Bacteria | 164758 |
| 621 | Ga0209564_1006742 | 3300025295 | Bacteria | 6097 |
| 622 | Ga0209758_1000042 | 3300025297 | Bacteria | 407145 |
| 623 | Ga0209758_1002409 | 3300025297 | Bacteria | 19162 |
| 624 | Ga0209758_1012843 | 3300025297 | Bacteria | 4639 |
| 625 | Ga0209050_1001555 | 3300025298 | Bacteria | 23938 |
| 626 | Ga0209050_1002543 | 3300025298 | Bacteria | 15245 |
| 627 | Ga0209256_1000724 | 3300025299 | Bacteria | 43561 |
| 628 | Ga0209256_1035123 | 3300025299 | Bacteria | 1327 |
| 629 | Ga0207426_1000055 | 3300025302 | Bacteria | 374450 |
| 630 | Ga0207426_1000238 | 3300025302 | Bacteria | 124393 |
| 631 | Ga0207426_1000428 | 3300025302 | Bacteria | 68777 |
| 632 | Ga0207426_1002351 | 3300025302 | Bacteria | 12330 |
| 633 | Ga0207426_1030684 | 3300025302 | Bacteria | 1761 |
| 634 | Ga0207426_1037474 | 3300025302 | Bacteria | 1533 |
| 635 | Ga0209051_1000286 | 3300025303 | Bacteria | 81784 |
| 636 | Ga0209051_1000376 | 3300025303 | Bacteria | 63531 |
| 637 | Ga0209051_1000655 | 3300025303 | Bacteria | 39161 |
| 638 | Ga0209051_1005994 | 3300025303 | Bacteria | 6947 |
| 639 | Ga0209051_1007305 | 3300025303 | Bacteria | 6063 |
| 640 | Ga0209257_1000215 | 3300025304 | Bacteria | 136521 |
| 641 | Ga0209257_1002370 | 3300025304 | Bacteria | 18884 |
| 642 | Ga0209257_1011096 | 3300025304 | Bacteria | 4410 |
| 643 | Ga0209257_1012170 | 3300025304 | Bacteria | 4022 |
| 644 | Ga0209257_1022478 | 3300025304 | Bacteria | 2249 |
| 645 | Ga0209257_1023675 | 3300025304 | Bacteria | 2152 |
| 646 | Ga0207697_10014602 | 3300025315 | Bacteria | 3255 |
| 647 | Ga0207697_10029265 | 3300025315 | Bacteria | 2253 |
| 648 | Ga0207656_10016183 | 3300025321 | Bacteria | 2900 |
| 649 | Ga0207655_1003433 | 3300025728 | Bacteria | 11793 |
| 650 | Ga0207713_1016034 | 3300025735 | Bacteria | 3819 |
| 651 | Ga0207682_10012567 | 3300025893 | Bacteria | 3305 |
| 652 | Ga0207692_10000845 | 3300025898 | Bacteria | 10979 |
| 653 | Ga0207692_10004717 | 3300025898 | Bacteria | 5410 |
| 654 | Ga0207642_10008441 | 3300025899 | Bacteria | 3534 |
| 655 | Ga0207642_10105054 | 3300025899 | Bacteria | 1426 |
| 656 | Ga0207688_10072893 | 3300025901 | Bacteria | 1951 |
| 657 | Ga0207680_10048692 | 3300025903 | Bacteria | 2519 |
| 658 | Ga0207680_10050541 | 3300025903 | Bacteria | 2481 |
| 659 | Ga0207647_10006516 | 3300025904 | Bacteria | 8486 |
| 660 | Ga0207647_10045018 | 3300025904 | Bacteria | 2754 |
| 661 | Ga0207685_10004501 | 3300025905 | Bacteria | 3554 |
| 662 | Ga0207699_10004348 | 3300025906 | Bacteria | 6777 |
| 663 | Ga0207699_10008314 | 3300025906 | Bacteria | 5115 |
| 664 | Ga0207645_10000187 | 3300025907 | Bacteria | 49829 |
| 665 | Ga0207645_10000236 | 3300025907 | Bacteria | 45713 |
| 666 | Ga0207645_10037265 | 3300025907 | Bacteria | 3120 |
| 667 | Ga0207645_10088550 | 3300025907 | Bacteria | 1990 |
| 668 | Ga0207645_10109515 | 3300025907 | Bacteria | 1787 |
| 669 | Ga0207643_10022515 | 3300025908 | Bacteria | 3469 |
| 670 | Ga0207643_10068297 | 3300025908 | Bacteria | 2042 |
| 671 | Ga0207654_10007014 | 3300025911 | Bacteria | 5674 |
| 672 | Ga0207654_10014569 | 3300025911 | Bacteria | 4063 |
| 673 | Ga0207654_10122401 | 3300025911 | Bacteria | 1636 |
| 674 | Ga0207707_10007114 | 3300025912 | Bacteria | 9748 |
| 675 | Ga0207707_10007388 | 3300025912 | Bacteria | 9570 |
| 676 | Ga0207707_10017925 | 3300025912 | Bacteria | 6173 |
| 677 | Ga0207707_10068237 | 3300025912 | Bacteria | 3098 |
| 678 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 679 | Ga0207695_10000615 | 3300025913 | Bacteria | 71501 |
| 680 | Ga0207695_10025000 | 3300025913 | Bacteria | 6700 |
| 681 | Ga0207695_10049084 | 3300025913 | Bacteria | 4452 |
| 682 | Ga0207695_10099403 | 3300025913 | Bacteria | 2907 |
| 683 | Ga0207695_10159680 | 3300025913 | Bacteria | 2187 |
| 684 | Ga0207695_10167863 | 3300025913 | Bacteria | 2122 |
| 685 | Ga0207695_10216393 | 3300025913 | Bacteria | 1825 |
| 686 | Ga0207695_10241549 | 3300025913 | Bacteria | 1707 |
| 687 | Ga0207671_10011165 | 3300025914 | Bacteria | 7335 |
| 688 | Ga0207671_10030267 | 3300025914 | Bacteria | 4038 |
| 689 | Ga0207671_10048900 | 3300025914 | Bacteria | 3130 |
| 690 | Ga0207671_10056947 | 3300025914 | Bacteria | 2897 |
| 691 | Ga0207693_10001388 | 3300025915 | Bacteria | 21472 |
| 692 | Ga0207693_10002380 | 3300025915 | Bacteria | 16317 |
| 693 | Ga0207693_10019236 | 3300025915 | Bacteria | 5435 |
| 694 | Ga0207693_10236822 | 3300025915 | Bacteria | 1433 |
| 695 | Ga0207663_10000515 | 3300025916 | Bacteria | 16967 |
| 696 | Ga0207663_10043229 | 3300025916 | Bacteria | 2757 |
| 697 | Ga0207663_10124966 | 3300025916 | Bacteria | 1768 |
| 698 | Ga0207660_10012876 | 3300025917 | Bacteria | 5477 |
| 699 | Ga0207660_10035751 | 3300025917 | Bacteria | 3451 |
| 700 | Ga0207660_10042551 | 3300025917 | Bacteria | 3189 |
| 701 | Ga0207660_10047995 | 3300025917 | Bacteria | 3021 |
| 702 | Ga0207660_10090458 | 3300025917 | Bacteria | 2268 |
| 703 | Ga0207662_10000233 | 3300025918 | Bacteria | 25755 |
| 704 | Ga0207657_10000102 | 3300025919 | Bacteria | 82096 |
| 705 | Ga0207657_10000250 | 3300025919 | Bacteria | 57310 |
| 706 | Ga0207657_10004866 | 3300025919 | Bacteria | 14133 |
| 707 | Ga0207657_10007662 | 3300025919 | Bacteria | 11045 |
| 708 | Ga0207657_10020898 | 3300025919 | Bacteria | 6178 |
| 709 | Ga0207657_10036021 | 3300025919 | Bacteria | 4432 |
| 710 | Ga0207657_10062444 | 3300025919 | Bacteria | 3189 |
| 711 | Ga0207657_10066317 | 3300025919 | Bacteria | 3073 |
| 712 | Ga0207649_10030080 | 3300025920 | Bacteria | 3213 |
| 713 | Ga0207652_10003521 | 3300025921 | Bacteria | 12909 |
| 714 | Ga0207652_10007056 | 3300025921 | Bacteria | 9054 |
| 715 | Ga0207652_10196633 | 3300025921 | Bacteria | 1814 |
| 716 | Ga0207646_10068594 | 3300025922 | Bacteria | 3167 |
| 717 | Ga0207646_10153213 | 3300025922 | Bacteria | 2079 |
| 718 | Ga0207646_10185421 | 3300025922 | Bacteria | 1879 |
| 719 | Ga0207646_10321466 | 3300025922 | Bacteria | 1398 |
| 720 | Ga0207681_10001251 | 3300025923 | Bacteria | 16395 |
| 721 | Ga0207681_10005840 | 3300025923 | Bacteria | 7546 |
| 722 | Ga0207681_10028920 | 3300025923 | Bacteria | 3594 |
| 723 | Ga0207681_10046404 | 3300025923 | Bacteria | 2922 |
| 724 | Ga0207681_10074720 | 3300025923 | Bacteria | 2375 |
| 725 | Ga0207681_10265589 | 3300025923 | Bacteria | 1345 |
| 726 | Ga0207694_10055785 | 3300025924 | Bacteria | 3067 |
| 727 | Ga0207694_10066581 | 3300025924 | Bacteria | 2810 |
| 728 | Ga0207694_10332411 | 3300025924 | Bacteria | 1256 |
| 729 | Ga0207650_10005839 | 3300025925 | Bacteria | 8400 |
| 730 | Ga0207650_10015099 | 3300025925 | Bacteria | 5373 |
| 731 | Ga0207650_10018209 | 3300025925 | Bacteria | 4926 |
| 732 | Ga0207650_10036293 | 3300025925 | Bacteria | 3586 |
| 733 | Ga0207659_10005194 | 3300025926 | Bacteria | 7884 |
| 734 | Ga0207659_10017441 | 3300025926 | Bacteria | 4691 |
| 735 | Ga0207659_10017845 | 3300025926 | Bacteria | 4643 |
| 736 | Ga0207659_10030124 | 3300025926 | Bacteria | 3704 |
| 737 | Ga0207659_10074910 | 3300025926 | Bacteria | 2482 |
| 738 | Ga0207687_10000552 | 3300025927 | Bacteria | 25163 |
| 739 | Ga0207687_10002722 | 3300025927 | Bacteria | 11964 |
| 740 | Ga0207687_10019251 | 3300025927 | Bacteria | 4520 |
| 741 | Ga0207687_10030964 | 3300025927 | Bacteria | 3613 |
| 742 | Ga0207687_10033203 | 3300025927 | Bacteria | 3499 |
| 743 | Ga0207687_10174019 | 3300025927 | Bacteria | 1662 |
| 744 | Ga0207700_10000062 | 3300025928 | Bacteria | 66509 |
| 745 | Ga0207700_10027270 | 3300025928 | Bacteria | 3998 |
| 746 | Ga0207700_10036858 | 3300025928 | Bacteria | 3536 |
| 747 | Ga0207700_10173653 | 3300025928 | Bacteria | 1800 |
| 748 | Ga0207664_10001592 | 3300025929 | Bacteria | 14920 |
| 749 | Ga0207664_10008636 | 3300025929 | Bacteria | 7121 |
| 750 | Ga0207664_10023886 | 3300025929 | Bacteria | 4587 |
| 751 | Ga0207664_10081537 | 3300025929 | Bacteria | 2633 |
| 752 | Ga0207644_10008758 | 3300025931 | Bacteria | 6624 |
| 753 | Ga0207644_10009820 | 3300025931 | Bacteria | 6294 |
| 754 | Ga0207644_10026050 | 3300025931 | Bacteria | 4026 |
| 755 | Ga0207644_10034755 | 3300025931 | Bacteria | 3528 |
| 756 | Ga0207644_10089922 | 3300025931 | Bacteria | 2286 |
| 757 | Ga0207644_10124426 | 3300025931 | Bacteria | 1967 |
| 758 | Ga0207690_10001799 | 3300025932 | Bacteria | 13173 |
| 759 | Ga0207690_10182296 | 3300025932 | Bacteria | 1582 |
| 760 | Ga0207690_10237399 | 3300025932 | Bacteria | 1402 |
| 761 | Ga0207706_10000095 | 3300025933 | Bacteria | 92378 |
| 762 | Ga0207706_10015953 | 3300025933 | Bacteria | 6788 |
| 763 | Ga0207706_10027452 | 3300025933 | Bacteria | 5089 |
| 764 | Ga0207706_10030841 | 3300025933 | Bacteria | 4781 |
| 765 | Ga0207706_10118637 | 3300025933 | Bacteria | 2326 |
| 766 | Ga0207706_10165670 | 3300025933 | Bacteria | 1942 |
| 767 | Ga0207686_10000989 | 3300025934 | Bacteria | 16915 |
| 768 | Ga0207709_10000092 | 3300025935 | Bacteria | 139154 |
| 769 | Ga0207709_10001455 | 3300025935 | Bacteria | 16481 |
| 770 | Ga0207709_10006663 | 3300025935 | Bacteria | 6478 |
| 771 | Ga0207709_10060202 | 3300025935 | Bacteria | 2366 |
| 772 | Ga0207670_10003492 | 3300025936 | Bacteria | 8342 |
| 773 | Ga0207669_10003427 | 3300025937 | Bacteria | 6858 |
| 774 | Ga0207669_10006265 | 3300025937 | Bacteria | 5421 |
| 775 | Ga0207704_10000547 | 3300025938 | Bacteria | 16748 |
| 776 | Ga0207704_10002119 | 3300025938 | Bacteria | 8893 |
| 777 | Ga0207704_10042711 | 3300025938 | Bacteria | 2670 |
| 778 | Ga0207665_10011003 | 3300025939 | Bacteria | 5938 |
| 779 | Ga0207665_10015264 | 3300025939 | Bacteria | 5044 |
| 780 | Ga0207665_10044837 | 3300025939 | Bacteria | 2959 |
| 781 | Ga0207665_10160962 | 3300025939 | Bacteria | 1614 |
| 782 | Ga0207691_10000305 | 3300025940 | Bacteria | 48776 |
| 783 | Ga0207691_10001872 | 3300025940 | Bacteria | 20567 |
| 784 | Ga0207691_10006614 | 3300025940 | Bacteria | 11192 |
| 785 | Ga0207691_10007383 | 3300025940 | Bacteria | 10591 |
| 786 | Ga0207691_10008924 | 3300025940 | Bacteria | 9624 |
| 787 | Ga0207691_10022644 | 3300025940 | Bacteria | 5925 |
| 788 | Ga0207691_10030534 | 3300025940 | Bacteria | 5035 |
| 789 | Ga0207691_10030672 | 3300025940 | Bacteria | 5022 |
| 790 | Ga0207691_10046211 | 3300025940 | Bacteria | 4003 |
| 791 | Ga0207691_10056047 | 3300025940 | Bacteria | 3591 |
| 792 | Ga0207691_10087765 | 3300025940 | Bacteria | 2790 |
| 793 | Ga0207691_10159818 | 3300025940 | Bacteria | 1977 |
| 794 | Ga0207691_10198110 | 3300025940 | Bacteria | 1749 |
| 795 | Ga0207711_10001126 | 3300025941 | Bacteria | 25546 |
| 796 | Ga0207711_10020916 | 3300025941 | Bacteria | 5462 |
| 797 | Ga0207711_10050804 | 3300025941 | Bacteria | 3550 |
| 798 | Ga0207689_10002282 | 3300025942 | Bacteria | 17945 |
| 799 | Ga0207689_10002780 | 3300025942 | Bacteria | 16182 |
| 800 | Ga0207689_10004782 | 3300025942 | Bacteria | 12211 |
| 801 | Ga0207689_10020951 | 3300025942 | Bacteria | 5495 |
| 802 | Ga0207689_10025866 | 3300025942 | Bacteria | 4916 |
| 803 | Ga0207689_10069380 | 3300025942 | Bacteria | 2896 |
| 804 | Ga0207689_10121118 | 3300025942 | Bacteria | 2152 |
| 805 | Ga0207679_10016304 | 3300025945 | Bacteria | 4932 |
| 806 | Ga0207679_10107154 | 3300025945 | Bacteria | 2198 |
| 807 | Ga0207679_10152752 | 3300025945 | Bacteria | 1881 |
| 808 | Ga0207679_10260121 | 3300025945 | Bacteria | 1480 |
| 809 | Ga0207667_10004358 | 3300025949 | Bacteria | 17337 |
| 810 | Ga0207667_10009599 | 3300025949 | Bacteria | 11387 |
| 811 | Ga0207667_10017754 | 3300025949 | Bacteria | 8002 |
| 812 | Ga0207667_10073105 | 3300025949 | Bacteria | 3563 |
| 813 | Ga0207667_10089507 | 3300025949 | Bacteria | 3181 |
| 814 | Ga0207667_10101035 | 3300025949 | Bacteria | 2975 |
| 815 | Ga0207667_10152756 | 3300025949 | Bacteria | 2376 |
| 816 | Ga0207667_10174570 | 3300025949 | Bacteria | 2208 |
| 817 | Ga0207651_10002756 | 3300025960 | Bacteria | 8438 |
| 818 | Ga0207651_10018649 | 3300025960 | Bacteria | 4136 |
| 819 | Ga0207651_10032573 | 3300025960 | Bacteria | 3350 |
| 820 | Ga0207651_10033399 | 3300025960 | Bacteria | 3318 |
| 821 | Ga0207651_10037613 | 3300025960 | Bacteria | 3172 |
| 822 | Ga0207651_10113146 | 3300025960 | Bacteria | 2042 |
| 823 | Ga0207651_10172911 | 3300025960 | Bacteria | 1705 |
| 824 | Ga0207651_10240589 | 3300025960 | Bacteria | 1475 |
| 825 | Ga0207712_10002814 | 3300025961 | Bacteria | 11139 |
| 826 | Ga0207712_10151136 | 3300025961 | Bacteria | 1793 |
| 827 | Ga0207668_10005820 | 3300025972 | Bacteria | 7262 |
| 828 | Ga0207668_10007591 | 3300025972 | Bacteria | 6456 |
| 829 | Ga0207668_10011214 | 3300025972 | Bacteria | 5440 |
| 830 | Ga0207668_10019431 | 3300025972 | Bacteria | 4296 |
| 831 | Ga0207668_10050285 | 3300025972 | Bacteria | 2872 |
| 832 | Ga0207668_10082183 | 3300025972 | Bacteria | 2339 |
| 833 | Ga0207668_10102095 | 3300025972 | Bacteria | 2133 |
| 834 | Ga0207668_10121507 | 3300025972 | Bacteria | 1978 |
| 835 | Ga0207640_10035942 | 3300025981 | Bacteria | 3105 |
| 836 | Ga0207640_10054084 | 3300025981 | Bacteria | 2624 |
| 837 | Ga0207640_10059190 | 3300025981 | Bacteria | 2527 |
| 838 | Ga0207640_10083649 | 3300025981 | Bacteria | 2189 |
| 839 | Ga0207658_10004062 | 3300025986 | Bacteria | 10216 |
| 840 | Ga0207658_10013833 | 3300025986 | Bacteria | 5521 |
| 841 | Ga0207658_10146753 | 3300025986 | Bacteria | 1917 |
| 842 | Ga0207677_10000926 | 3300026023 | Bacteria | 16380 |
| 843 | Ga0207677_10005445 | 3300026023 | Bacteria | 6911 |
| 844 | Ga0207677_10006472 | 3300026023 | Bacteria | 6430 |
| 845 | Ga0207677_10010738 | 3300026023 | Bacteria | 5191 |
| 846 | Ga0207677_10031143 | 3300026023 | Bacteria | 3414 |
| 847 | Ga0207703_10000552 | 3300026035 | Bacteria | 38477 |
| 848 | Ga0207703_10001501 | 3300026035 | Bacteria | 21293 |
| 849 | Ga0207703_10016718 | 3300026035 | Bacteria | 5722 |
| 850 | Ga0207703_10077643 | 3300026035 | Bacteria | 2757 |
| 851 | Ga0207639_10044654 | 3300026041 | Bacteria | 3333 |
| 852 | Ga0207639_10045118 | 3300026041 | Bacteria | 3318 |
| 853 | Ga0207639_10048208 | 3300026041 | Bacteria | 3223 |
| 854 | Ga0207639_10074437 | 3300026041 | Bacteria | 2667 |
| 855 | Ga0207639_10139600 | 3300026041 | Bacteria | 2017 |
| 856 | Ga0207639_10228656 | 3300026041 | Bacteria | 1611 |
| 857 | Ga0207678_10020643 | 3300026067 | Bacteria | 5775 |
| 858 | Ga0207678_10036306 | 3300026067 | Bacteria | 4290 |
| 859 | Ga0207678_10094994 | 3300026067 | Bacteria | 2547 |
| 860 | Ga0207678_10099182 | 3300026067 | Bacteria | 2488 |
| 861 | Ga0207708_10002518 | 3300026075 | Bacteria | 13474 |
| 862 | Ga0207708_10004176 | 3300026075 | Bacteria | 10616 |
| 863 | Ga0207708_10082165 | 3300026075 | Bacteria | 2476 |
| 864 | Ga0207702_10001309 | 3300026078 | Bacteria | 24941 |
| 865 | Ga0207702_10021617 | 3300026078 | Bacteria | 5328 |
| 866 | Ga0207702_10025993 | 3300026078 | Bacteria | 4860 |
| 867 | Ga0207702_10062465 | 3300026078 | Bacteria | 3181 |
| 868 | Ga0207702_10089750 | 3300026078 | Bacteria | 2688 |
| 869 | Ga0207702_10169036 | 3300026078 | Bacteria | 2003 |
| 870 | Ga0207641_10010854 | 3300026088 | Bacteria | 7462 |
| 871 | Ga0207641_10040599 | 3300026088 | Bacteria | 3897 |
| 872 | Ga0207641_10050538 | 3300026088 | Bacteria | 3517 |
| 873 | Ga0207641_10050730 | 3300026088 | Bacteria | 3511 |
| 874 | Ga0207641_10065372 | 3300026088 | Bacteria | 3111 |
| 875 | Ga0207641_10074094 | 3300026088 | Bacteria | 2936 |
| 876 | Ga0207641_10132086 | 3300026088 | Bacteria | 2243 |
| 877 | Ga0207641_10264493 | 3300026088 | Bacteria | 1612 |
| 878 | Ga0207648_10002355 | 3300026089 | Bacteria | 20391 |
| 879 | Ga0207648_10004793 | 3300026089 | Bacteria | 13810 |
| 880 | Ga0207648_10008777 | 3300026089 | Bacteria | 9739 |
| 881 | Ga0207648_10012840 | 3300026089 | Bacteria | 7823 |
| 882 | Ga0207648_10013617 | 3300026089 | Bacteria | 7552 |
| 883 | Ga0207648_10014379 | 3300026089 | Bacteria | 7313 |
| 884 | Ga0207648_10023176 | 3300026089 | Bacteria | 5568 |
| 885 | Ga0207648_10033406 | 3300026089 | Bacteria | 4538 |
| 886 | Ga0207648_10074787 | 3300026089 | Bacteria | 2953 |
| 887 | Ga0207648_10147770 | 3300026089 | Bacteria | 2073 |
| 888 | Ga0207648_10334233 | 3300026089 | Bacteria | 1363 |
| 889 | Ga0207676_10001004 | 3300026095 | Bacteria | 21721 |
| 890 | Ga0207676_10006584 | 3300026095 | Bacteria | 8214 |
| 891 | Ga0207676_10029335 | 3300026095 | Bacteria | 4117 |
| 892 | Ga0207676_10032673 | 3300026095 | Bacteria | 3924 |
| 893 | Ga0207676_10039828 | 3300026095 | Bacteria | 3598 |
| 894 | Ga0207676_10061120 | 3300026095 | Bacteria | 2982 |
| 895 | Ga0207676_10149817 | 3300026095 | Bacteria | 2008 |
| 896 | Ga0207676_10181790 | 3300026095 | Bacteria | 1842 |
| 897 | Ga0207674_10000131 | 3300026116 | Bacteria | 88017 |
| 898 | Ga0207674_10000326 | 3300026116 | Bacteria | 60670 |
| 899 | Ga0207674_10007985 | 3300026116 | Bacteria | 12281 |
| 900 | Ga0207674_10017015 | 3300026116 | Bacteria | 7938 |
| 901 | Ga0207674_10018761 | 3300026116 | Bacteria | 7506 |
| 902 | Ga0207674_10101788 | 3300026116 | Bacteria | 2853 |
| 903 | Ga0207674_10108501 | 3300026116 | Bacteria | 2752 |
| 904 | Ga0207675_100001604 | 3300026118 | Bacteria | 22664 |
| 905 | Ga0207675_100003012 | 3300026118 | Bacteria | 16522 |
| 906 | Ga0207675_100003839 | 3300026118 | Bacteria | 14619 |
| 907 | Ga0207675_100005164 | 3300026118 | Bacteria | 12569 |
| 908 | Ga0207675_100063462 | 3300026118 | Bacteria | 3451 |
| 909 | Ga0207675_100144245 | 3300026118 | Bacteria | 2263 |
| 910 | Ga0207675_100265152 | 3300026118 | Bacteria | 1666 |
| 911 | Ga0207683_10000012 | 3300026121 | Bacteria | 134768 |
| 912 | Ga0207683_10001281 | 3300026121 | Bacteria | 22746 |
| 913 | Ga0207683_10001607 | 3300026121 | Bacteria | 20316 |
| 914 | Ga0207683_10003558 | 3300026121 | Bacteria | 13588 |
| 915 | Ga0207683_10024843 | 3300026121 | Bacteria | 5163 |
| 916 | Ga0207683_10025806 | 3300026121 | Bacteria | 5069 |
| 917 | Ga0207683_10070414 | 3300026121 | Bacteria | 3090 |
| 918 | Ga0207683_10083926 | 3300026121 | Bacteria | 2831 |
| 919 | Ga0207683_10182154 | 3300026121 | Bacteria | 1905 |
| 920 | Ga0207698_10010991 | 3300026142 | Bacteria | 5851 |
| 921 | Ga0207698_10023151 | 3300026142 | Bacteria | 4334 |
| 922 | Ga0207698_10024354 | 3300026142 | Bacteria | 4247 |
| 923 | Ga0207698_10035244 | 3300026142 | Bacteria | 3658 |
| 924 | Ga0207698_10075023 | 3300026142 | Bacteria | 2700 |
| 925 | Ga0209389_1000107 | 3300027296 | Bacteria | 74129 |
| 926 | Ga0209389_1002563 | 3300027296 | Bacteria | 14077 |
| 927 | Ga0209589_1000011 | 3300027357 | Bacteria | 236981 |
| 928 | Ga0209589_1000036 | 3300027357 | Bacteria | 131278 |
| 929 | Ga0209969_1005608 | 3300027360 | Bacteria | 1765 |
| 930 | Ga0209489_100006 | 3300027361 | Bacteria | 475698 |
| 931 | Ga0209489_100012 | 3300027361 | Bacteria | 236981 |
| 932 | Ga0209489_115889 | 3300027361 | Bacteria | 4339 |
| 933 | Ga0209489_115890 | 3300027361 | Bacteria | 4339 |
| 934 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 935 | Ga0209700_100019 | 3300027363 | Bacteria | 236981 |
| 936 | Ga0209967_1000511 | 3300027364 | Bacteria | 5096 |
| 937 | Ga0209981_1001823 | 3300027378 | Bacteria | 2703 |
| 938 | Ga0210000_1002564 | 3300027462 | Bacteria | 2592 |
| 939 | Ga0209995_1001143 | 3300027471 | Bacteria | 4078 |
| 940 | Ga0209968_1003859 | 3300027526 | Bacteria | 2250 |
| 941 | Ga0209999_1001594 | 3300027543 | Bacteria | 3905 |
| 942 | Ga0209999_1012519 | 3300027543 | Bacteria | 1537 |
| 943 | Ga0209282_1021775 | 3300027666 | Bacteria | 4046 |
| 944 | Ga0209971_1003964 | 3300027682 | Bacteria | 3503 |
| 945 | Ga0209813_10010027 | 3300027866 | Bacteria | 2439 |
| 946 | Ga0209974_10000445 | 3300027876 | Bacteria | 13695 |
| 947 | Ga0207428_10000610 | 3300027907 | Bacteria | 42207 |
| 948 | Ga0207428_10006909 | 3300027907 | Bacteria | 10401 |
| 949 | Ga0268266_10002874 | 3300028379 | Bacteria | 17897 |
| 950 | Ga0268266_10006338 | 3300028379 | Bacteria | 10846 |
| 951 | Ga0268266_10012839 | 3300028379 | Bacteria | 7232 |
| 952 | Ga0268266_10015598 | 3300028379 | Bacteria | 6512 |
| 953 | Ga0268266_10034249 | 3300028379 | Bacteria | 4319 |
| 954 | Ga0268266_10042648 | 3300028379 | Bacteria | 3876 |
| 955 | Ga0268266_10200834 | 3300028379 | Bacteria | 1825 |
| 956 | Ga0268266_10206171 | 3300028379 | Bacteria | 1801 |
| 957 | Ga0268266_10247698 | 3300028379 | Bacteria | 1647 |
| 958 | Ga0268265_10001521 | 3300028380 | Bacteria | 19348 |
| 959 | Ga0268265_10003158 | 3300028380 | Bacteria | 11997 |
| 960 | Ga0268265_10014343 | 3300028380 | Bacteria | 5397 |
| 961 | Ga0268265_10021079 | 3300028380 | Bacteria | 4559 |
| 962 | Ga0268265_10053207 | 3300028380 | Bacteria | 3066 |
| 963 | Ga0268264_10000940 | 3300028381 | Bacteria | 30212 |
| 964 | Ga0268264_10002908 | 3300028381 | Bacteria | 14883 |
| 965 | Ga0268264_10023563 | 3300028381 | Bacteria | 5019 |
| 966 | Ga0268264_10026248 | 3300028381 | Bacteria | 4758 |
| 967 | Ga0268264_10075073 | 3300028381 | Bacteria | 2874 |
| 968 | Ga0268264_10080564 | 3300028381 | Bacteria | 2780 |
| 969 | Ga0268264_10092250 | 3300028381 | Bacteria | 2614 |
| 970 | Ga0268264_10242934 | 3300028381 | Bacteria | 1669 |
| 971 | Ga0268264_10326908 | 3300028381 | Bacteria | 1452 |
| 972 | Ga0265334_10006395 | 3300028573 | Bacteria | 5079 |
| 973 | Ga0307517_10002655 | 3300028786 | Bacteria | 28561 |
| 974 | Ga0307517_10096177 | 3300028786 | Bacteria | 2375 |
| 975 | Ga0307517_10146755 | 3300028786 | Bacteria | 1634 |
| 976 | Ga0307515_10000043 | 3300028794 | Bacteria | 304612 |
| 977 | Ga0307515_10000997 | 3300028794 | Bacteria | 64733 |
| 978 | Ga0307515_10005007 | 3300028794 | Bacteria | 27028 |
| 979 | Ga0307515_10034195 | 3300028794 | Bacteria | 8334 |
| 980 | Ga0307515_10104042 | 3300028794 | Bacteria | 3397 |
| 981 | Ga0316177_1144764 | 3300030731 | Bacteria | 3679 |
| 982 | Ga0314311_1228247 | 3300030733 | Bacteria | 4335 |
| 983 | Ga0316178_1010387 | 3300030735 | Bacteria | 4481 |
| 984 | Ga0316183_1086850 | 3300030742 | Bacteria | 2106 |
| 985 | Ga0316181_1069579 | 3300030744 | Bacteria | 2120 |
| 986 | Ga0265332_10004724 | 3300031238 | Bacteria | 6353 |
| 987 | Ga0265329_10002279 | 3300031242 | Bacteria | 8800 |
| 988 | Ga0265339_10054753 | 3300031249 | Bacteria | 2166 |
| 989 | Ga0265331_10000350 | 3300031250 | Bacteria | 48905 |
| 990 | Ga0265327_10008774 | 3300031251 | Bacteria | 7461 |
| 991 | Ga0307513_10000034 | 3300031456 | Bacteria | 185012 |
| 992 | Ga0307513_10002789 | 3300031456 | Bacteria | 23982 |
| 993 | Ga0307513_10009006 | 3300031456 | Bacteria | 12664 |
| 994 | Ga0307513_10029154 | 3300031456 | Bacteria | 6296 |
| 995 | Ga0307509_10004612 | 3300031507 | Bacteria | 19754 |
| 996 | Ga0307509_10005248 | 3300031507 | Bacteria | 18145 |
| 997 | Ga0307509_10012825 | 3300031507 | Bacteria | 9976 |
| 998 | Ga0307509_10122339 | 3300031507 | Bacteria | 2577 |
| 999 | Ga0307408_100000548 | 3300031548 | Bacteria | 32373 |
| 1000 | Ga0307408_100026129 | 3300031548 | Bacteria | 4005 |
| 1001 | Ga0307408_100028905 | 3300031548 | Bacteria | 3835 |
| 1002 | Ga0307408_100160228 | 3300031548 | Bacteria | 1786 |
| 1003 | Ga0307408_100335977 | 3300031548 | Bacteria | 1277 |
| 1004 | Ga0307508_10000450 | 3300031616 | Bacteria | 49283 |
| 1005 | Ga0265314_10000412 | 3300031711 | Bacteria | 57508 |
| 1006 | Ga0307516_10000851 | 3300031730 | Bacteria | 41827 |
| 1007 | Ga0307516_10003913 | 3300031730 | Bacteria | 18775 |
| 1008 | Ga0307516_10004352 | 3300031730 | Bacteria | 17513 |
| 1009 | Ga0307516_10016764 | 3300031730 | Bacteria | 7650 |
| 1010 | Ga0307516_10021101 | 3300031730 | Bacteria | 6715 |
| 1011 | Ga0307405_10003700 | 3300031731 | Bacteria | 7094 |
| 1012 | Ga0307405_10062009 | 3300031731 | Bacteria | 2366 |
| 1013 | Ga0307405_10075847 | 3300031731 | Bacteria | 2179 |
| 1014 | Ga0307413_10014837 | 3300031824 | Bacteria | 3973 |
| 1015 | Ga0307413_10034139 | 3300031824 | Bacteria | 2904 |
| 1016 | Ga0307410_10004349 | 3300031852 | Bacteria | 7309 |
| 1017 | Ga0307406_10000252 | 3300031901 | Bacteria | 32401 |
| 1018 | Ga0307406_10003266 | 3300031901 | Bacteria | 8836 |
| 1019 | Ga0307407_10003718 | 3300031903 | Bacteria | 6330 |
| 1020 | Ga0307407_10037735 | 3300031903 | Bacteria | 2672 |
| 1021 | Ga0307412_10002295 | 3300031911 | Bacteria | 10590 |
| 1022 | Ga0307412_10021748 | 3300031911 | Bacteria | 3922 |
| 1023 | Ga0307412_10041107 | 3300031911 | Bacteria | 2994 |
| 1024 | Ga0307412_10047853 | 3300031911 | Bacteria | 2810 |
| 1025 | Ga0307412_10245617 | 3300031911 | Bacteria | 1387 |
| 1026 | Ga0307412_10247899 | 3300031911 | Bacteria | 1381 |
| 1027 | Ga0307409_100002844 | 3300031995 | Bacteria | 9155 |
| 1028 | Ga0307409_100146642 | 3300031995 | Bacteria | 2042 |
| 1029 | Ga0307409_100180960 | 3300031995 | Bacteria | 1866 |
| 1030 | Ga0307409_100184763 | 3300031995 | Bacteria | 1849 |
| 1031 | Ga0307409_100240104 | 3300031995 | Bacteria | 1649 |
| 1032 | Ga0307416_100184015 | 3300032002 | Bacteria | 1961 |
| 1033 | Ga0307416_100226173 | 3300032002 | Bacteria | 1799 |
| 1034 | Ga0307416_100240084 | 3300032002 | Bacteria | 1755 |
| 1035 | Ga0307414_10110857 | 3300032004 | Bacteria | 2088 |
| 1036 | Ga0307414_10125952 | 3300032004 | Bacteria | 1979 |
| 1037 | Ga0307411_10007755 | 3300032005 | Bacteria | 5501 |
| 1038 | Ga0307411_10140477 | 3300032005 | Bacteria | 1780 |
| 1039 | Ga0307415_100011785 | 3300032126 | Bacteria | 5022 |
| 1040 | Ga0307415_100173912 | 3300032126 | Bacteria | 1682 |
| 1041 | Ga0316583_10012723 | 3300032133 | Bacteria | 3036 |
| 1042 | Ga0307507_10047573 | 3300033179 | Bacteria | 4186 |
| 1043 | Ga0307510_10000109 | 3300033180 | Bacteria | 65353 |
| 1044 | Ga0307510_10014792 | 3300033180 | Bacteria | 9235 |
| 1045 | Ga0315911_1000003 | 3300033442 | Bacteria | 502217 |
| 1046 | Ga0373926_0020461 | 3300035083 | Bacteria | 2286 |
| 1047 | Ga0373926_0053100 | 3300035083 | Bacteria | 1466 |
| 1048 | Ga0373934_0000122 | 3300035086 | Bacteria | 28187 |
| 1049 | Ga0373934_0003712 | 3300035086 | Bacteria | 5620 |
| 1050 | Ga0373940_0014767 | 3300035088 | Bacteria | 1910 |
| 1051 | Ga0373944_0002441 | 3300035089 | Bacteria | 4719 |
| 1052 | Ga0373944_0017518 | 3300035089 | Bacteria | 2035 |
| 1053 | Ga0373944_0025274 | 3300035089 | Bacteria | 1747 |
| 1054 | Ga0373951_0019282 | 3300035091 | Bacteria | 1554 |
| 1055 | Ga0373923_0001868 | 3300035111 | Bacteria | 6268 |
| 1056 | Ga0373923_0057258 | 3300035111 | Bacteria | 1648 |
| 1057 | Ga0373932_0007459 | 3300035112 | Bacteria | 2603 |
| 1058 | Ga0373936_0014020 | 3300035113 | Bacteria | 3061 |
| 1059 | Ga0373939_0017052 | 3300035114 | Bacteria | 1924 |
| 1060 | Ga0373945_0002362 | 3300035116 | Bacteria | 5921 |
| 1061 | Ga0373945_0010415 | 3300035116 | Bacteria | 3061 |
| 1062 | Ga0373953_0003552 | 3300035117 | Bacteria | 4875 |
| 1063 | Ga0373954_0000174 | 3300035118 | Bacteria | 23102 |
| 1064 | Ga0373954_0000449 | 3300035118 | Bacteria | 15402 |
| 1065 | Ga0373954_0002684 | 3300035118 | Bacteria | 7486 |
| 1066 | Ga0373954_0007283 | 3300035118 | Bacteria | 4836 |
| 1067 | Ga0373954_0008944 | 3300035118 | Bacteria | 4407 |
| 1068 | Ga0373954_0055388 | 3300035118 | Bacteria | 1866 |
| 1069 | Ga0373956_0000054 | 3300035119 | Bacteria | 38916 |
| 1070 | Ga0373956_0014793 | 3300035119 | Bacteria | 3262 |
| 1071 | Ga0373957_0001739 | 3300035120 | Bacteria | 5997 |
| 1072 | Ga0373957_0003860 | 3300035120 | Bacteria | 4494 |
| 1073 | Ga0373957_0004716 | 3300035120 | Bacteria | 4170 |
| 1074 | Ga0373943_0004691 | 3300035170 | Bacteria | 6182 |
| 1075 | Ga0373955_0002291 | 3300035172 | Bacteria | 8323 |
| 1076 | Ga0373955_0031289 | 3300035172 | Bacteria | 2786 |
| 1077 | Ga0373955_0079730 | 3300035172 | Bacteria | 1848 |
| 1078 | Ga0373942_0017293 | 3300035207 | Bacteria | 1776 |
| 1079 | Ga0373962_0005867 | 3300035242 | Bacteria | 2964 |
| 1080 | Ga0373924_0003449 | 3300035410 | Bacteria | 5440 |
| 1081 | Ga0373924_0006114 | 3300035410 | Bacteria | 4297 |
| 1082 | Ga0373924_0019126 | 3300035410 | Bacteria | 2650 |
| 1083 | Ga0373924_0073167 | 3300035410 | Bacteria | 1448 |
| 1084 | Ga0373931_0006471 | 3300035691 | Bacteria | 5476 |
| 1085 | Ga0373935_0007402 | 3300035692 | Bacteria | 6570 |
| 1086 | Ga0373935_0007934 | 3300035692 | Bacteria | 6368 |
| 1087 | Ga0373935_0011968 | 3300035692 | Bacteria | 5212 |
| 1088 | Ga0373935_0065650 | 3300035692 | Bacteria | 2330 |
| 1089 | Ga0373935_0065896 | 3300035692 | Bacteria | 2325 |
| 1090 | Ga0373927_0005049 | 3300035695 | Bacteria | 9136 |
| 1091 | Ga0373927_0008390 | 3300035695 | Bacteria | 6949 |
| 1092 | Ga0373927_0010118 | 3300035695 | Bacteria | 6308 |
| 1093 | Ga0373927_0029106 | 3300035695 | Bacteria | 3599 |
| 1094 | Ga0373927_0034249 | 3300035695 | Bacteria | 3304 |
| 1095 | Ga0373927_0049493 | 3300035695 | Bacteria | 2717 |
| 1096 | Ga0373927_0091638 | 3300035695 | Bacteria | 1974 |
| 1097 | Ga0373933_0000782 | 3300035724 | Bacteria | 19413 |
| 1098 | Ga0373933_0008072 | 3300035724 | Bacteria | 5746 |
| 1099 | Ga0373933_0012960 | 3300035724 | Bacteria | 4612 |
| 1100 | Ga0373933_0088040 | 3300035724 | Bacteria | 1913 |
| 1101 | Ga0373933_0178186 | 3300035724 | Bacteria | 1355 |
| 1102 | Ga0373947_0015681 | 3300035725 | Bacteria | 4353 |
| 1103 | Ga0373947_0098568 | 3300035725 | Bacteria | 1833 |
| 1104 | Ga0373937_0000590 | 3300036401 | Bacteria | 32251 |
| 1105 | Ga0373937_0001198 | 3300036401 | Bacteria | 21774 |
| 1106 | Ga0373937_0022602 | 3300036401 | Bacteria | 5656 |
| 1107 | Ga0373937_0035822 | 3300036401 | Bacteria | 4519 |
| 1108 | Ga0373937_0286396 | 3300036401 | Bacteria | 1556 |
| 1109 | Ga0316582_0005485 | 3300036647 | Bacteria | 6541 |
| 1110 | Ga0373925_0009683 | 3300037068 | Bacteria | 7010 |
| 1111 | Ga0373925_0016652 | 3300037068 | Bacteria | 5324 |
| 1112 | Ga0373925_0105673 | 3300037068 | Bacteria | 2170 |
| 1113 | Ga0373925_0128155 | 3300037068 | Bacteria | 1976 |
| 1114 | Ga0373925_0172471 | 3300037068 | Bacteria | 1708 |
| 1115 | Ga0395899_0187655 | 3300037312 | Bacteria | 1448 |
| 1116 | Ga0395900_0001586 | 3300037418 | Bacteria | 26897 |
| 1117 | Ga0395900_0054523 | 3300037418 | Bacteria | 4116 |
| 1118 | Ga0395900_0070956 | 3300037418 | Bacteria | 3580 |
| 1119 | Ga0395898_0018855 | 3300037466 | Bacteria | 7030 |
| 1120 | Ga0395898_0031129 | 3300037466 | Bacteria | 5335 |
| 1121 | Ga0395898_0035905 | 3300037466 | Bacteria | 4925 |
| 1122 | Ga0395898_0067374 | 3300037466 | Bacteria | 3466 |
| 1123 | Ga0395898_0098090 | 3300037466 | Bacteria | 2814 |
| 1124 | Ga0395898_0123792 | 3300037466 | Bacteria | 2477 |
| 1125 | Ga0395898_0205184 | 3300037466 | Bacteria | 1881 |
| 1126 | Ga0395905_0055068 | 3300037471 | Bacteria | 3723 |
| 1127 | Ga0395905_0203655 | 3300037471 | Bacteria | 1855 |
| 1128 | Ga0395905_0285136 | 3300037471 | Bacteria | 1538 |
| 1129 | Ga0316581_0006616 | 3300037588 | Bacteria | 3076 |
| 1130 | Ga0436364_0175508 | 3300037853 | Bacteria | 2467 |
| 1131 | Ga0436364_1468890 | 3300037853 | Bacteria | 3472 |
| 1132 | Ga0395901_0001544 | 3300038443 | Bacteria | 23862 |
| 1133 | Ga0395901_0009907 | 3300038443 | Bacteria | 9660 |
| 1134 | Ga0395901_0014285 | 3300038443 | Bacteria | 8084 |
| 1135 | Ga0395901_0034663 | 3300038443 | Bacteria | 5214 |
| 1136 | Ga0395901_0077928 | 3300038443 | Bacteria | 3459 |
| 1137 | Ga0395901_0244032 | 3300038443 | Bacteria | 1872 |
| 1138 | Ga0395901_0338812 | 3300038443 | Bacteria | 1554 |
| 1139 | Ga0395901_0378743 | 3300038443 | Bacteria | 1457 |
| 1140 | Ga0395901_0425223 | 3300038443 | Bacteria | 1361 |
| 1141 | Ga0436365_1860619 | 3300039437 | Bacteria | 2795 |
| 1142 | Ga0436360_0269953 | 3300039438 | Bacteria | 1391 |
| 1143 | Ga0436360_0914350 | 3300039438 | Bacteria | 7514 |
| 1144 | Ga0439436_0005119 | 3300041404 | Bacteria | 4018 |
| 1145 | Ga0439466_0004842 | 3300041411 | Bacteria | 5178 |
| 1146 | Ga0451800_1323902 | 3300041459 | Bacteria | 1543 |
| 1147 | Ga0439441_001747 | 3300042001 | Bacteria | 2927 |
| 1148 | Ga0439441_004454 | 3300042001 | Bacteria | 2124 |
| 1149 | Ga0439442_007829 | 3300042002 | Bacteria | 2156 |
| 1150 | Ga0439432_006320 | 3300042006 | Bacteria | 4237 |
| 1151 | Ga0439449_0009382 | 3300042007 | Bacteria | 3709 |
| 1152 | Ga0450911_001006 | 3300042115 | Bacteria | 7214 |
| 1153 | Ga0439446_0000182 | 3300042156 | Bacteria | 11066 |
| 1154 | Ga0439446_0004139 | 3300042156 | Bacteria | 3657 |
| 1155 | Ga0439434_0000753 | 3300042435 | Bacteria | 9302 |
| 1156 | Ga0439434_0026983 | 3300042435 | Bacteria | 1735 |
| 1157 | Ga0439435_0010096 | 3300042436 | Bacteria | 2231 |
| 1158 | Ga0439444_0010178 | 3300042437 | Bacteria | 1498 |
| 1159 | Ga0439460_0011018 | 3300042461 | Bacteria | 2326 |
| 1160 | Ga0466972_0000122 | 3300044658 | Bacteria | 65679 |
| 1161 | Ga0466965_0014791 | 3300044683 | Bacteria | 3696 |
| 1162 | Ga0466966_0008365 | 3300044684 | Bacteria | 6853 |
| 1163 | Ga0466966_0020376 | 3300044684 | Bacteria | 4361 |
| 1164 | Ga0466961_0000038 | 3300044693 | Bacteria | 80721 |
| 1165 | Ga0466971_0088447 | 3300044719 | Bacteria | 1417 |
| 1166 | Ga0466957_0069481 | 3300044842 | Bacteria | 2176 |
| 1167 | Ga0466957_0229669 | 3300044842 | Bacteria | 1228 |
| 1168 | Ga0466959_0009876 | 3300045049 | Bacteria | 6803 |
| 1169 | Ga0466959_0071972 | 3300045049 | Bacteria | 2503 |
| 1170 | Ga0451576_0001864 | 3300045051 | Bacteria | 34040 |
| 1171 | Ga0451576_0004679 | 3300045051 | Bacteria | 17624 |
| 1172 | Ga0451576_0015696 | 3300045051 | Bacteria | 8384 |
| 1173 | Ga0466967_0152177 | 3300045976 | Bacteria | 2163 |
| 1174 | Ga0495592_0000160 | 3300046454 | Bacteria | 59404 |
| 1175 | Ga0495592_0000163 | 3300046454 | Bacteria | 59199 |
| 1176 | Ga0495592_0001343 | 3300046454 | Bacteria | 17024 |
| 1177 | Ga0495592_0009664 | 3300046454 | Bacteria | 7259 |
| 1178 | Ga0495592_0031488 | 3300046454 | Bacteria | 4008 |
| 1179 | Ga0495603_0041723 | 3300046455 | Bacteria | 2743 |
| 1180 | Ga0495629_0171883 | 3300046459 | Bacteria | 1504 |
| 1181 | Ga0495641_0012566 | 3300046461 | Bacteria | 4723 |
| 1182 | Ga0495651_0000881 | 3300046462 | Bacteria | 23351 |
| 1183 | Ga0495651_0013912 | 3300046462 | Bacteria | 6222 |
| 1184 | Ga0495651_0068424 | 3300046462 | Bacteria | 2707 |
| 1185 | Ga0495653_0045866 | 3300046463 | Bacteria | 3386 |
| 1186 | Ga0495653_0120810 | 3300046463 | Bacteria | 1868 |
| 1187 | Ga0495580_0019423 | 3300046472 | Bacteria | 5049 |
| 1188 | Ga0495580_0060427 | 3300046472 | Bacteria | 2663 |
| 1189 | Ga0495582_0001076 | 3300046473 | Bacteria | 15333 |
| 1190 | Ga0495582_0008434 | 3300046473 | Bacteria | 5685 |
| 1191 | Ga0495639_0001255 | 3300046475 | Bacteria | 11434 |
| 1192 | Ga0495639_0004716 | 3300046475 | Bacteria | 5861 |
| 1193 | Ga0495639_0005054 | 3300046475 | Bacteria | 5666 |
| 1194 | Ga0495639_0010412 | 3300046475 | Bacteria | 4006 |
| 1195 | Ga0495639_0014938 | 3300046475 | Bacteria | 3365 |
| 1196 | Ga0495662_0002396 | 3300046476 | Bacteria | 9424 |
| 1197 | Ga0495662_0091002 | 3300046476 | Bacteria | 1487 |
| 1198 | Ga0495664_0024586 | 3300046477 | Bacteria | 3502 |
| 1199 | Ga0495594_0015836 | 3300046499 | Bacteria | 3966 |
| 1200 | Ga0495594_0052150 | 3300046499 | Bacteria | 2252 |
| 1201 | Ga0495607_0001888 | 3300046501 | Bacteria | 17773 |
| 1202 | Ga0495608_0000112 | 3300046511 | Bacteria | 57935 |
| 1203 | Ga0495608_0078079 | 3300046511 | Bacteria | 2155 |
| 1204 | Ga0495610_0013320 | 3300046512 | Bacteria | 4892 |
| 1205 | Ga0495610_0042766 | 3300046512 | Bacteria | 2263 |
| 1206 | Ga0495616_0018427 | 3300046513 | Bacteria | 3832 |
| 1207 | Ga0495618_0031487 | 3300046514 | Bacteria | 3318 |
| 1208 | Ga0495620_0051678 | 3300046515 | Bacteria | 1748 |
| 1209 | Ga0495628_0000931 | 3300046516 | Bacteria | 26852 |
| 1210 | Ga0495628_0005171 | 3300046516 | Bacteria | 11469 |
| 1211 | Ga0495628_0056050 | 3300046516 | Bacteria | 3103 |
| 1212 | Ga0495628_0098401 | 3300046516 | Bacteria | 2259 |
| 1213 | Ga0495628_0138512 | 3300046516 | Bacteria | 1858 |
| 1214 | Ga0495630_0002409 | 3300046517 | Bacteria | 12985 |
| 1215 | Ga0495631_0000660 | 3300046518 | Bacteria | 22275 |
| 1216 | Ga0495632_0008995 | 3300046519 | Bacteria | 6060 |
| 1217 | Ga0495643_0017469 | 3300046522 | Bacteria | 4192 |
| 1218 | Ga0495666_0010469 | 3300046526 | Bacteria | 4623 |
| 1219 | Ga0495666_0081289 | 3300046526 | Bacteria | 1533 |
| 1220 | Ga0495642_0021710 | 3300046528 | Bacteria | 2526 |
| 1221 | Ga0495652_0010373 | 3300046529 | Bacteria | 8443 |
| 1222 | Ga0495652_0041978 | 3300046529 | Bacteria | 3945 |
| 1223 | Ga0495652_0055601 | 3300046529 | Bacteria | 3365 |
| 1224 | Ga0495652_0084990 | 3300046529 | Bacteria | 2601 |
| 1225 | Ga0495665_0001558 | 3300046531 | Bacteria | 12233 |
| 1226 | Ga0495665_0002382 | 3300046531 | Bacteria | 10158 |
| 1227 | Ga0495665_0005107 | 3300046531 | Bacteria | 7079 |
| 1228 | Ga0495665_0059015 | 3300046531 | Bacteria | 2026 |
| 1229 | Ga0495640_0008789 | 3300046533 | Bacteria | 7904 |
| 1230 | Ga0495640_0036716 | 3300046533 | Bacteria | 3460 |
| 1231 | Ga0495640_0038067 | 3300046533 | Bacteria | 3386 |
| 1232 | Ga0495586_0004819 | 3300046535 | Bacteria | 7211 |
| 1233 | Ga0495586_0005688 | 3300046535 | Bacteria | 6668 |
| 1234 | Ga0495586_0049507 | 3300046535 | Bacteria | 2272 |
| 1235 | Ga0495586_0102747 | 3300046535 | Bacteria | 1587 |
| 1236 | Ga0495587_0039563 | 3300046536 | Bacteria | 2821 |
| 1237 | Ga0495598_0009416 | 3300046537 | Bacteria | 2308 |
| 1238 | Ga0495597_0000271 | 3300046542 | Bacteria | 47044 |
| 1239 | Ga0495597_0016916 | 3300046542 | Bacteria | 3439 |
| 1240 | Ga0495645_0000592 | 3300046543 | Bacteria | 24955 |
| 1241 | Ga0495645_0021371 | 3300046543 | Bacteria | 4678 |
| 1242 | Ga0495645_0031168 | 3300046543 | Bacteria | 3884 |
| 1243 | Ga0495645_0163303 | 3300046543 | Bacteria | 1538 |
| 1244 | Ga0495668_0006479 | 3300046616 | Bacteria | 7661 |
| 1245 | Ga0495634_0047458 | 3300046642 | Bacteria | 2893 |
| 1246 | Ga0495625_0000146 | 3300046660 | Bacteria | 108123 |
| 1247 | Ga0495625_0000337 | 3300046660 | Bacteria | 71532 |
| 1248 | Ga0495625_0015391 | 3300046660 | Bacteria | 6061 |
| 1249 | Ga0495625_0016801 | 3300046660 | Bacteria | 5746 |
| 1250 | Ga0495625_0023947 | 3300046660 | Bacteria | 4655 |
| 1251 | Ga0495635_0008975 | 3300046663 | Bacteria | 6979 |
| 1252 | Ga0495635_0029727 | 3300046663 | Bacteria | 3800 |
| 1253 | Ga0495661_0004974 | 3300046665 | Bacteria | 9492 |
| 1254 | Ga0495588_0005084 | 3300046674 | Bacteria | 5844 |
| 1255 | Ga0495588_0053535 | 3300046674 | Bacteria | 2081 |
| 1256 | Ga0495657_0029626 | 3300046675 | Bacteria | 3837 |
| 1257 | Ga0495599_0020376 | 3300046678 | Bacteria | 4130 |
| 1258 | Ga0495599_0025468 | 3300046678 | Bacteria | 3703 |
| 1259 | Ga0495623_0012442 | 3300046679 | Bacteria | 5508 |
| 1260 | Ga0495647_0003916 | 3300046681 | Bacteria | 4804 |
| 1261 | Ga0495647_0004228 | 3300046681 | Bacteria | 4648 |
| 1262 | Ga0495647_0006474 | 3300046681 | Bacteria | 3880 |
| 1263 | Ga0495647_0006981 | 3300046681 | Bacteria | 3763 |
| 1264 | Ga0495658_0006398 | 3300046683 | Bacteria | 5786 |
| 1265 | Ga0495658_0014450 | 3300046683 | Bacteria | 4035 |
| 1266 | Ga0495658_0018307 | 3300046683 | Bacteria | 3639 |
| 1267 | Ga0495658_0047719 | 3300046683 | Bacteria | 2412 |
| 1268 | Ga0495669_0002266 | 3300046684 | Bacteria | 7892 |
| 1269 | Ga0495613_0017768 | 3300046689 | Bacteria | 5300 |
| 1270 | Ga0495613_0019748 | 3300046689 | Bacteria | 5021 |
| 1271 | Ga0495613_0027380 | 3300046689 | Bacteria | 4242 |
| 1272 | Ga0495624_0007501 | 3300046690 | Bacteria | 7651 |
| 1273 | Ga0495624_0027634 | 3300046690 | Bacteria | 3714 |
| 1274 | Ga0495624_0040501 | 3300046690 | Bacteria | 2984 |
| 1275 | Ga0495649_0011645 | 3300046694 | Bacteria | 5153 |
| 1276 | Ga0495600_0000413 | 3300046809 | Bacteria | 22111 |
| 1277 | Ga0495581_0003251 | 3300047315 | Bacteria | 9316 |
| 1278 | Ga0495604_0051220 | 3300047317 | Bacteria | 3201 |
| 1279 | Ga0495674_0009334 | 3300047319 | Bacteria | 9327 |
| 1280 | Ga0495672_0011717 | 3300047320 | Bacteria | 6166 |
| 1281 | Ga0495676_0004847 | 3300047321 | Bacteria | 12342 |
| 1282 | Ga0495676_0027757 | 3300047321 | Bacteria | 4849 |
| 1283 | Ga0495676_0033347 | 3300047321 | Bacteria | 4339 |
| 1284 | Ga0495680_0003144 | 3300047322 | Bacteria | 16455 |
| 1285 | Ga0495680_0030418 | 3300047322 | Bacteria | 4408 |
| 1286 | Ga0495680_0066319 | 3300047322 | Bacteria | 2763 |
| 1287 | Ga0495680_0071548 | 3300047322 | Bacteria | 2640 |
| 1288 | Ga0495687_004820 | 3300047443 | Bacteria | 8886 |
| 1289 | Ga0495687_017610 | 3300047443 | Bacteria | 3557 |
| 1290 | Ga0495687_022383 | 3300047443 | Bacteria | 3034 |
| 1291 | Ga0495675_0018241 | 3300047444 | Bacteria | 4453 |
| 1292 | Ga0495675_0075459 | 3300047444 | Bacteria | 2125 |
| 1293 | Ga0495685_027576 | 3300047447 | Bacteria | 1954 |
| 1294 | Ga0495673_0072245 | 3300047469 | Bacteria | 1449 |
| 1295 | Ga0495681_0062573 | 3300047470 | Bacteria | 1711 |
| 1296 | Ga0495684_0042716 | 3300047471 | Bacteria | 3471 |
| 1297 | Ga0496100_0030763 | 3300048903 | Bacteria | 3332 |
| 1298 | Ga0496100_0184125 | 3300048903 | Bacteria | 1512 |
| 1299 | Ga0496100_0202541 | 3300048903 | Bacteria | 1447 |
| 1300 | Ga0496101_0000648 | 3300048904 | Bacteria | 20964 |
| 1301 | Ga0496101_0008563 | 3300048904 | Bacteria | 6687 |
| 1302 | Ga0496101_0015153 | 3300048904 | Bacteria | 5190 |
| 1303 | Ga0496101_0022950 | 3300048904 | Bacteria | 4303 |
| 1304 | Ga0496102_0006708 | 3300048905 | Bacteria | 9832 |
| 1305 | Ga0496102_0009709 | 3300048905 | Bacteria | 8274 |
| 1306 | Ga0496102_0021133 | 3300048905 | Bacteria | 5755 |
| 1307 | Ga0496102_0025539 | 3300048905 | Bacteria | 5260 |
| 1308 | Ga0496102_0045525 | 3300048905 | Bacteria | 3984 |
| 1309 | Ga0496102_0048945 | 3300048905 | Bacteria | 3844 |
| 1310 | Ga0496103_0010060 | 3300048906 | Bacteria | 5593 |
| 1311 | Ga0496103_0020553 | 3300048906 | Bacteria | 3967 |
| 1312 | Ga0496103_0066360 | 3300048906 | Bacteria | 2252 |
| 1313 | Ga0496103_0086628 | 3300048906 | Bacteria | 1974 |
| 1314 | Ga0496104_0009873 | 3300048907 | Bacteria | 8520 |
| 1315 | Ga0496104_0010866 | 3300048907 | Bacteria | 8142 |
| 1316 | Ga0496104_0013631 | 3300048907 | Bacteria | 7329 |
| 1317 | Ga0496104_0017610 | 3300048907 | Bacteria | 6509 |
| 1318 | Ga0496104_0023744 | 3300048907 | Bacteria | 5639 |
| 1319 | Ga0496104_0324337 | 3300048907 | Bacteria | 1453 |
| 1320 | Ga0496105_0004124 | 3300048908 | Bacteria | 10892 |
| 1321 | Ga0496105_0020682 | 3300048908 | Bacteria | 5320 |
| 1322 | Ga0496105_0026867 | 3300048908 | Bacteria | 4697 |
| 1323 | Ga0496105_0062665 | 3300048908 | Bacteria | 3069 |
| 1324 | Ga0496106_0013736 | 3300048909 | Bacteria | 5980 |
| 1325 | Ga0496106_0071440 | 3300048909 | Bacteria | 2653 |
| 1326 | Ga0496106_0131483 | 3300048909 | Bacteria | 1963 |
| 1327 | Ga0496106_0147962 | 3300048909 | Bacteria | 1851 |
| 1328 | Ga0496107_0010282 | 3300048910 | Bacteria | 6497 |
| 1329 | Ga0496107_0014148 | 3300048910 | Bacteria | 5586 |
| 1330 | Ga0496107_0111178 | 3300048910 | Bacteria | 2014 |
| 1331 | Ga0496107_0114631 | 3300048910 | Bacteria | 1983 |
| 1332 | Ga0496108_0004526 | 3300048911 | Bacteria | 11195 |
| 1333 | Ga0496108_0034837 | 3300048911 | Bacteria | 4183 |
| 1334 | Ga0496108_0090160 | 3300048911 | Bacteria | 2606 |
| 1335 | Ga0496109_0009137 | 3300048912 | Bacteria | 8439 |
| 1336 | Ga0496109_0124537 | 3300048912 | Bacteria | 2402 |
| 1337 | Ga0496109_0136115 | 3300048912 | Bacteria | 2295 |
| 1338 | Ga0496109_0141421 | 3300048912 | Bacteria | 2250 |
| 1339 | Ga0496109_0300190 | 3300048912 | Bacteria | 1514 |
| 1340 | Ga0496109_0324861 | 3300048912 | Bacteria | 1452 |
| 1341 | Ga0496109_0332129 | 3300048912 | Bacteria | 1435 |
| 1342 | Ga0496110_0007558 | 3300048913 | Bacteria | 8681 |
| 1343 | Ga0496110_0058595 | 3300048913 | Bacteria | 3392 |
| 1344 | Ga0496110_0162407 | 3300048913 | Bacteria | 2025 |
| 1345 | Ga0496110_0253393 | 3300048913 | Bacteria | 1602 |
| 1346 | Ga0496111_0080941 | 3300048914 | Bacteria | 2370 |
| 1347 | Ga0496112_0002865 | 3300048915 | Bacteria | 14019 |
| 1348 | Ga0496112_0008850 | 3300048915 | Bacteria | 9033 |
| 1349 | Ga0496112_0027916 | 3300048915 | Bacteria | 5445 |
| 1350 | Ga0496112_0028785 | 3300048915 | Bacteria | 5366 |
| 1351 | Ga0496112_0248046 | 3300048915 | Bacteria | 1732 |
| 1352 | Ga0496112_0270924 | 3300048915 | Bacteria | 1646 |
| 1353 | Ga0496113_0010063 | 3300048916 | Bacteria | 6238 |
| 1354 | Ga0496113_0168466 | 3300048916 | Bacteria | 1734 |
| 1355 | Ga0496113_0219647 | 3300048916 | Bacteria | 1514 |
| 1356 | Ga0496114_0008449 | 3300048917 | Bacteria | 8158 |
| 1357 | Ga0496114_0020456 | 3300048917 | Bacteria | 5372 |
| 1358 | Ga0496114_0038579 | 3300048917 | Bacteria | 3953 |
| 1359 | Ga0496114_0134807 | 3300048917 | Bacteria | 2135 |
| 1360 | Ga0496115_0013729 | 3300048918 | Bacteria | 6133 |
| 1361 | Ga0496116_0009705 | 3300048919 | Bacteria | 8179 |
| 1362 | Ga0496116_0026735 | 3300048919 | Bacteria | 4210 |
| 1363 | Ga0496117_0037255 | 3300048920 | Bacteria | 3625 |
| 1364 | Ga0496118_0009367 | 3300048921 | Bacteria | 9915 |
| 1365 | Ga0496118_0015550 | 3300048921 | Bacteria | 7038 |
| 1366 | Ga0496121_0017571 | 3300048924 | Bacteria | 7293 |
| 1367 | Ga0496121_0067230 | 3300048924 | Bacteria | 2905 |
| 1368 | Ga0496121_0077877 | 3300048924 | Bacteria | 2638 |
| 1369 | Ga0496121_0141252 | 3300048924 | Bacteria | 1786 |
| 1370 | Ga0496121_0170361 | 3300048924 | Bacteria | 1582 |
| 1371 | Ga0496121_0227373 | 3300048924 | Bacteria | 1309 |
| 1372 | Ga0496122_0000408 | 3300048925 | Bacteria | 91323 |
| 1373 | Ga0496123_0000124 | 3300048926 | Bacteria | 158327 |
| 1374 | Ga0496123_0000188 | 3300048926 | Bacteria | 125135 |
| 1375 | Ga0496123_0119361 | 3300048926 | Bacteria | 1487 |
| 1376 | Ga0496125_0000060 | 3300048928 | Bacteria | 264143 |
| 1377 | Ga0496125_0000939 | 3300048928 | Bacteria | 45810 |
| 1378 | Ga0496125_0003316 | 3300048928 | Bacteria | 19699 |
| 1379 | Ga0496125_0012543 | 3300048928 | Bacteria | 8404 |
| 1380 | Ga0496125_0038850 | 3300048928 | Bacteria | 4110 |
| 1381 | Ga0496126_0061276 | 3300048929 | Bacteria | 3380 |
| 1382 | Ga0496126_0066290 | 3300048929 | Bacteria | 3228 |
| 1383 | Ga0495678_058853 | 3300049459 | Bacteria | 1451 |
| 1384 | Ga0501033_0221879 | 3300049570 | Bacteria | 1345 |
| 1385 | Ga0501034_0002706 | 3300049571 | Bacteria | 20879 |
| 1386 | Ga0501034_0049783 | 3300049571 | Bacteria | 4228 |
| 1387 | Ga0501034_0049918 | 3300049571 | Bacteria | 4221 |
| 1388 | Ga0501034_0077092 | 3300049571 | Bacteria | 3339 |
| 1389 | Ga0501034_0101177 | 3300049571 | Bacteria | 2876 |
| 1390 | Ga0501036_0036902 | 3300049572 | Bacteria | 4135 |
| 1391 | Ga0501036_0115181 | 3300049572 | Bacteria | 2271 |
| 1392 | Ga0501037_0093781 | 3300049573 | Bacteria | 2171 |
| 1393 | Ga0501038_0023765 | 3300049574 | Bacteria | 5476 |
| 1394 | Ga0501038_0079258 | 3300049574 | Bacteria | 2770 |
| 1395 | Ga0501039_0001773 | 3300049575 | Bacteria | 15943 |
| 1396 | Ga0501039_0010820 | 3300049575 | Bacteria | 6951 |
| 1397 | Ga0501039_0032989 | 3300049575 | Bacteria | 3994 |
| 1398 | Ga0501039_0051640 | 3300049575 | Bacteria | 3181 |
| 1399 | Ga0501039_0056245 | 3300049575 | Bacteria | 3047 |
| 1400 | Ga0501039_0187571 | 3300049575 | Bacteria | 1626 |
| 1401 | Ga0501040_0005843 | 3300049576 | Bacteria | 7965 |
| 1402 | Ga0501040_0007299 | 3300049576 | Bacteria | 7160 |
| 1403 | Ga0501040_0016338 | 3300049576 | Bacteria | 4911 |
| 1404 | Ga0501040_0022260 | 3300049576 | Bacteria | 4240 |
| 1405 | Ga0501041_0001572 | 3300049577 | Bacteria | 12703 |
| 1406 | Ga0501041_0005336 | 3300049577 | Bacteria | 7521 |
| 1407 | Ga0501041_0034766 | 3300049577 | Bacteria | 3052 |
| 1408 | Ga0501042_0003040 | 3300049578 | Bacteria | 10436 |
| 1409 | Ga0501042_0011136 | 3300049578 | Bacteria | 6060 |
| 1410 | Ga0501042_0063919 | 3300049578 | Bacteria | 2630 |
| 1411 | Ga0501043_0149735 | 3300049579 | Bacteria | 1826 |
| 1412 | Ga0501046_0010010 | 3300049580 | Bacteria | 8167 |
| 1413 | Ga0501047_0075613 | 3300049581 | Bacteria | 3241 |
| 1414 | Ga0501047_0240411 | 3300049581 | Bacteria | 1661 |
| 1415 | Ga0501048_0016231 | 3300049582 | Bacteria | 5490 |
| 1416 | Ga0501067_0056290 | 3300049583 | Bacteria | 2179 |
| 1417 | Ga0501067_0082717 | 3300049583 | Bacteria | 1780 |
| 1418 | Ga0501068_0014530 | 3300049584 | Bacteria | 4503 |
| 1419 | Ga0501070_0054730 | 3300049586 | Bacteria | 3309 |
| 1420 | Ga0501070_0070807 | 3300049586 | Bacteria | 2887 |
| 1421 | Ga0501070_0316420 | 3300049586 | Bacteria | 1270 |
| 1422 | Ga0501071_0000373 | 3300049587 | Bacteria | 21984 |
| 1423 | Ga0501071_0016292 | 3300049587 | Bacteria | 5111 |
| 1424 | Ga0501071_0019722 | 3300049587 | Bacteria | 4680 |
| 1425 | Ga0501071_0021607 | 3300049587 | Bacteria | 4483 |
| 1426 | Ga0501072_0001156 | 3300049588 | Bacteria | 19636 |
| 1427 | Ga0501072_0002674 | 3300049588 | Bacteria | 13366 |
| 1428 | Ga0501072_0010678 | 3300049588 | Bacteria | 6992 |
| 1429 | Ga0501072_0018804 | 3300049588 | Bacteria | 5330 |
| 1430 | Ga0501072_0069898 | 3300049588 | Bacteria | 2772 |
| 1431 | Ga0501073_0005691 | 3300049589 | Bacteria | 9323 |
| 1432 | Ga0501073_0162819 | 3300049589 | Bacteria | 1545 |
| 1433 | Ga0501074_0066911 | 3300049590 | Bacteria | 2584 |
| 1434 | Ga0501074_0124449 | 3300049590 | Bacteria | 1844 |
| 1435 | Ga0501074_0131313 | 3300049590 | Bacteria | 1792 |
| 1436 | Ga0501075_0000936 | 3300049591 | Bacteria | 18548 |
| 1437 | Ga0501075_0028293 | 3300049591 | Bacteria | 4137 |
| 1438 | Ga0501075_0093655 | 3300049591 | Bacteria | 2280 |
| 1439 | Ga0501075_0112563 | 3300049591 | Bacteria | 2069 |
| 1440 | Ga0501076_0000368 | 3300049592 | Bacteria | 28011 |
| 1441 | Ga0501076_0000723 | 3300049592 | Bacteria | 21344 |
| 1442 | Ga0501076_0008694 | 3300049592 | Bacteria | 7458 |
| 1443 | Ga0501076_0067779 | 3300049592 | Bacteria | 2850 |
| 1444 | Ga0501076_0107612 | 3300049592 | Bacteria | 2252 |
| 1445 | Ga0501076_0149854 | 3300049592 | Bacteria | 1897 |
| 1446 | Ga0501077_0007614 | 3300049593 | Bacteria | 6684 |
| 1447 | Ga0501077_0010717 | 3300049593 | Bacteria | 5708 |
| 1448 | Ga0501077_0084935 | 3300049593 | Bacteria | 2006 |
| 1449 | Ga0501079_0004391 | 3300049741 | Bacteria | 10441 |
| 1450 | Ga0501079_0006780 | 3300049741 | Bacteria | 8616 |
| 1451 | Ga0501079_0019212 | 3300049741 | Bacteria | 5220 |
| 1452 | Ga0501079_0242440 | 3300049741 | Bacteria | 1408 |
| 1453 | Ga0501080_0000884 | 3300049742 | Bacteria | 24518 |
| 1454 | Ga0501080_0014279 | 3300049742 | Bacteria | 7315 |
| 1455 | Ga0501080_0018314 | 3300049742 | Bacteria | 6481 |
| 1456 | Ga0501080_0059029 | 3300049742 | Bacteria | 3571 |
| 1457 | Ga0501081_0008922 | 3300049743 | Bacteria | 6516 |
| 1458 | Ga0501081_0012105 | 3300049743 | Bacteria | 5655 |
| 1459 | Ga0501081_0162389 | 3300049743 | Bacteria | 1610 |
| 1460 | Ga0501081_0174342 | 3300049743 | Bacteria | 1553 |
| 1461 | Ga0501083_0099888 | 3300049744 | Bacteria | 1914 |
| 1462 | Ga0501262_000676 | 3300049759 | Bacteria | 3958 |
| 1463 | Ga0501035_0160942 | 3300049822 | Bacteria | 1943 |
| 1464 | Ga0501035_0185716 | 3300049822 | Bacteria | 1789 |
| 1465 | Ga0501044_0014975 | 3300049823 | Bacteria | 8361 |
| 1466 | Ga0501044_0040015 | 3300049823 | Bacteria | 4888 |
| 1467 | Ga0501044_0042184 | 3300049823 | Bacteria | 4747 |
| 1468 | Ga0501044_0206525 | 3300049823 | Bacteria | 1920 |
| 1469 | Ga0501045_0000263 | 3300049824 | Bacteria | 30506 |
| 1470 | Ga0501045_0007193 | 3300049824 | Bacteria | 7722 |
| 1471 | Ga0501045_0009377 | 3300049824 | Bacteria | 6843 |
| 1472 | Ga0501045_0203571 | 3300049824 | Bacteria | 1475 |
| 1473 | nmdc:mga03683_67597_c1 | 3300050489 | Bacteria | 1521 |
| 1474 | nmdc:mga03n38_28823_c1 | 3300050490 | Bacteria | 2318 |
| 1475 | nmdc:mga00v17_33302_c1 | 3300050491 | Bacteria | 3053 |
| 1476 | nmdc:mga00v17_62148_c1 | 3300050491 | Bacteria | 2297 |
| 1477 | nmdc:mga0yw44_14606_c1 | 3300050492 | Bacteria | 4176 |
| 1478 | nmdc:mga0yw44_28991_c1 | 3300050492 | Bacteria | 3191 |
| 1479 | nmdc:mga0yw44_86618_c1 | 3300050492 | Bacteria | 1973 |
| 1480 | nmdc:mga0k408_130547_c1 | 3300050493 | Bacteria | 1492 |
| 1481 | nmdc:mga0k408_38350_c1 | 3300050493 | Bacteria | 2750 |
| 1482 | nmdc:mga0k408_5966_c1 | 3300050493 | Bacteria | 6501 |
| 1483 | nmdc:mga0k408_6258_c1 | 3300050493 | Bacteria | 6350 |
| 1484 | nmdc:mga0k408_91149_c1 | 3300050493 | Bacteria | 1791 |
| 1485 | nmdc:mga0k408_9812_c1 | 3300050493 | Bacteria | 5171 |
| 1486 | nmdc:mga06z11_5930_c1 | 3300050494 | Bacteria | 4935 |
| 1487 | nmdc:mga06z11_71560_c1 | 3300050494 | Bacteria | 1836 |
| 1488 | nmdc:mga06z11_79424_c1 | 3300050494 | Bacteria | 1756 |
| 1489 | nmdc:mga04h51_30499_c1 | 3300050495 | Bacteria | 1697 |
| 1490 | nmdc:mga07m45_114474_c1 | 3300050496 | Bacteria | 1555 |
| 1491 | nmdc:mga07m45_1563_c1 | 3300050496 | Bacteria | 10535 |
| 1492 | nmdc:mga07m45_20110_c1 | 3300050496 | Bacteria | 3624 |
| 1493 | nmdc:mga07m45_2696_c2 | 3300050496 | Bacteria | 3813 |
| 1494 | nmdc:mga07m45_3774_c1 | 3300050496 | Bacteria | 7328 |
| 1495 | nmdc:mga07m45_577_c1 | 3300050496 | Bacteria | 15597 |
| 1496 | nmdc:mga05p37_758_c1 | 3300050507 | Bacteria | 35839 |
| 1497 | nmdc:mga05p37_8_c1 | 3300050507 | Bacteria | 153982 |
| 1498 | nmdc:mga09592_101343_c1 | 3300050508 | Bacteria | 2467 |
| 1499 | nmdc:mga09592_12310_c1 | 3300050508 | Bacteria | 6966 |
| 1500 | nmdc:mga09592_130039_c1 | 3300050508 | Bacteria | 2166 |
| 1501 | nmdc:mga09592_5994_c1 | 3300050508 | Bacteria | 9912 |
| 1502 | nmdc:mga0qj67_727_c1 | 3300050509 | Bacteria | 22392 |
| 1503 | nmdc:mga06r32_131218_c1 | 3300050510 | Bacteria | 2478 |
| 1504 | nmdc:mga06r32_2_c2 | 3300050510 | Bacteria | 135779 |
| 1505 | nmdc:mga06r32_40790_c1 | 3300050510 | Bacteria | 4408 |
| 1506 | nmdc:mga06r32_5553_c1 | 3300050510 | Bacteria | 11365 |
| 1507 | nmdc:mga08y16_10189_c1 | 3300050511 | Bacteria | 9871 |
| 1508 | nmdc:mga08y16_141939_c1 | 3300050511 | Bacteria | 2497 |
| 1509 | nmdc:mga08y16_40523_c1 | 3300050511 | Bacteria | 4882 |
| 1510 | nmdc:mga08y16_7868_c1 | 3300050511 | Bacteria | 11161 |
| 1511 | nmdc:mga0n895_103893_c1 | 3300050512 | Bacteria | 2853 |
| 1512 | nmdc:mga0n895_10501_c1 | 3300050512 | Bacteria | 8190 |
| 1513 | nmdc:mga0n895_126353_c1 | 3300050512 | Bacteria | 2581 |
| 1514 | nmdc:mga0n895_13715_c1 | 3300050512 | Bacteria | 7327 |
| 1515 | nmdc:mga0n895_1569_c1 | 3300050512 | Bacteria | 17184 |
| 1516 | nmdc:mga0n895_2878_c1 | 3300050512 | Bacteria | 13655 |
| 1517 | nmdc:mga0n895_29379_c1 | 3300050512 | Bacteria | 5242 |
| 1518 | nmdc:mga0rr50_261772_c1 | 3300050513 | Bacteria | 1439 |
| 1519 | nmdc:mga0rr50_47223_c1 | 3300050513 | Bacteria | 3175 |
| 1520 | nmdc:mga08x19_103071_c1 | 3300050514 | Bacteria | 1895 |
| 1521 | nmdc:mga08x19_10771_c1 | 3300050514 | Bacteria | 5497 |
| 1522 | nmdc:mga0a205_146335_c1 | 3300050515 | Bacteria | 2263 |
| 1523 | nmdc:mga0a205_226174_c1 | 3300050515 | Bacteria | 1755 |
| 1524 | nmdc:mga0sz30_183_c2 | 3300050516 | Bacteria | 16792 |
| 1525 | Ga0495601_0062656 | 3300053077 | Bacteria | 2362 |
| 1526 | Ga0495612_0056450 | 3300053078 | Bacteria | 1621 |
| 1527 | Ga0495595_0015766 | 3300053084 | Bacteria | 3225 |
| 1528 | Ga0495619_0009928 | 3300053085 | Bacteria | 5995 |
| 1529 | Ga0500578_0148542 | 3300053086 | Bacteria | 1461 |
| 1530 | Ga0500651_0000306 | 3300053093 | Bacteria | 28273 |
| 1531 | Ga0500566_0000003 | 3300053094 | Bacteria | 166820 |
| 1532 | Ga0500571_000025 | 3300053110 | Bacteria | 52183 |
| 1533 | Ga0500572_002602 | 3300053111 | Bacteria | 4288 |
| 1534 | Ga0500595_002313 | 3300053119 | Bacteria | 9533 |
| 1535 | Ga0500607_053840 | 3300053121 | Bacteria | 2132 |
| 1536 | Ga0500608_003401 | 3300053122 | Bacteria | 5958 |
| 1537 | Ga0500608_077346 | 3300053122 | Bacteria | 1575 |
| 1538 | Ga0500618_004010 | 3300053125 | Bacteria | 4850 |
| 1539 | Ga0500658_0039107 | 3300053134 | Bacteria | 1893 |
| 1540 | Ga0500559_0001626 | 3300053136 | Bacteria | 12489 |
| 1541 | Ga0500559_0002366 | 3300053136 | Bacteria | 9829 |
| 1542 | Ga0500574_003346 | 3300053141 | Bacteria | 2818 |
| 1543 | Ga0500603_000184 | 3300053150 | Bacteria | 16166 |
| 1544 | Ga0500616_0000725 | 3300053153 | Bacteria | 38124 |
| 1545 | Ga0500630_001089 | 3300053159 | Bacteria | 12674 |
| 1546 | Ga0500634_0037391 | 3300053161 | Bacteria | 2640 |
| 1547 | Ga0500639_000033 | 3300053163 | Bacteria | 68969 |
| 1548 | Ga0500639_086147 | 3300053163 | Bacteria | 1573 |
| 1549 | Ga0500636_0000042 | 3300053177 | Bacteria | 69412 |
| 1550 | Ga0500637_0094416 | 3300053178 | Bacteria | 1733 |
| 1551 | Ga0500596_001686 | 3300053735 | Bacteria | 4475 |
| 1552 | Ga0500596_004563 | 3300053735 | Bacteria | 2527 |
| 1553 | Ga0500601_000553 | 3300053737 | Bacteria | 5521 |
| 1554 | Ga0501084_0047911 | 3300054114 | Bacteria | 3579 |
| 1555 | Ga0501084_0177745 | 3300054114 | Bacteria | 1797 |
| 1556 | Ga0501084_0190447 | 3300054114 | Bacteria | 1730 |
| 1557 | Ga0500661_004312 | 3300055283 | Bacteria | 2661 |
| 1558 | Ga0501082_0001125 | 3300060353 | Bacteria | 23645 |
| 1559 | Ga0501082_0011010 | 3300060353 | Bacteria | 7777 |
| 1560 | Ga0501082_0236387 | 3300060353 | Bacteria | 1590 |
| 1561 | Ga0530510_0000286 | 3300061734 | Bacteria | 32044 |
| 1562 | Ga0530510_0000862 | 3300061734 | Bacteria | 19989 |
| 1563 | Ga0530510_0067151 | 3300061734 | Bacteria | 2601 |
| 1564 | 2509148370 | 2508501128 | Bacteria | 8613869 |
| 1565 | 2511248212 | 2511231003 | Bacteria | 5606035 |
| 1566 | 2511252324 | 2511231003 | Bacteria | 5606035 |
| 1567 | 2513228504 | 2513020051 | Bacteria | 6053213 |
| 1568 | 2513622353 | 2513237092 | Bacteria | 8341956 |
| 1569 | 2513640530 | 2513237094 | Bacteria | 8789602 |
| 1570 | 2513645448 | 2513237095 | Bacteria | 8976980 |
| 1571 | 2513657153 | 2513237096 | Bacteria | 8722461 |
| 1572 | 2513693739 | 2513237101 | Bacteria | 7952346 |
| 1573 | 2513701716 | 2513237102 | Bacteria | 7703324 |
| 1574 | 2513863161 | 2513237137 | Bacteria | 9558895 |
| 1575 | 2513873134 | 2513237139 | Bacteria | 8737671 |
| 1576 | 2513892626 | 2513237141 | Bacteria | 8496279 |
| 1577 | 2513919161 | 2513237145 | Bacteria | 8979722 |
| 1578 | 2514016521 | 2513237161 | Bacteria | 8871253 |
| 1579 | 2517102627 | 2517093001 | Bacteria | 9002274 |
| 1580 | 2517891146 | 2517572143 | Bacteria | 9484767 |
| 1581 | 2524465597 | 2524023210 | Bacteria | 9029266 |
| 1582 | 2524533670 | 2524023228 | Bacteria | 10118060 |
| 1583 | 2528848702 | 2528768022 | Bacteria | 10457665 |
| 1584 | 2550697506 | 2548876994 | Bacteria | 4904866 |
| 1585 | 2553003411 | 2551306416 | Bacteria | 6152985 |
| 1586 | 2587755956 | 2585428062 | Bacteria | 6842168 |
| 1587 | 2617346997 | 2617270735 | Bacteria | 9163226 |
| 1588 | 2643864154 | 2643221570 | Bacteria | 5103772 |
| 1589 | 2643981047 | 2643221594 | Bacteria | 5811388 |
| 1590 | 2643992454 | 2643221596 | Bacteria | 5006805 |
| 1591 | 2644029503 | 2643221603 | Bacteria | 6147767 |
| 1592 | 2644163353 | 2643221628 | Bacteria | 5745828 |
| 1593 | 2644292143 | 2643221652 | Bacteria | 5140275 |
| 1594 | 2644303104 | 2643221654 | Bacteria | 5273570 |
| 1595 | 2644305856 | 2643221654 | Bacteria | 5273570 |
| 1596 | 2644326638 | 2643221658 | Bacteria | 6064537 |
| 1597 | 2644396988 | 2643221672 | Bacteria | 6322190 |
| 1598 | 2644469340 | 2643221683 | Bacteria | 5749203 |
| 1599 | 2671123252 | 2667528175 | Bacteria | 7532676 |
| 1600 | 2723843482 | 2721755755 | Bacteria | 8322773 |
| 1601 | 2738724072 | 2738541277 | Bacteria | 7458140 |
| 1602 | 2738883437 | 2738541307 | Bacteria | 8606193 |
| 1603 | 2739247507 | 2738543013 | Bacteria | 5618633 |
| 1604 | 2739284757 | 2738543019 | Bacteria | 7459457 |
| 1605 | 2739610807 | 2739367655 | Bacteria | 4051151 |
| 1606 | 2793066489 | 2791355197 | Bacteria | 8420563 |
| 1607 | 2805914967 | 2802429603 | Bacteria | 8777136 |
| 1608 | 2809034915 | 2808606395 | Bacteria | 6020352 |
| 1609 | 2809131656 | 2808606415 | Bacteria | 4576710 |
| 1610 | 2809151278 | 2808606419 | Bacteria | 4576925 |
| 1611 | 2818239675 | 2816332527 | Bacteria | 8933356 |
| 1612 | 2819594133 | 2818991445 | Bacteria | 4955017 |
| 1613 | 2821450574 | 2821443989 | Bacteria | 7658172 |
| 1614 | 2824602357 | 2824600985 | Bacteria | 8488197 |
| 1615 | 2824610549 | 2824609381 | Bacteria | 8672835 |
| 1616 | 2824618109 | 2824617872 | Bacteria | 8814715 |
| 1617 | 2824626777 | 2824626560 | Bacteria | 8813858 |
| 1618 | 2824636588 | 2824635225 | Bacteria | 8785348 |
| 1619 | 2824645122 | 2824644064 | Bacteria | 8743947 |
| 1620 | 2824654326 | 2824653114 | Bacteria | 8493680 |
| 1621 | 2824661589 | 2824661429 | Bacteria | 9877870 |
| 1622 | 2824672038 | 2824671348 | Bacteria | 8369588 |
| 1623 | 2824679862 | 2824679649 | Bacteria | 8248951 |
| 1624 | 2824688637 | 2824687955 | Bacteria | 8360029 |
| 1625 | 2824697127 | 2824696289 | Bacteria | 8335049 |
| 1626 | 2824705091 | 2824704595 | Bacteria | 9667483 |
| 1627 | 2824715717 | 2824714736 | Bacteria | 8717648 |
| 1628 | 2824725200 | 2824723954 | Bacteria | 8758240 |
| 1629 | 2824754372 | 2824753945 | Bacteria | 9787441 |
| 1630 | 2824767871 | 2824763712 | Bacteria | 9792355 |
| 1631 | 2824775253 | 2824773399 | Bacteria | 8360218 |
| 1632 | 2834645881 | 2834641062 | Bacteria | 5559922 |
| 1633 | 2838123351 | 2838122688 | Bacteria | 8803140 |
| 1634 | 2841946645 | 2841941048 | Bacteria | 8688029 |
| 1635 | 2841954122 | 2841949485 | Bacteria | 8680857 |
| 1636 | 2841960975 | 2841957949 | Bacteria | 8652217 |
| 1637 | 2841969500 | 2841966195 | Bacteria | 8673214 |
| 1638 | 2841974616 | 2841974524 | Bacteria | 8931498 |
| 1639 | 2841983825 | 2841983080 | Bacteria | 8395090 |
| 1640 | 2842679386 | 2842677519 | Bacteria | 5615038 |
| 1641 | 2842738338 | 2842733646 | Bacteria | 5716726 |
| 1642 | 2842750554 | 2842747753 | Bacteria | 5578255 |
| 1643 | 2844319405 | 2844315083 | Bacteria | 8138177 |
| 1644 | 2847936581 | 2847930680 | Bacteria | 9342022 |
| 1645 | 2847946925 | 2847939898 | Bacteria | 8606328 |
| 1646 | 2849078964 | 2849076700 | Bacteria | 7039503 |
| 1647 | 2852622440 | 2852618963 | Bacteria | 4577824 |
| 1648 | 2857578439 | 2857576091 | Bacteria | 5465855 |
| 1649 | 2874611603 | 2874604998 | Bacteria | 7834745 |
| 1650 | 2874632268 | 2874628541 | Bacteria | 8630250 |
| 1651 | 2879088075 | 2879083081 | Bacteria | 8587928 |
| 1652 | 2879108342 | 2879099564 | Bacteria | 10442239 |
| 1653 | 2879117467 | 2879110137 | Bacteria | 8907982 |
| 1654 | 2881672533 | 2881665667 | Bacteria | 8175609 |
| 1655 | 2881929559 | 2881927736 | Bacteria | 3993927 |
| 1656 | 2884816086 | 2884811622 | Bacteria | 5552861 |
| 1657 | 2884839435 | 2884836552 | Bacteria | 5219991 |
| 1658 | 2884856755 | 2884852848 | Bacteria | 5221161 |
| 1659 | 2885193315 | 2885192300 | Bacteria | 5882526 |
| 1660 | 2885413317 | 2885409591 | Bacteria | 9235467 |
| 1661 | 2888384474 | 2888378607 | Bacteria | 9652610 |
| 1662 | 2888393436 | 2888388044 | Bacteria | 7304136 |
| 1663 | 2888424924 | 2888419890 | Bacteria | 7857137 |
| 1664 | 2894023396 | 2894023352 | Bacteria | 5167372 |
| 1665 | 2896158101 | 2896154374 | Bacteria | 5221518 |
| 1666 | 2903734347 | 2903727486 | Bacteria | 8281579 |
| 1667 | 2903752233 | 2903748898 | Bacteria | 9972761 |
| 1668 | 2904435008 | 2904434214 | Bacteria | 6230908 |
| 1669 | 2904451537 | 2904449895 | Bacteria | 6927402 |
| 1670 | 2904458394 | 2904456579 | Bacteria | 6819253 |
| 1671 | 2904543190 | 2904541872 | Bacteria | 8915136 |
| 1672 | 2904698954 | 2904690495 | Bacteria | 9412302 |
| 1673 | 2904701025 | |||
| 1674 | 2904715095 | 2904711408 | Bacteria | 9771557 |
| 1675 | 2906605591 | 2906602504 | Bacteria | 8295279 |
| 1676 | 2906616326 | |||
| 1677 | 2906627163 | 2906626472 | Bacteria | 8826946 |
| 1678 | 2906641531 | 2906635258 | Bacteria | 8601019 |
| 1679 | 2906646195 | 2906643746 | Bacteria | 8722424 |
| 1680 | 2906662891 | 2906660503 | Bacteria | 8595048 |
| 1681 | 2908741466 | 2908739725 | Bacteria | 8628932 |
| 1682 | 2908758751 | 2908756301 | Bacteria | 8864324 |
| 1683 | 2919466499 | 2919462493 | Bacteria | 5817112 |
| 1684 | 2922361738 | 2922361189 | Bacteria | 7436256 |
| 1685 | 2922374886 | |||
| 1686 | 2922387012 | 2922386360 | Bacteria | 7017218 |
| 1687 | 2922400429 | 2922393267 | Bacteria | 8285685 |
| 1688 | 2922431676 | |||
| 1689 | 2923511539 | 2923510766 | Bacteria | 5926163 |
| 1690 | 2928090405 | 2928084124 | Bacteria | 7159212 |
| 1691 | 2929160424 | 2929160207 | Bacteria | 9075316 |
| 1692 | 2929524029 | 2929520902 | Bacteria | 6765052 |
| 1693 | 2929621930 | 2929615660 | Bacteria | 9193770 |
| 1694 | 2929629763 | 2929624759 | Bacteria | 9339455 |
| 1695 | 2932422932 | 2932422444 | Bacteria | 4678430 |
| 1696 | 2932788797 | 2932784394 | Bacteria | 9704911 |
| 1697 | 2932812771 | 2932809354 | Bacteria | 9135765 |
| 1698 | 2932819137 | 2932818245 | Bacteria | 9955613 |
| 1699 | 2932830463 | 2932828146 | Bacteria | 9745859 |
| 1700 | 2933583794 | 2933577622 | Bacteria | 9116884 |
| 1701 | 2935616757 | 2935616580 | Bacteria | 9032984 |
| 1702 | 2935635776 | 2935630451 | Bacteria | 8169952 |
| 1703 | 2935641913 | 2935638405 | Bacteria | 10015038 |
| 1704 | 2935673044 | 2935665750 | Bacteria | 9571747 |
| 1705 | 2935675849 | 2935675223 | Bacteria | 9928132 |
| 1706 | 2935685846 | 2935684952 | Bacteria | 9590419 |
| 1707 | 2935697908 | 2935694250 | Bacteria | 9291695 |
| 1708 | 2935705686 | 2935703347 | Bacteria | 10242284 |
| 1709 | 2935714398 | 2935713505 | Bacteria | 9608509 |
| 1710 | 2935725017 | 2935722832 | Bacteria | 9608746 |
| 1711 | 2935732624 | 2935732158 | Bacteria | 9706831 |
| 1712 | 2935742003 | 2935741537 | Bacteria | 9707219 |
| 1713 | 2935751811 | 2935750917 | Bacteria | 9590372 |
| 1714 | 2935765068 | 2935760218 | Bacteria | 9817913 |
| 1715 | 2935802664 | 2935801545 | Bacteria | 9301974 |
| 1716 | 2935813506 | 2935810662 | Bacteria | 9401221 |
| 1717 | 2935830080 | 2935827899 | Bacteria | 10038562 |
| 1718 | 2935837998 | 2935837841 | Bacteria | 9454360 |
| 1719 | 2935855381 | 2935855204 | Bacteria | 9035059 |
| 1720 | 2935867375 | 2935864058 | Bacteria | 9784707 |
| 1721 | 2935875806 | 2935873716 | Bacteria | 9632195 |
| 1722 | 2935996470 | 2935992306 | Bacteria | 9802711 |
| 1723 | 2936003750 | 2936002035 | Bacteria | 9362176 |
| 1724 | 2936042455 | 2936037263 | Bacteria | 9446081 |
| 1725 | 2939633593 | 2939631187 | Bacteria | 6118131 |
| 1726 | 2940557386 | 2940556831 | Bacteria | 9590747 |
| 1727 | 2941512387 | 2941507105 | Bacteria | 8166816 |
| 1728 | 2941520108 | 2941515067 | Bacteria | 8166720 |
| 1729 | 2941528257 | 2941523033 | Bacteria | 8169134 |
| 1730 | 2941539336 | 2941538514 | Bacteria | 9402094 |
| 1731 | 2945915454 | 2945909444 | Bacteria | 7065066 |
| 1732 | 2945950552 | 2945945610 | Bacteria | 5951079 |
| 1733 | 2945974815 | 2945972063 | Bacteria | 6086495 |
| 1734 | 2945989144 | 2945984333 | Bacteria | 7358892 |
| 1735 | 2954770014 | 2954767861 | Bacteria | 5535784 |
| 1736 | 2990714767 | 2990710928 | Bacteria | 5002431 |
| 1737 | 3005481475 | 3005474847 | Bacteria | 9259049 |
| 1738 | 3005484657 | 3005483717 | Bacteria | 7877331 |
| 1739 | 3005510669 | 3005506211 | Bacteria | 6943378 |
| 1740 | 3005587692 | 3005587118 | Bacteria | 7794411 |
| 1741 | 3005599606 | 3005594810 | Bacteria | 8716512 |
| 1742 | 3005722643 | 3005718088 | Bacteria | 8283608 |
| 1743 | 8003405145 | 8003400568 | Bacteria | 5535898 |
| 1744 | 8006939242 | 8006933436 | Bacteria | 10410654 |
| 1745 | 8006966853 | 8006964411 | Bacteria | 8966052 |
| 1746 | 8006978900 | 8006973647 | Bacteria | 10679141 |
| 1747 | 8006994635 | 8006994254 | Bacteria | 8309700 |
| 1748 | 8016521830 | 8016511872 | Bacteria | 9921665 |
| 1749 | 8017063824 | 8017057580 | Bacteria | 10023680 |
| 1750 | 8019565101 | 8019555841 | Bacteria | 9642137 |
| 1751 | 8019575205 | 8019565922 | Bacteria | 9639779 |
| 1752 | 8019583172 | 8019576017 | Bacteria | 10049540 |
| 1753 | 8019618174 | 8019608314 | Bacteria | 10042931 |
| 1754 | 8019658927 | 8019648815 | Bacteria | 10014479 |
| 1755 | 8048749031 | 8048746797 | Bacteria | 3557226 |
| 1756 | 8055226651 | 8055225921 | Bacteria | 3341787 |
| 1757 | 8055745904 | 8055742211 | Bacteria | 9226248 |
| 1758 | 8056680897 | 8056673599 | Bacteria | 7871253 |
| 1759 | 8056690606 | 8056689827 | Bacteria | 6712655 |
| 1760 | 8056968394 | 8056967851 | Bacteria | 9038162 |
| 1761 | Ga0105238_10000770 | |||
| 1762 | JGI25155J39150_1000348 | |||
| 1763 | JGI25155J39150_1000397 | |||
| 1764 | JGI25156J39149_1000039 | |||
| 1765 | JGI25154J39366_1000059 | |||
| 1766 | JGI25154J39366_1000162 | |||
| 1767 | JGI25157J39369_1000057 | |||
| 1768 | JGI25152J39213_1003210 | |||
| 1769 | JGI25150J39212_1001186 | |||
| 1770 | JGI25159J45721_1000497 | |||
| 1771 | JGI25159J45721_1003112 | |||
| 1772 | JGI25159J45721_1017927 | |||
| 1773 | JGI25151J46595_10001481 | |||
| 1774 | JGI25151J46595_10004147 | |||
| 1775 | JGI25151J46595_10004723 | |||
| 1776 | JGI25153J46596_10004260 | |||
| 1777 | JGI25153J46596_10006245 | |||
| 1778 | JGI25160J50197_1000228 | |||
| 1779 | JGI25160J50197_1004539 | |||
| 1780 | JGI25161J50226_1000171 | |||
| 1781 | JGI25161J50226_1006232 | |||
| 1782 | Ga0006562J51391_1036868 | |||
| 1783 | JGI25404J52841_10007941 | |||
| 1784 | JGI25404J52841_10009477 | |||
| 1785 | Ga0055532_1000018 | |||
| 1786 | Ga0055535_1008422 | |||
| 1787 | Ga0055526_1007445 | |||
| 1788 | Ga0055537_1001030 | |||
| 1789 | Ga0055537_1001074 | |||
| 1790 | Ga0055537_1002754 | |||
| 1791 | Ga0055524_1005449 | |||
| 1792 | Ga0055536_1000981 | |||
| 1793 | Ga0055536_1003501 | |||
| 1794 | Ga0055536_1021260 | |||
| 1795 | Ga0055534_1000371 | |||
| 1796 | Ga0055534_1002905 | |||
| 1797 | Ga0055528_1003578 | |||
| 1798 | Ga0055528_1014888 | |||
| 1799 | Ga0055530_10008883 | |||
| 1800 | Ga0055540_1014156 | |||
| 1801 | Ga0055531_10012862 | |||
| 1802 | Ga0055531_10024389 | |||
| 1803 | JGI25405J52794_10013526 | |||
| 1804 | Ga0055543_1001492 | |||
| 1805 | Ga0055543_1002183 | |||
| 1806 | Ga0055543_1002866 | |||
| 1807 | Ga0065165_1002034 | |||
| 1808 | Ga0065165_1002156 | |||
| 1809 | Ga0065165_1004137 | |||
| 1810 | Ga0065714_10029414 | |||
| 1811 | Ga0070658_10043586 | |||
| 1812 | Ga0070658_10202646 | |||
| 1813 | Ga0070676_10014784 | |||
| 1814 | Ga0070676_10021242 | |||
| 1815 | Ga0070683_100020403 | |||
| 1816 | Ga0070683_100080691 | |||
| 1817 | Ga0070690_100024193 | |||
| 1818 | Ga0070670_100006216 | |||
| 1819 | Ga0070670_100010932 | |||
| 1820 | Ga0070670_100020925 | |||
| 1821 | Ga0070670_100024850 | |||
| 1822 | Ga0070670_100026734 | |||
| 1823 | Ga0070670_100034308 | |||
| 1824 | Ga0070670_100097687 | |||
| 1825 | Ga0070670_100254077 | |||
| 1826 | Ga0068869_100001034 | |||
| 1827 | Ga0068869_100007415 | |||
| 1828 | Ga0070666_10005594 | |||
| 1829 | Ga0070666_10010734 | |||
| 1830 | Ga0070666_10064662 | |||
| 1831 | Ga0070680_100000789 | |||
| 1832 | Ga0070680_100019987 | |||
| 1833 | Ga0070680_100020435 | |||
| 1834 | Ga0070682_100025351 | |||
| 1835 | Ga0068868_100008066 | |||
| 1836 | Ga0068868_100009673 | |||
| 1837 | Ga0068868_100035445 | |||
| 1838 | Ga0068868_100058041 | |||
| 1839 | Ga0068868_100083366 | |||
| 1840 | Ga0068868_100176045 | |||
| 1841 | Ga0070660_100002643 | |||
| 1842 | Ga0070660_100012054 | |||
| 1843 | Ga0070660_100110595 | |||
| 1844 | Ga0070689_100002767 | |||
| 1845 | Ga0070691_10001775 | |||
| 1846 | Ga0070661_100001036 | |||
| 1847 | Ga0070661_100076907 | |||
| 1848 | Ga0070661_100086187 | |||
| 1849 | Ga0070692_10010384 | |||
| 1850 | Ga0070668_100005979 | |||
| 1851 | Ga0070668_100010299 | |||
| 1852 | Ga0070668_100046663 | |||
| 1853 | Ga0070668_100074690 | |||
| 1854 | Ga0070668_100160684 | |||
| 1855 | Ga0070669_100000706 | |||
| 1856 | Ga0070669_100002383 | |||
| 1857 | Ga0070669_100058804 | |||
| 1858 | Ga0070669_100100200 | |||
| 1859 | Ga0070675_100005756 | |||
| 1860 | Ga0070675_100006313 | |||
| 1861 | Ga0070675_100012135 | |||
| 1862 | Ga0070675_100014622 | |||
| 1863 | Ga0070675_100030287 | |||
| 1864 | Ga0070675_100361590 | |||
| 1865 | Ga0070671_100002238 | |||
| 1866 | Ga0070671_100011061 | |||
| 1867 | Ga0070671_100055325 | |||
| 1868 | Ga0070671_100056246 | |||
| 1869 | Ga0070671_100140698 | |||
| 1870 | Ga0070671_100152595 | |||
| 1871 | Ga0070674_100012268 | |||
| 1872 | Ga0070674_100110275 | |||
| 1873 | Ga0070673_100001120 | |||
| 1874 | Ga0070673_100002595 | |||
| 1875 | Ga0070673_100002922 | |||
| 1876 | Ga0070673_100007394 | |||
| 1877 | Ga0070673_100008204 | |||
| 1878 | Ga0070673_100028980 | |||
| 1879 | Ga0070673_100042964 | |||
| 1880 | Ga0070688_100022547 | |||
| 1881 | Ga0070659_100000182 | |||
| 1882 | Ga0070659_100193834 | |||
| 1883 | Ga0070659_100264107 | |||
| 1884 | Ga0070667_100004260 | |||
| 1885 | Ga0070667_100005889 | |||
| 1886 | Ga0070667_100073642 | |||
| 1887 | Ga0070667_100076324 | |||
| 1888 | Ga0070667_100105822 | |||
| 1889 | Ga0070667_100180403 | |||
| 1890 | Ga0070667_100184200 | |||
| 1891 | Ga0070667_100200102 | |||
| 1892 | Ga0070667_100208869 | |||
| 1893 | Ga0070709_10030069 | |||
| 1894 | Ga0070709_10125521 | |||
| 1895 | Ga0070714_100015456 | |||
| 1896 | Ga0070714_100053815 | |||
| 1897 | Ga0070713_100000097 | |||
| 1898 | Ga0070713_100018700 | |||
| 1899 | Ga0070713_100357050 | |||
| 1900 | Ga0070710_10003116 | |||
| 1901 | Ga0070710_10016099 | |||
| 1902 | Ga0070701_10027118 | |||
| 1903 | Ga0070711_100004189 | |||
| 1904 | Ga0070711_100026980 | |||
| 1905 | Ga0070711_100040688 | |||
| 1906 | Ga0070705_100001008 | |||
| 1907 | Ga0070705_100002250 | |||
| 1908 | Ga0070700_100000507 | |||
| 1909 | Ga0070700_100009539 | |||
| 1910 | Ga0070700_100139578 | |||
| 1911 | Ga0070694_100001273 | |||
| 1912 | Ga0070694_100023987 | |||
| 1913 | Ga0070694_100036132 | |||
| 1914 | Ga0070708_100036981 | |||
| 1915 | Ga0070708_100047590 | |||
| 1916 | Ga0070663_100007054 | |||
| 1917 | Ga0070663_100012111 | |||
| 1918 | Ga0070663_100028572 | |||
| 1919 | Ga0070663_100041202 | |||
| 1920 | Ga0070663_100048993 | |||
| 1921 | Ga0070663_100110399 | |||
| 1922 | Ga0070678_100001572 | |||
| 1923 | Ga0070678_100062917 | |||
| 1924 | Ga0070678_100075042 | |||
| 1925 | Ga0070678_100103116 | |||
| 1926 | Ga0070662_100000120 | |||
| 1927 | Ga0070662_100025661 | |||
| 1928 | Ga0070662_100045286 | |||
| 1929 | Ga0070662_100173022 | |||
| 1930 | Ga0070681_10000235 | |||
| 1931 | Ga0070681_10052911 | |||
| 1932 | Ga0070681_10098937 | |||
| 1933 | Ga0070681_10163907 | |||
| 1934 | Ga0070681_10189790 | |||
| 1935 | Ga0068867_100000699 | |||
| 1936 | Ga0068867_100001479 | |||
| 1937 | Ga0068867_100022330 | |||
| 1938 | Ga0068867_100031990 | |||
| 1939 | Ga0068867_100042529 | |||
| 1940 | Ga0070685_10068444 | |||
| 1941 | Ga0070706_100005279 | |||
| 1942 | Ga0070706_100026812 | |||
| 1943 | Ga0070706_100065693 | |||
| 1944 | Ga0070706_100160570 | |||
| 1945 | Ga0070707_100014058 | |||
| 1946 | Ga0070707_100172193 | |||
| 1947 | Ga0070707_100231857 | |||
| 1948 | Ga0070698_100000346 | |||
| 1949 | Ga0070698_100030448 | |||
| 1950 | Ga0070699_100008587 | |||
| 1951 | Ga0070699_100097488 | |||
| 1952 | Ga0070679_100008198 | |||
| 1953 | Ga0070679_100067454 | |||
| 1954 | Ga0070679_100138837 | |||
| 1955 | Ga0070679_100243192 | |||
| 1956 | Ga0070684_100012356 | |||
| 1957 | Ga0070684_100053346 | |||
| 1958 | Ga0070684_100100932 | |||
| 1959 | Ga0070697_100038951 | |||
| 1960 | Ga0070697_100080330 | |||
| 1961 | Ga0068853_100001080 | |||
| 1962 | Ga0068853_100012124 | |||
| 1963 | Ga0068853_100065882 | |||
| 1964 | Ga0068853_100148707 | |||
| 1965 | Ga0068853_100249045 | |||
| 1966 | Ga0068853_100289906 | |||
| 1967 | Ga0070672_100008837 | |||
| 1968 | Ga0070672_100011179 | |||
| 1969 | Ga0070672_100012802 | |||
| 1970 | Ga0070672_100033629 | |||
| 1971 | Ga0070672_100035679 | |||
| 1972 | Ga0070672_100044056 | |||
| 1973 | Ga0070672_100124753 | |||
| 1974 | Ga0070672_100136229 | |||
| 1975 | Ga0070686_100000451 | |||
| 1976 | Ga0070695_100000113 | |||
| 1977 | Ga0070695_100004445 | |||
| 1978 | Ga0070695_100059389 | |||
| 1979 | Ga0070695_100100914 | |||
| 1980 | Ga0070696_100001794 | |||
| 1981 | Ga0070696_100029810 | |||
| 1982 | Ga0070693_100006920 | |||
| 1983 | Ga0070665_100002511 | |||
| 1984 | Ga0070665_100005013 | |||
| 1985 | Ga0070665_100020157 | |||
| 1986 | Ga0070665_100024935 | |||
| 1987 | Ga0070665_100054839 | |||
| 1988 | Ga0070665_100083512 | |||
| 1989 | Ga0070665_100090011 | |||
| 1990 | Ga0070665_100259817 | |||
| 1991 | Ga0070704_100001744 | |||
| 1992 | Ga0070704_100031607 | |||
| 1993 | Ga0070704_100104705 | |||
| 1994 | Ga0068855_100003059 | |||
| 1995 | Ga0068855_100004880 | |||
| 1996 | Ga0068855_100044092 | |||
| 1997 | Ga0068855_100116191 | |||
| 1998 | Ga0068855_100133255 | |||
| 1999 | Ga0070664_100000226 | |||
| 2000 | Ga0070664_100006946 | |||
| 2001 | Ga0070664_100008588 | |||
| 2002 | Ga0070664_100068450 | |||
| 2003 | Ga0070664_100082392 | |||
| 2004 | Ga0070664_100093702 | |||
| 2005 | Ga0070664_100205357 | |||
| 2006 | Ga0068857_100009219 | |||
| 2007 | Ga0068857_100012359 | |||
| 2008 | Ga0068857_100017621 | |||
| 2009 | Ga0068854_100004976 | |||
| 2010 | Ga0068854_100091425 | |||
| 2011 | Ga0068856_100002965 | |||
| 2012 | Ga0068856_100004533 | |||
| 2013 | Ga0068856_100006452 | |||
| 2014 | Ga0068856_100034528 | |||
| 2015 | Ga0068856_100035978 | |||
| 2016 | Ga0068856_100046152 | |||
| 2017 | Ga0068856_100060037 | |||
| 2018 | Ga0068856_100108343 | |||
| 2019 | Ga0068856_100132592 | |||
| 2020 | Ga0068856_100197998 | |||
| 2021 | Ga0068856_100204117 | |||
| 2022 | Ga0068856_100342019 | |||
| 2023 | Ga0070702_100000240 | |||
| 2024 | Ga0070702_100108560 | |||
| 2025 | Ga0068852_100000458 | |||
| 2026 | Ga0068852_100002866 | |||
| 2027 | Ga0068852_100003345 | |||
| 2028 | Ga0068852_100044052 | |||
| 2029 | Ga0068852_100050792 | |||
| 2030 | Ga0068852_100361619 | |||
| 2031 | Ga0068859_100001046 | |||
| 2032 | Ga0068859_100004628 | |||
| 2033 | Ga0068859_100005100 | |||
| 2034 | Ga0068859_100011777 | |||
| 2035 | Ga0068859_100131360 | |||
| 2036 | Ga0068859_100371126 | |||
| 2037 | Ga0068859_100432532 | |||
| 2038 | Ga0068864_100001845 | |||
| 2039 | Ga0068864_100006755 | |||
| 2040 | Ga0068864_100033625 | |||
| 2041 | Ga0068864_100060757 | |||
| 2042 | Ga0068864_100100205 | |||
| 2043 | Ga0068866_10000744 | |||
| 2044 | Ga0068866_10022984 | |||
| 2045 | Ga0068861_100000550 | |||
| 2046 | Ga0068861_100009710 | |||
| 2047 | Ga0068861_100011045 | |||
| 2048 | Ga0068861_100012089 | |||
| 2049 | Ga0068861_100016696 | |||
| 2050 | Ga0068861_100197378 | |||
| 2051 | Ga0068851_10004220 | |||
| 2052 | Ga0068870_10014703 | |||
| 2053 | Ga0068863_100003310 | |||
| 2054 | Ga0068863_100004932 | |||
| 2055 | Ga0068863_100024146 | |||
| 2056 | Ga0068863_100026315 | |||
| 2057 | Ga0068863_100056419 | |||
| 2058 | Ga0068863_100162307 | |||
| 2059 | Ga0068858_100001886 | |||
| 2060 | Ga0068858_100009824 | |||
| 2061 | Ga0068858_100054622 | |||
| 2062 | Ga0068858_100059335 | |||
| 2063 | Ga0068858_100115612 | |||
| 2064 | Ga0068860_100000995 | |||
| 2065 | Ga0068860_100002455 | |||
| 2066 | Ga0068860_100004676 | |||
| 2067 | Ga0068860_100006826 | |||
| 2068 | Ga0068860_100011997 | |||
| 2069 | Ga0068860_100017959 | |||
| 2070 | Ga0068860_100027734 | |||
| 2071 | Ga0068860_100043605 | |||
| 2072 | Ga0068862_100001897 | |||
| 2073 | Ga0068862_100007683 | |||
| 2074 | Ga0068862_100011352 | |||
| 2075 | Ga0068862_100018082 | |||
| 2076 | Ga0068862_100023649 | |||
| 2077 | Ga0068862_100048060 | |||
| 2078 | Ga0068862_100060608 | |||
| 2079 | Ga0068862_100062934 | |||
| 2080 | Ga0068862_100070581 | |||
| 2081 | Ga0081455_10002128 | |||
| 2082 | Ga0081455_10005931 | |||
| 2083 | Ga0081455_10007164 | |||
| 2084 | Ga0081455_10008105 | |||
| 2085 | Ga0081455_10056129 | |||
| 2086 | Ga0081455_10067942 | |||
| 2087 | Ga0081538_10062089 | |||
| 2088 | Ga0081540_1008063 | |||
| 2089 | Ga0081540_1010718 | |||
| 2090 | Ga0081540_1011457 | |||
| 2091 | Ga0081540_1027323 | |||
| 2092 | Ga0081540_1081211 | |||
| 2093 | Ga0081539_10000199 | |||
| 2094 | Ga0081539_10008807 | |||
| 2095 | Ga0081539_10035474 | |||
| 2096 | Ga0070717_10226606 | |||
| 2097 | Ga0075365_10081210 | |||
| 2098 | Ga0075365_10120135 | |||
| 2099 | Ga0075368_10049277 | |||
| 2100 | Ga0075363_100033317 | |||
| 2101 | Ga0075363_100038226 | |||
| 2102 | Ga0075364_10000449 | |||
| 2103 | Ga0075364_10001306 | |||
| 2104 | Ga0075364_10041388 | |||
| 2105 | Ga0075364_10041828 | |||
| 2106 | Ga0075432_10004252 | |||
| 2107 | Ga0070715_10007524 | |||
| 2108 | Ga0070716_100025770 | |||
| 2109 | Ga0070712_100005468 | |||
| 2110 | Ga0070712_100025225 | |||
| 2111 | Ga0075362_10007655 | |||
| 2112 | Ga0075362_10017916 | |||
| 2113 | Ga0075362_10036312 | |||
| 2114 | Ga0075367_10022998 | |||
| 2115 | Ga0075367_10058895 | |||
| 2116 | Ga0075367_10091962 | |||
| 2117 | Ga0075369_10039228 | |||
| 2118 | Ga0075366_10003108 | |||
| 2119 | Ga0075366_10020960 | |||
| 2120 | Ga0075366_10034499 | |||
| 2121 | Ga0075366_10048359 | |||
| 2122 | Ga0075366_10090760 | |||
| 2123 | Ga0075366_10101532 | |||
| 2124 | Ga0097621_100181066 | |||
| 2125 | Ga0097621_100235597 | |||
| 2126 | Ga0097621_100362827 | |||
| 2127 | Ga0075370_10016491 | |||
| 2128 | Ga0075370_10016870 | |||
| 2129 | Ga0075370_10016996 | |||
| 2130 | Ga0075370_10039884 | |||
| 2131 | Ga0075370_10091130 | |||
| 2132 | Ga0075370_10107767 | |||
| 2133 | Ga0068871_100001073 | |||
| 2134 | Ga0068871_100026391 | |||
| 2135 | Ga0068871_100051176 | |||
| 2136 | Ga0068871_100101091 | |||
| 2137 | Ga0068871_100119593 | |||
| 2138 | Ga0068871_100126027 | |||
| 2139 | Ga0068871_100255065 | |||
| 2140 | Ga0075428_100001002 | |||
| 2141 | Ga0075428_100010339 | |||
| 2142 | Ga0075428_100018888 | |||
| 2143 | Ga0075428_100195292 | |||
| 2144 | Ga0075428_100410183 | |||
| 2145 | Ga0075430_100008058 | |||
| 2146 | Ga0075431_100000071 | |||
| 2147 | Ga0075431_100007105 | |||
| 2148 | Ga0075431_100046776 | |||
| 2149 | Ga0075431_100245954 | |||
| 2150 | Ga0075433_10100040 | |||
| 2151 | Ga0075434_100000004 | |||
| 2152 | Ga0075434_100001086 | |||
| 2153 | Ga0075434_100003417 | |||
| 2154 | Ga0075434_100081205 | |||
| 2155 | Ga0075434_100081590 | |||
| 2156 | Ga0075434_100123733 | |||
| 2157 | Ga0075429_100000051 | |||
| 2158 | Ga0075429_100009199 | |||
| 2159 | Ga0075429_100063395 | |||
| 2160 | Ga0068865_100001146 | |||
| 2161 | Ga0068865_100013695 | |||
| 2162 | Ga0068865_100043597 | |||
| 2163 | Ga0068865_100077454 | |||
| 2164 | Ga0068865_100197862 | |||
| 2165 | Ga0075436_100000331 | |||
| 2166 | Ga0075436_100031681 | |||
| 2167 | Ga0097620_100001046 | |||
| 2168 | Ga0097620_100004627 | |||
| 2169 | Ga0097620_100005100 | |||
| 2170 | Ga0097620_100011776 | |||
| 2171 | Ga0097620_100131360 | |||
| 2172 | Ga0097620_100371106 | |||
| 2173 | Ga0097620_100432534 | |||
| 2174 | Ga0099825_1027213 | |||
| 2175 | Ga0099824_1014858 | |||
| 2176 | Ga0099822_1003531 | |||
| 2177 | Ga0099826_10017935 | |||
| 2178 | Ga0075435_100000313 | |||
| 2179 | Ga0075435_100018126 | |||
| 2180 | Ga0075435_100028667 | |||
| 2181 | Ga0075435_100102689 | |||
| 2182 | Ga0075435_100118661 | |||
| 2183 | Ga0075435_100122701 | |||
| 2184 | Ga0075435_100239513 | |||
| 2185 | Ga0099794_10023907 | |||
| 2186 | Ga0105251_10025368 | |||
| 2187 | Ga0105244_10004646 | |||
| 2188 | Ga0105240_10000250 | |||
| 2189 | Ga0105240_10005077 | |||
| 2190 | Ga0105240_10005554 | |||
| 2191 | Ga0105240_10035358 | |||
| 2192 | Ga0105240_10167477 | |||
| 2193 | Ga0105240_10229755 | |||
| 2194 | Ga0105240_10318126 | |||
| 2195 | Ga0111539_10003132 | |||
| 2196 | Ga0111539_10010804 | |||
| 2197 | Ga0111539_10047411 | |||
| 2198 | Ga0111539_10052402 | |||
| 2199 | Ga0111539_10076125 | |||
| 2200 | Ga0111539_10113136 | |||
| 2201 | Ga0105245_10014889 | |||
| 2202 | Ga0105245_10054950 | |||
| 2203 | Ga0105247_10010424 | |||
| 2204 | Ga0105247_10027421 | |||
| 2205 | Ga0105247_10130989 | |||
| 2206 | Ga0114129_10000009 | |||
| 2207 | Ga0114129_10000337 | |||
| 2208 | Ga0114129_10120173 | |||
| 2209 | Ga0105243_10000915 | |||
| 2210 | Ga0105243_10001591 | |||
| 2211 | Ga0105243_10027411 | |||
| 2212 | Ga0105243_10137416 | |||
| 2213 | Ga0105243_10186934 | |||
| 2214 | Ga0105241_10002214 | |||
| 2215 | Ga0105241_10011671 | |||
| 2216 | Ga0105242_10000945 | |||
| 2217 | Ga0105242_10095819 | |||
| 2218 | Ga0105248_10004085 | |||
| 2219 | Ga0105248_10014014 | |||
| 2220 | Ga0105248_10036026 | |||
| 2221 | Ga0105237_10000806 | |||
| 2222 | Ga0105237_10037340 | |||
| 2223 | Ga0105237_10068354 | |||
| 2224 | Ga0105237_10083206 | |||
| 2225 | Ga0105237_10091804 | |||
| 2226 | Ga0105237_10112524 | |||
| 2227 | Ga0105237_10202255 | |||
| 2228 | Ga0105238_10014862 | |||
| 2229 | Ga0105238_10073324 | |||
| 2230 | Ga0105238_10077770 | |||
| 2231 | Ga0105249_10000975 | |||
| 2232 | Ga0105249_10006665 | |||
| 2233 | Ga0105249_10274324 | |||
| 2234 | Ga0105249_10313131 | |||
| 2235 | Ga0105249_10389405 | |||
| 2236 | Ga0105239_10000292 | |||
| 2237 | Ga0105239_10055870 | |||
| 2238 | Ga0105239_10065549 | |||
| 2239 | Ga0105239_10078771 | |||
| 2240 | Ga0105239_10099166 | |||
| 2241 | Ga0105239_10354637 | |||
| 2242 | Ga0105239_10419615 | |||
| 2243 | Ga0105246_10056261 | |||
| 2244 | Ga0105246_10093617 | |||
| 2245 | Ga0105246_10094888 | |||
| 2246 | Ga0105246_10181185 | |||
| 2247 | Ga0157373_10008298 | |||
| 2248 | Ga0157373_10009650 | |||
| 2249 | Ga0157373_10035104 | |||
| 2250 | Ga0157371_10000769 | |||
| 2251 | Ga0157370_10008286 | |||
| 2252 | Ga0157370_10008739 | |||
| 2253 | Ga0157370_10010979 | |||
| 2254 | Ga0157370_10012141 | |||
| 2255 | Ga0157370_10029684 | |||
| 2256 | Ga0157370_10056276 | |||
| 2257 | Ga0157370_10078446 | |||
| 2258 | Ga0157370_10176423 | |||
| 2259 | Ga0157369_10008103 | |||
| 2260 | Ga0157369_10044792 | |||
| 2261 | Ga0157369_10077758 | |||
| 2262 | Ga0157369_10156297 | |||
| 2263 | Ga0157369_10298009 | |||
| 2264 | Ga0157374_10001486 | |||
| 2265 | Ga0157374_10006780 | |||
| 2266 | Ga0157374_10046727 | |||
| 2267 | Ga0157374_10080670 | |||
| 2268 | Ga0157374_10356313 | |||
| 2269 | Ga0157378_10000844 | |||
| 2270 | Ga0157378_10079380 | |||
| 2271 | Ga0157378_10092014 | |||
| 2272 | Ga0157378_10192977 | |||
| 2273 | Ga0157378_10197493 | |||
| 2274 | Ga0163162_10005722 | |||
| 2275 | Ga0163162_10018632 | |||
| 2276 | Ga0163162_10074028 | |||
| 2277 | Ga0163162_10079077 | |||
| 2278 | Ga0163162_10140144 | |||
| 2279 | Ga0163162_10177704 | |||
| 2280 | Ga0163162_10251441 | |||
| 2281 | Ga0157372_10004681 | |||
| 2282 | Ga0157372_10006187 | |||
| 2283 | Ga0157372_10007871 | |||
| 2284 | Ga0157372_10024035 | |||
| 2285 | Ga0157372_10229700 | |||
| 2286 | Ga0157372_10360707 | |||
| 2287 | Ga0157375_10002482 | |||
| 2288 | Ga0157375_10021511 | |||
| 2289 | Ga0157375_10030198 | |||
| 2290 | Ga0157375_10031394 | |||
| 2291 | Ga0157375_10055972 | |||
| 2292 | Ga0157375_10073768 | |||
| 2293 | Ga0157375_10096977 | |||
| 2294 | Ga0157375_10373761 | |||
| 2295 | Ga0163163_10003555 | |||
| 2296 | Ga0163163_10007010 | |||
| 2297 | Ga0163163_10016615 | |||
| 2298 | Ga0163163_10028233 | |||
| 2299 | Ga0163163_10056064 | |||
| 2300 | Ga0163163_10103916 | |||
| 2301 | Ga0163163_10200477 | |||
| 2302 | Ga0157380_10002048 | |||
| 2303 | Ga0157380_10032105 | |||
| 2304 | Ga0157380_10032106 | |||
| 2305 | Ga0157380_10075159 | |||
| 2306 | Ga0157380_10093331 | |||
| 2307 | Ga0157380_10113689 | |||
| 2308 | Ga0182008_10021837 | |||
| 2309 | Ga0182008_10032465 | |||
| 2310 | Ga0182008_10049084 | |||
| 2311 | Ga0157377_10057796 | |||
| 2312 | Ga0157379_10000542 | |||
| 2313 | Ga0157379_10003892 | |||
| 2314 | Ga0157379_10045142 | |||
| 2315 | Ga0157379_10131429 | |||
| 2316 | Ga0157379_10151476 | |||
| 2317 | Ga0157379_10306548 | |||
| 2318 | Ga0157376_10010104 | |||
| 2319 | Ga0157376_10060761 | |||
| 2320 | Ga0157376_10065423 | |||
| 2321 | Ga0182006_1003114 | |||
| 2322 | Ga0183362_10004 | |||
| 2323 | Ga0163161_10000198 | |||
| 2324 | Ga0163161_10004824 | |||
| 2325 | Ga0163161_10054872 | |||
| 2326 | Ga0163161_10087527 | |||
| 2327 | Ga0163161_10103861 | |||
| 2328 | Ga0163161_10124173 | |||
| 2329 | Ga0163161_10131830 | |||
| 2330 | Ga0197907_11408047 | |||
| 2331 | Ga0213874_10027747 | |||
| 2332 | Ga0213876_10067981 | |||
| 2333 | Ga0213871_10004080 | |||
| 2334 | Ga0224712_10020465 | |||
| 2335 | Ga0209435_100007 | |||
| 2336 | Ga0209436_105003 | |||
| 2337 | Ga0209147_100017 | |||
| 2338 | Ga0209563_101866 | |||
| 2339 | Ga0209437_100272 | |||
| 2340 | Ga0209258_100297 | |||
| 2341 | Ga0207425_1000697 | |||
| 2342 | Ga0209646_1000061 | |||
| 2343 | Ga0209646_1000096 | |||
| 2344 | Ga0209026_1000052 | |||
| 2345 | Ga0209026_1002209 | |||
| 2346 | Ga0209677_102108 | |||
| 2347 | Ga0209677_105443 | |||
| 2348 | Ga0209148_1000500 | |||
| 2349 | Ga0209759_1000174 | |||
| 2350 | Ga0209759_1000537 | |||
| 2351 | Ga0209129_1000168 | |||
| 2352 | Ga0209129_1001716 | |||
| 2353 | Ga0209233_1001496 | |||
| 2354 | Ga0209233_1012236 | |||
| 2355 | Ga0209565_1000078 | |||
| 2356 | Ga0209565_1000350 | |||
| 2357 | Ga0209565_1000992 | |||
| 2358 | Ga0209455_1006056 | |||
| 2359 | Ga0209455_1009658 | |||
| 2360 | Ga0209673_1000516 | |||
| 2361 | Ga0209673_1000627 | |||
| 2362 | Ga0209673_1010584 | |||
| 2363 | Ga0209130_1000440 | |||
| 2364 | Ga0209130_1000798 | |||
| 2365 | Ga0209130_1001805 | |||
| 2366 | Ga0209130_1008121 | |||
| 2367 | Ga0209675_1000355 | |||
| 2368 | Ga0209675_1000916 | |||
| 2369 | Ga0209675_1000925 | |||
| 2370 | Ga0209675_1002231 | |||
| 2371 | Ga0209675_1005267 | |||
| 2372 | Ga0209676_1000312 | |||
| 2373 | Ga0209676_1000403 | |||
| 2374 | Ga0209676_1003118 | |||
| 2375 | Ga0209676_1041466 | |||
| 2376 | Ga0209025_1000242 | |||
| 2377 | Ga0209025_1000378 | |||
| 2378 | Ga0209025_1001004 | |||
| 2379 | Ga0209025_1065104 | |||
| 2380 | Ga0209564_1000157 | |||
| 2381 | Ga0209564_1006742 | |||
| 2382 | Ga0209758_1000042 | |||
| 2383 | Ga0209758_1002409 | |||
| 2384 | Ga0209758_1012843 | |||
| 2385 | Ga0209050_1001555 | |||
| 2386 | Ga0209050_1002543 | |||
| 2387 | Ga0209256_1000724 | |||
| 2388 | Ga0209256_1035123 | |||
| 2389 | Ga0207426_1000055 | |||
| 2390 | Ga0207426_1000238 | |||
| 2391 | Ga0207426_1000428 | |||
| 2392 | Ga0207426_1002351 | |||
| 2393 | Ga0207426_1030684 | |||
| 2394 | Ga0207426_1037474 | |||
| 2395 | Ga0209051_1000286 | |||
| 2396 | Ga0209051_1000376 | |||
| 2397 | Ga0209051_1000655 | |||
| 2398 | Ga0209051_1005994 | |||
| 2399 | Ga0209051_1007305 | |||
| 2400 | Ga0209257_1000215 | |||
| 2401 | Ga0209257_1002370 | |||
| 2402 | Ga0209257_1011096 | |||
| 2403 | Ga0209257_1012170 | |||
| 2404 | Ga0209257_1022478 | |||
| 2405 | Ga0209257_1023675 | |||
| 2406 | Ga0207697_10014602 | |||
| 2407 | Ga0207697_10029265 | |||
| 2408 | Ga0207656_10016183 | |||
| 2409 | Ga0207655_1003433 | |||
| 2410 | Ga0207713_1016034 | |||
| 2411 | Ga0207682_10012567 | |||
| 2412 | Ga0207692_10000845 | |||
| 2413 | Ga0207692_10004717 | |||
| 2414 | Ga0207642_10008441 | |||
| 2415 | Ga0207642_10105054 | |||
| 2416 | Ga0207688_10072893 | |||
| 2417 | Ga0207680_10048692 | |||
| 2418 | Ga0207680_10050541 | |||
| 2419 | Ga0207647_10006516 | |||
| 2420 | Ga0207647_10045018 | |||
| 2421 | Ga0207685_10004501 | |||
| 2422 | Ga0207699_10004348 | |||
| 2423 | Ga0207699_10008314 | |||
| 2424 | Ga0207645_10000187 | |||
| 2425 | Ga0207645_10000236 | |||
| 2426 | Ga0207645_10037265 | |||
| 2427 | Ga0207645_10088550 | |||
| 2428 | Ga0207645_10109515 | |||
| 2429 | Ga0207643_10022515 | |||
| 2430 | Ga0207643_10068297 | |||
| 2431 | Ga0207654_10007014 | |||
| 2432 | Ga0207654_10014569 | |||
| 2433 | Ga0207654_10122401 | |||
| 2434 | Ga0207707_10007114 | |||
| 2435 | Ga0207707_10007388 | |||
| 2436 | Ga0207707_10017925 | |||
| 2437 | Ga0207707_10068237 | |||
| 2438 | Ga0207695_10000008 | |||
| 2439 | Ga0207695_10000615 | |||
| 2440 | Ga0207695_10025000 | |||
| 2441 | Ga0207695_10049084 | |||
| 2442 | Ga0207695_10099403 | |||
| 2443 | Ga0207695_10159680 | |||
| 2444 | Ga0207695_10167863 | |||
| 2445 | Ga0207695_10216393 | |||
| 2446 | Ga0207695_10241549 | |||
| 2447 | Ga0207671_10011165 | |||
| 2448 | Ga0207671_10030267 | |||
| 2449 | Ga0207671_10048900 | |||
| 2450 | Ga0207671_10056947 | |||
| 2451 | Ga0207693_10001388 | |||
| 2452 | Ga0207693_10002380 | |||
| 2453 | Ga0207693_10019236 | |||
| 2454 | Ga0207693_10236822 | |||
| 2455 | Ga0207663_10000515 | |||
| 2456 | Ga0207663_10043229 | |||
| 2457 | Ga0207663_10124966 | |||
| 2458 | Ga0207660_10012876 | |||
| 2459 | Ga0207660_10035751 | |||
| 2460 | Ga0207660_10042551 | |||
| 2461 | Ga0207660_10047995 | |||
| 2462 | Ga0207660_10090458 | |||
| 2463 | Ga0207662_10000233 | |||
| 2464 | Ga0207657_10000102 | |||
| 2465 | Ga0207657_10000250 | |||
| 2466 | Ga0207657_10004866 | |||
| 2467 | Ga0207657_10007662 | |||
| 2468 | Ga0207657_10020898 | |||
| 2469 | Ga0207657_10036021 | |||
| 2470 | Ga0207657_10062444 | |||
| 2471 | Ga0207657_10066317 | |||
| 2472 | Ga0207649_10030080 | |||
| 2473 | Ga0207652_10003521 | |||
| 2474 | Ga0207652_10007056 | |||
| 2475 | Ga0207652_10196633 | |||
| 2476 | Ga0207646_10068594 | |||
| 2477 | Ga0207646_10153213 | |||
| 2478 | Ga0207646_10185421 | |||
| 2479 | Ga0207646_10321466 | |||
| 2480 | Ga0207681_10001251 | |||
| 2481 | Ga0207681_10005840 | |||
| 2482 | Ga0207681_10028920 | |||
| 2483 | Ga0207681_10046404 | |||
| 2484 | Ga0207681_10074720 | |||
| 2485 | Ga0207681_10265589 | |||
| 2486 | Ga0207694_10055785 | |||
| 2487 | Ga0207694_10066581 | |||
| 2488 | Ga0207694_10332411 | |||
| 2489 | Ga0207650_10005839 | |||
| 2490 | Ga0207650_10015099 | |||
| 2491 | Ga0207650_10018209 | |||
| 2492 | Ga0207650_10036293 | |||
| 2493 | Ga0207659_10005194 | |||
| 2494 | Ga0207659_10017441 | |||
| 2495 | Ga0207659_10017845 | |||
| 2496 | Ga0207659_10030124 | |||
| 2497 | Ga0207659_10074910 | |||
| 2498 | Ga0207687_10000552 | |||
| 2499 | Ga0207687_10002722 | |||
| 2500 | Ga0207687_10019251 | |||
| 2501 | Ga0207687_10030964 | |||
| 2502 | Ga0207687_10033203 | |||
| 2503 | Ga0207687_10174019 | |||
| 2504 | Ga0207700_10000062 | |||
| 2505 | Ga0207700_10027270 | |||
| 2506 | Ga0207700_10036858 | |||
| 2507 | Ga0207700_10173653 | |||
| 2508 | Ga0207664_10001592 | |||
| 2509 | Ga0207664_10008636 | |||
| 2510 | Ga0207664_10023886 | |||
| 2511 | Ga0207664_10081537 | |||
| 2512 | Ga0207644_10008758 | |||
| 2513 | Ga0207644_10009820 | |||
| 2514 | Ga0207644_10026050 | |||
| 2515 | Ga0207644_10034755 | |||
| 2516 | Ga0207644_10089922 | |||
| 2517 | Ga0207644_10124426 | |||
| 2518 | Ga0207690_10001799 | |||
| 2519 | Ga0207690_10182296 | |||
| 2520 | Ga0207690_10237399 | |||
| 2521 | Ga0207706_10000095 | |||
| 2522 | Ga0207706_10015953 | |||
| 2523 | Ga0207706_10027452 | |||
| 2524 | Ga0207706_10030841 | |||
| 2525 | Ga0207706_10118637 | |||
| 2526 | Ga0207706_10165670 | |||
| 2527 | Ga0207686_10000989 | |||
| 2528 | Ga0207709_10000092 | |||
| 2529 | Ga0207709_10001455 | |||
| 2530 | Ga0207709_10006663 | |||
| 2531 | Ga0207709_10060202 | |||
| 2532 | Ga0207670_10003492 | |||
| 2533 | Ga0207669_10003427 | |||
| 2534 | Ga0207669_10006265 | |||
| 2535 | Ga0207704_10000547 | |||
| 2536 | Ga0207704_10002119 | |||
| 2537 | Ga0207704_10042711 | |||
| 2538 | Ga0207665_10011003 | |||
| 2539 | Ga0207665_10015264 | |||
| 2540 | Ga0207665_10044837 | |||
| 2541 | Ga0207665_10160962 | |||
| 2542 | Ga0207691_10000305 | |||
| 2543 | Ga0207691_10001872 | |||
| 2544 | Ga0207691_10006614 | |||
| 2545 | Ga0207691_10007383 | |||
| 2546 | Ga0207691_10008924 | |||
| 2547 | Ga0207691_10022644 | |||
| 2548 | Ga0207691_10030534 | |||
| 2549 | Ga0207691_10030672 | |||
| 2550 | Ga0207691_10046211 | |||
| 2551 | Ga0207691_10056047 | |||
| 2552 | Ga0207691_10087765 | |||
| 2553 | Ga0207691_10159818 | |||
| 2554 | Ga0207691_10198110 | |||
| 2555 | Ga0207711_10001126 | |||
| 2556 | Ga0207711_10020916 | |||
| 2557 | Ga0207711_10050804 | |||
| 2558 | Ga0207689_10002282 | |||
| 2559 | Ga0207689_10002780 | |||
| 2560 | Ga0207689_10004782 | |||
| 2561 | Ga0207689_10020951 | |||
| 2562 | Ga0207689_10025866 | |||
| 2563 | Ga0207689_10069380 | |||
| 2564 | Ga0207689_10121118 | |||
| 2565 | Ga0207679_10016304 | |||
| 2566 | Ga0207679_10107154 | |||
| 2567 | Ga0207679_10152752 | |||
| 2568 | Ga0207679_10260121 | |||
| 2569 | Ga0207667_10004358 | |||
| 2570 | Ga0207667_10009599 | |||
| 2571 | Ga0207667_10017754 | |||
| 2572 | Ga0207667_10073105 | |||
| 2573 | Ga0207667_10089507 | |||
| 2574 | Ga0207667_10101035 | |||
| 2575 | Ga0207667_10152756 | |||
| 2576 | Ga0207667_10174570 | |||
| 2577 | Ga0207651_10002756 | |||
| 2578 | Ga0207651_10018649 | |||
| 2579 | Ga0207651_10032573 | |||
| 2580 | Ga0207651_10033399 | |||
| 2581 | Ga0207651_10037613 | |||
| 2582 | Ga0207651_10113146 | |||
| 2583 | Ga0207651_10172911 | |||
| 2584 | Ga0207651_10240589 | |||
| 2585 | Ga0207712_10002814 | |||
| 2586 | Ga0207712_10151136 | |||
| 2587 | Ga0207668_10005820 | |||
| 2588 | Ga0207668_10007591 | |||
| 2589 | Ga0207668_10011214 | |||
| 2590 | Ga0207668_10019431 | |||
| 2591 | Ga0207668_10050285 | |||
| 2592 | Ga0207668_10082183 | |||
| 2593 | Ga0207668_10102095 | |||
| 2594 | Ga0207668_10121507 | |||
| 2595 | Ga0207640_10035942 | |||
| 2596 | Ga0207640_10054084 | |||
| 2597 | Ga0207640_10059190 | |||
| 2598 | Ga0207640_10083649 | |||
| 2599 | Ga0207658_10004062 | |||
| 2600 | Ga0207658_10013833 | |||
| 2601 | Ga0207658_10146753 | |||
| 2602 | Ga0207677_10000926 | |||
| 2603 | Ga0207677_10005445 | |||
| 2604 | Ga0207677_10006472 | |||
| 2605 | Ga0207677_10010738 | |||
| 2606 | Ga0207677_10031143 | |||
| 2607 | Ga0207703_10000552 | |||
| 2608 | Ga0207703_10001501 | |||
| 2609 | Ga0207703_10016718 | |||
| 2610 | Ga0207703_10077643 | |||
| 2611 | Ga0207639_10044654 | |||
| 2612 | Ga0207639_10045118 | |||
| 2613 | Ga0207639_10048208 | |||
| 2614 | Ga0207639_10074437 | |||
| 2615 | Ga0207639_10139600 | |||
| 2616 | Ga0207639_10228656 | |||
| 2617 | Ga0207678_10020643 | |||
| 2618 | Ga0207678_10036306 | |||
| 2619 | Ga0207678_10094994 | |||
| 2620 | Ga0207678_10099182 | |||
| 2621 | Ga0207708_10002518 | |||
| 2622 | Ga0207708_10004176 | |||
| 2623 | Ga0207708_10082165 | |||
| 2624 | Ga0207702_10001309 | |||
| 2625 | Ga0207702_10021617 | |||
| 2626 | Ga0207702_10025993 | |||
| 2627 | Ga0207702_10062465 | |||
| 2628 | Ga0207702_10089750 | |||
| 2629 | Ga0207702_10169036 | |||
| 2630 | Ga0207641_10010854 | |||
| 2631 | Ga0207641_10040599 | |||
| 2632 | Ga0207641_10050538 | |||
| 2633 | Ga0207641_10050730 | |||
| 2634 | Ga0207641_10065372 | |||
| 2635 | Ga0207641_10074094 | |||
| 2636 | Ga0207641_10132086 | |||
| 2637 | Ga0207641_10264493 | |||
| 2638 | Ga0207648_10002355 | |||
| 2639 | Ga0207648_10004793 | |||
| 2640 | Ga0207648_10008777 | |||
| 2641 | Ga0207648_10012840 | |||
| 2642 | Ga0207648_10013617 | |||
| 2643 | Ga0207648_10014379 | |||
| 2644 | Ga0207648_10023176 | |||
| 2645 | Ga0207648_10033406 | |||
| 2646 | Ga0207648_10074787 | |||
| 2647 | Ga0207648_10147770 | |||
| 2648 | Ga0207648_10334233 | |||
| 2649 | Ga0207676_10001004 | |||
| 2650 | Ga0207676_10006584 | |||
| 2651 | Ga0207676_10029335 | |||
| 2652 | Ga0207676_10032673 | |||
| 2653 | Ga0207676_10039828 | |||
| 2654 | Ga0207676_10061120 | |||
| 2655 | Ga0207676_10149817 | |||
| 2656 | Ga0207676_10181790 | |||
| 2657 | Ga0207674_10000131 | |||
| 2658 | Ga0207674_10000326 | |||
| 2659 | Ga0207674_10007985 | |||
| 2660 | Ga0207674_10017015 | |||
| 2661 | Ga0207674_10018761 | |||
| 2662 | Ga0207674_10101788 | |||
| 2663 | Ga0207674_10108501 | |||
| 2664 | Ga0207675_100001604 | |||
| 2665 | Ga0207675_100003012 | |||
| 2666 | Ga0207675_100003839 | |||
| 2667 | Ga0207675_100005164 | |||
| 2668 | Ga0207675_100063462 | |||
| 2669 | Ga0207675_100144245 | |||
| 2670 | Ga0207675_100265152 | |||
| 2671 | Ga0207683_10000012 | |||
| 2672 | Ga0207683_10001281 | |||
| 2673 | Ga0207683_10001607 | |||
| 2674 | Ga0207683_10003558 | |||
| 2675 | Ga0207683_10024843 | |||
| 2676 | Ga0207683_10025806 | |||
| 2677 | Ga0207683_10070414 | |||
| 2678 | Ga0207683_10083926 | |||
| 2679 | Ga0207683_10182154 | |||
| 2680 | Ga0207698_10010991 | |||
| 2681 | Ga0207698_10023151 | |||
| 2682 | Ga0207698_10024354 | |||
| 2683 | Ga0207698_10035244 | |||
| 2684 | Ga0207698_10075023 | |||
| 2685 | Ga0209389_1000107 | |||
| 2686 | Ga0209389_1002563 | |||
| 2687 | Ga0209589_1000011 | |||
| 2688 | Ga0209589_1000036 | |||
| 2689 | Ga0209969_1005608 | |||
| 2690 | Ga0209489_100006 | |||
| 2691 | Ga0209489_100012 | |||
| 2692 | Ga0209489_115889 | |||
| 2693 | Ga0209489_115890 | |||
| 2694 | Ga0209700_100005 | |||
| 2695 | Ga0209700_100019 | |||
| 2696 | Ga0209967_1000511 | |||
| 2697 | Ga0209981_1001823 | |||
| 2698 | Ga0210000_1002564 | |||
| 2699 | Ga0209995_1001143 | |||
| 2700 | Ga0209968_1003859 | |||
| 2701 | Ga0209999_1001594 | |||
| 2702 | Ga0209999_1012519 | |||
| 2703 | Ga0209282_1021775 | |||
| 2704 | Ga0209971_1003964 | |||
| 2705 | Ga0209813_10010027 | |||
| 2706 | Ga0209974_10000445 | |||
| 2707 | Ga0207428_10000610 | |||
| 2708 | Ga0207428_10006909 | |||
| 2709 | Ga0268266_10002874 | |||
| 2710 | Ga0268266_10006338 | |||
| 2711 | Ga0268266_10012839 | |||
| 2712 | Ga0268266_10015598 | |||
| 2713 | Ga0268266_10034249 | |||
| 2714 | Ga0268266_10042648 | |||
| 2715 | Ga0268266_10200834 | |||
| 2716 | Ga0268266_10206171 | |||
| 2717 | Ga0268266_10247698 | |||
| 2718 | Ga0268265_10001521 | |||
| 2719 | Ga0268265_10003158 | |||
| 2720 | Ga0268265_10014343 | |||
| 2721 | Ga0268265_10021079 | |||
| 2722 | Ga0268265_10053207 | |||
| 2723 | Ga0268264_10000940 | |||
| 2724 | Ga0268264_10002908 | |||
| 2725 | Ga0268264_10023563 | |||
| 2726 | Ga0268264_10026248 | |||
| 2727 | Ga0268264_10075073 | |||
| 2728 | Ga0268264_10080564 | |||
| 2729 | Ga0268264_10092250 | |||
| 2730 | Ga0268264_10242934 | |||
| 2731 | Ga0268264_10326908 | |||
| 2732 | Ga0265334_10006395 | |||
| 2733 | Ga0307517_10002655 | |||
| 2734 | Ga0307517_10096177 | |||
| 2735 | Ga0307517_10146755 | |||
| 2736 | Ga0307515_10000043 | |||
| 2737 | Ga0307515_10000997 | |||
| 2738 | Ga0307515_10005007 | |||
| 2739 | Ga0307515_10034195 | |||
| 2740 | Ga0307515_10104042 | |||
| 2741 | Ga0316177_1144764 | |||
| 2742 | Ga0314311_1228247 | |||
| 2743 | Ga0316178_1010387 | |||
| 2744 | Ga0316183_1086850 | |||
| 2745 | Ga0316181_1069579 | |||
| 2746 | Ga0265332_10004724 | |||
| 2747 | Ga0265329_10002279 | |||
| 2748 | Ga0265339_10054753 | |||
| 2749 | Ga0265331_10000350 | |||
| 2750 | Ga0265327_10008774 | |||
| 2751 | Ga0307513_10000034 | |||
| 2752 | Ga0307513_10002789 | |||
| 2753 | Ga0307513_10009006 | |||
| 2754 | Ga0307513_10029154 | |||
| 2755 | Ga0307509_10004612 | |||
| 2756 | Ga0307509_10005248 | |||
| 2757 | Ga0307509_10012825 | |||
| 2758 | Ga0307509_10122339 | |||
| 2759 | Ga0307408_100000548 | |||
| 2760 | Ga0307408_100026129 | |||
| 2761 | Ga0307408_100028905 | |||
| 2762 | Ga0307408_100160228 | |||
| 2763 | Ga0307408_100335977 | |||
| 2764 | Ga0307508_10000450 | |||
| 2765 | Ga0265314_10000412 | |||
| 2766 | Ga0307516_10000851 | |||
| 2767 | Ga0307516_10003913 | |||
| 2768 | Ga0307516_10004352 | |||
| 2769 | Ga0307516_10016764 | |||
| 2770 | Ga0307516_10021101 | |||
| 2771 | Ga0307405_10003700 | |||
| 2772 | Ga0307405_10062009 | |||
| 2773 | Ga0307405_10075847 | |||
| 2774 | Ga0307413_10014837 | |||
| 2775 | Ga0307413_10034139 | |||
| 2776 | Ga0307410_10004349 | |||
| 2777 | Ga0307406_10000252 | |||
| 2778 | Ga0307406_10003266 | |||
| 2779 | Ga0307407_10003718 | |||
| 2780 | Ga0307407_10037735 | |||
| 2781 | Ga0307412_10002295 | |||
| 2782 | Ga0307412_10021748 | |||
| 2783 | Ga0307412_10041107 | |||
| 2784 | Ga0307412_10047853 | |||
| 2785 | Ga0307412_10245617 | |||
| 2786 | Ga0307412_10247899 | |||
| 2787 | Ga0307409_100002844 | |||
| 2788 | Ga0307409_100146642 | |||
| 2789 | Ga0307409_100180960 | |||
| 2790 | Ga0307409_100184763 | |||
| 2791 | Ga0307409_100240104 | |||
| 2792 | Ga0307416_100184015 | |||
| 2793 | Ga0307416_100226173 | |||
| 2794 | Ga0307416_100240084 | |||
| 2795 | Ga0307414_10110857 | |||
| 2796 | Ga0307414_10125952 | |||
| 2797 | Ga0307411_10007755 | |||
| 2798 | Ga0307411_10140477 | |||
| 2799 | Ga0307415_100011785 | |||
| 2800 | Ga0307415_100173912 | |||
| 2801 | Ga0316583_10012723 | |||
| 2802 | Ga0307507_10047573 | |||
| 2803 | Ga0307510_10000109 | |||
| 2804 | Ga0307510_10014792 | |||
| 2805 | Ga0315911_1000003 | |||
| 2806 | Ga0373926_0020461 | |||
| 2807 | Ga0373926_0053100 | |||
| 2808 | Ga0373934_0000122 | |||
| 2809 | Ga0373934_0003712 | |||
| 2810 | Ga0373940_0014767 | |||
| 2811 | Ga0373944_0002441 | |||
| 2812 | Ga0373944_0017518 | |||
| 2813 | Ga0373944_0025274 | |||
| 2814 | Ga0373951_0019282 | |||
| 2815 | Ga0373923_0001868 | |||
| 2816 | Ga0373923_0057258 | |||
| 2817 | Ga0373932_0007459 | |||
| 2818 | Ga0373936_0014020 | |||
| 2819 | Ga0373939_0017052 | |||
| 2820 | Ga0373945_0002362 | |||
| 2821 | Ga0373945_0010415 | |||
| 2822 | Ga0373953_0003552 | |||
| 2823 | Ga0373954_0000174 | |||
| 2824 | Ga0373954_0000449 | |||
| 2825 | Ga0373954_0002684 | |||
| 2826 | Ga0373954_0007283 | |||
| 2827 | Ga0373954_0008944 | |||
| 2828 | Ga0373954_0055388 | |||
| 2829 | Ga0373956_0000054 | |||
| 2830 | Ga0373956_0014793 | |||
| 2831 | Ga0373957_0001739 | |||
| 2832 | Ga0373957_0003860 | |||
| 2833 | Ga0373957_0004716 | |||
| 2834 | Ga0373943_0004691 | |||
| 2835 | Ga0373955_0002291 | |||
| 2836 | Ga0373955_0031289 | |||
| 2837 | Ga0373955_0079730 | |||
| 2838 | Ga0373942_0017293 | |||
| 2839 | Ga0373962_0005867 | |||
| 2840 | Ga0373924_0003449 | |||
| 2841 | Ga0373924_0006114 | |||
| 2842 | Ga0373924_0019126 | |||
| 2843 | Ga0373924_0073167 | |||
| 2844 | Ga0373931_0006471 | |||
| 2845 | Ga0373935_0007402 | |||
| 2846 | Ga0373935_0007934 | |||
| 2847 | Ga0373935_0011968 | |||
| 2848 | Ga0373935_0065650 | |||
| 2849 | Ga0373935_0065896 | |||
| 2850 | Ga0373927_0005049 | |||
| 2851 | Ga0373927_0008390 | |||
| 2852 | Ga0373927_0010118 | |||
| 2853 | Ga0373927_0029106 | |||
| 2854 | Ga0373927_0034249 | |||
| 2855 | Ga0373927_0049493 | |||
| 2856 | Ga0373927_0091638 | |||
| 2857 | Ga0373933_0000782 | |||
| 2858 | Ga0373933_0008072 | |||
| 2859 | Ga0373933_0012960 | |||
| 2860 | Ga0373933_0088040 | |||
| 2861 | Ga0373933_0178186 | |||
| 2862 | Ga0373947_0015681 | |||
| 2863 | Ga0373947_0098568 | |||
| 2864 | Ga0373937_0000590 | |||
| 2865 | Ga0373937_0001198 | |||
| 2866 | Ga0373937_0022602 | |||
| 2867 | Ga0373937_0035822 | |||
| 2868 | Ga0373937_0286396 | |||
| 2869 | Ga0316582_0005485 | |||
| 2870 | Ga0373925_0009683 | |||
| 2871 | Ga0373925_0016652 | |||
| 2872 | Ga0373925_0105673 | |||
| 2873 | Ga0373925_0128155 | |||
| 2874 | Ga0373925_0172471 | |||
| 2875 | Ga0395899_0187655 | |||
| 2876 | Ga0395900_0001586 | |||
| 2877 | Ga0395900_0054523 | |||
| 2878 | Ga0395900_0070956 | |||
| 2879 | Ga0395898_0018855 | |||
| 2880 | Ga0395898_0031129 | |||
| 2881 | Ga0395898_0035905 | |||
| 2882 | Ga0395898_0067374 | |||
| 2883 | Ga0395898_0098090 | |||
| 2884 | Ga0395898_0123792 | |||
| 2885 | Ga0395898_0205184 | |||
| 2886 | Ga0395905_0055068 | |||
| 2887 | Ga0395905_0203655 | |||
| 2888 | Ga0395905_0285136 | |||
| 2889 | Ga0316581_0006616 | |||
| 2890 | Ga0436364_0175508 | |||
| 2891 | Ga0436364_1468890 | |||
| 2892 | Ga0395901_0001544 | |||
| 2893 | Ga0395901_0009907 | |||
| 2894 | Ga0395901_0014285 | |||
| 2895 | Ga0395901_0034663 | |||
| 2896 | Ga0395901_0077928 | |||
| 2897 | Ga0395901_0244032 | |||
| 2898 | Ga0395901_0338812 | |||
| 2899 | Ga0395901_0378743 | |||
| 2900 | Ga0395901_0425223 | |||
| 2901 | Ga0436365_1860619 | |||
| 2902 | Ga0436360_0269953 | |||
| 2903 | Ga0436360_0914350 | |||
| 2904 | Ga0439436_0005119 | |||
| 2905 | Ga0439466_0004842 | |||
| 2906 | Ga0451800_1323902 | |||
| 2907 | Ga0439441_001747 | |||
| 2908 | Ga0439441_004454 | |||
| 2909 | Ga0439442_007829 | |||
| 2910 | Ga0439432_006320 | |||
| 2911 | Ga0439449_0009382 | |||
| 2912 | Ga0450911_001006 | |||
| 2913 | Ga0439446_0000182 | |||
| 2914 | Ga0439446_0004139 | |||
| 2915 | Ga0439434_0000753 | |||
| 2916 | Ga0439434_0026983 | |||
| 2917 | Ga0439435_0010096 | |||
| 2918 | Ga0439444_0010178 | |||
| 2919 | Ga0439460_0011018 | |||
| 2920 | Ga0466972_0000122 | |||
| 2921 | Ga0466965_0014791 | |||
| 2922 | Ga0466966_0008365 | |||
| 2923 | Ga0466966_0020376 | |||
| 2924 | Ga0466961_0000038 | |||
| 2925 | Ga0466971_0088447 | |||
| 2926 | Ga0466957_0069481 | |||
| 2927 | Ga0466957_0229669 | |||
| 2928 | Ga0466959_0009876 | |||
| 2929 | Ga0466959_0071972 | |||
| 2930 | Ga0451576_0001864 | |||
| 2931 | Ga0451576_0004679 | |||
| 2932 | Ga0451576_0015696 | |||
| 2933 | Ga0466967_0152177 | |||
| 2934 | Ga0495592_0000160 | |||
| 2935 | Ga0495592_0000163 | |||
| 2936 | Ga0495592_0001343 | |||
| 2937 | Ga0495592_0009664 | |||
| 2938 | Ga0495592_0031488 | |||
| 2939 | Ga0495603_0041723 | |||
| 2940 | Ga0495629_0171883 | |||
| 2941 | Ga0495641_0012566 | |||
| 2942 | Ga0495651_0000881 | |||
| 2943 | Ga0495651_0013912 | |||
| 2944 | Ga0495651_0068424 | |||
| 2945 | Ga0495653_0045866 | |||
| 2946 | Ga0495653_0120810 | |||
| 2947 | Ga0495580_0019423 | |||
| 2948 | Ga0495580_0060427 | |||
| 2949 | Ga0495582_0001076 | |||
| 2950 | Ga0495582_0008434 | |||
| 2951 | Ga0495639_0001255 | |||
| 2952 | Ga0495639_0004716 | |||
| 2953 | Ga0495639_0005054 | |||
| 2954 | Ga0495639_0010412 | |||
| 2955 | Ga0495639_0014938 | |||
| 2956 | Ga0495662_0002396 | |||
| 2957 | Ga0495662_0091002 | |||
| 2958 | Ga0495664_0024586 | |||
| 2959 | Ga0495594_0015836 | |||
| 2960 | Ga0495594_0052150 | |||
| 2961 | Ga0495607_0001888 | |||
| 2962 | Ga0495608_0000112 | |||
| 2963 | Ga0495608_0078079 | |||
| 2964 | Ga0495610_0013320 | |||
| 2965 | Ga0495610_0042766 | |||
| 2966 | Ga0495616_0018427 | |||
| 2967 | Ga0495618_0031487 | |||
| 2968 | Ga0495620_0051678 | |||
| 2969 | Ga0495628_0000931 | |||
| 2970 | Ga0495628_0005171 | |||
| 2971 | Ga0495628_0056050 | |||
| 2972 | Ga0495628_0098401 | |||
| 2973 | Ga0495628_0138512 | |||
| 2974 | Ga0495630_0002409 | |||
| 2975 | Ga0495631_0000660 | |||
| 2976 | Ga0495632_0008995 | |||
| 2977 | Ga0495643_0017469 | |||
| 2978 | Ga0495666_0010469 | |||
| 2979 | Ga0495666_0081289 | |||
| 2980 | Ga0495642_0021710 | |||
| 2981 | Ga0495652_0010373 | |||
| 2982 | Ga0495652_0041978 | |||
| 2983 | Ga0495652_0055601 | |||
| 2984 | Ga0495652_0084990 | |||
| 2985 | Ga0495665_0001558 | |||
| 2986 | Ga0495665_0002382 | |||
| 2987 | Ga0495665_0005107 | |||
| 2988 | Ga0495665_0059015 | |||
| 2989 | Ga0495640_0008789 | |||
| 2990 | Ga0495640_0036716 | |||
| 2991 | Ga0495640_0038067 | |||
| 2992 | Ga0495586_0004819 | |||
| 2993 | Ga0495586_0005688 | |||
| 2994 | Ga0495586_0049507 | |||
| 2995 | Ga0495586_0102747 | |||
| 2996 | Ga0495587_0039563 | |||
| 2997 | Ga0495598_0009416 | |||
| 2998 | Ga0495597_0000271 | |||
| 2999 | Ga0495597_0016916 | |||
| 3000 | Ga0495645_0000592 | |||
| 3001 | Ga0495645_0021371 | |||
| 3002 | Ga0495645_0031168 | |||
| 3003 | Ga0495645_0163303 | |||
| 3004 | Ga0495668_0006479 | |||
| 3005 | Ga0495634_0047458 | |||
| 3006 | Ga0495625_0000146 | |||
| 3007 | Ga0495625_0000337 | |||
| 3008 | Ga0495625_0015391 | |||
| 3009 | Ga0495625_0016801 | |||
| 3010 | Ga0495625_0023947 | |||
| 3011 | Ga0495635_0008975 | |||
| 3012 | Ga0495635_0029727 | |||
| 3013 | Ga0495661_0004974 | |||
| 3014 | Ga0495588_0005084 | |||
| 3015 | Ga0495588_0053535 | |||
| 3016 | Ga0495657_0029626 | |||
| 3017 | Ga0495599_0020376 | |||
| 3018 | Ga0495599_0025468 | |||
| 3019 | Ga0495623_0012442 | |||
| 3020 | Ga0495647_0003916 | |||
| 3021 | Ga0495647_0004228 | |||
| 3022 | Ga0495647_0006474 | |||
| 3023 | Ga0495647_0006981 | |||
| 3024 | Ga0495658_0006398 | |||
| 3025 | Ga0495658_0014450 | |||
| 3026 | Ga0495658_0018307 | |||
| 3027 | Ga0495658_0047719 | |||
| 3028 | Ga0495669_0002266 | |||
| 3029 | Ga0495613_0017768 | |||
| 3030 | Ga0495613_0019748 | |||
| 3031 | Ga0495613_0027380 | |||
| 3032 | Ga0495624_0007501 | |||
| 3033 | Ga0495624_0027634 | |||
| 3034 | Ga0495624_0040501 | |||
| 3035 | Ga0495649_0011645 | |||
| 3036 | Ga0495600_0000413 | |||
| 3037 | Ga0495581_0003251 | |||
| 3038 | Ga0495604_0051220 | |||
| 3039 | Ga0495674_0009334 | |||
| 3040 | Ga0495672_0011717 | |||
| 3041 | Ga0495676_0004847 | |||
| 3042 | Ga0495676_0027757 | |||
| 3043 | Ga0495676_0033347 | |||
| 3044 | Ga0495680_0003144 | |||
| 3045 | Ga0495680_0030418 | |||
| 3046 | Ga0495680_0066319 | |||
| 3047 | Ga0495680_0071548 | |||
| 3048 | Ga0495687_004820 | |||
| 3049 | Ga0495687_017610 | |||
| 3050 | Ga0495687_022383 | |||
| 3051 | Ga0495675_0018241 | |||
| 3052 | Ga0495675_0075459 | |||
| 3053 | Ga0495685_027576 | |||
| 3054 | Ga0495673_0072245 | |||
| 3055 | Ga0495681_0062573 | |||
| 3056 | Ga0495684_0042716 | |||
| 3057 | Ga0496100_0030763 | |||
| 3058 | Ga0496100_0184125 | |||
| 3059 | Ga0496100_0202541 | |||
| 3060 | Ga0496101_0000648 | |||
| 3061 | Ga0496101_0008563 | |||
| 3062 | Ga0496101_0015153 | |||
| 3063 | Ga0496101_0022950 | |||
| 3064 | Ga0496102_0006708 | |||
| 3065 | Ga0496102_0009709 | |||
| 3066 | Ga0496102_0021133 | |||
| 3067 | Ga0496102_0025539 | |||
| 3068 | Ga0496102_0045525 | |||
| 3069 | Ga0496102_0048945 | |||
| 3070 | Ga0496103_0010060 | |||
| 3071 | Ga0496103_0020553 | |||
| 3072 | Ga0496103_0066360 | |||
| 3073 | Ga0496103_0086628 | |||
| 3074 | Ga0496104_0009873 | |||
| 3075 | Ga0496104_0010866 | |||
| 3076 | Ga0496104_0013631 | |||
| 3077 | Ga0496104_0017610 | |||
| 3078 | Ga0496104_0023744 | |||
| 3079 | Ga0496104_0324337 | |||
| 3080 | Ga0496105_0004124 | |||
| 3081 | Ga0496105_0020682 | |||
| 3082 | Ga0496105_0026867 | |||
| 3083 | Ga0496105_0062665 | |||
| 3084 | Ga0496106_0013736 | |||
| 3085 | Ga0496106_0071440 | |||
| 3086 | Ga0496106_0131483 | |||
| 3087 | Ga0496106_0147962 | |||
| 3088 | Ga0496107_0010282 | |||
| 3089 | Ga0496107_0014148 | |||
| 3090 | Ga0496107_0111178 | |||
| 3091 | Ga0496107_0114631 | |||
| 3092 | Ga0496108_0004526 | |||
| 3093 | Ga0496108_0034837 | |||
| 3094 | Ga0496108_0090160 | |||
| 3095 | Ga0496109_0009137 | |||
| 3096 | Ga0496109_0124537 | |||
| 3097 | Ga0496109_0136115 | |||
| 3098 | Ga0496109_0141421 | |||
| 3099 | Ga0496109_0300190 | |||
| 3100 | Ga0496109_0324861 | |||
| 3101 | Ga0496109_0332129 | |||
| 3102 | Ga0496110_0007558 | |||
| 3103 | Ga0496110_0058595 | |||
| 3104 | Ga0496110_0162407 | |||
| 3105 | Ga0496110_0253393 | |||
| 3106 | Ga0496111_0080941 | |||
| 3107 | Ga0496112_0002865 | |||
| 3108 | Ga0496112_0008850 | |||
| 3109 | Ga0496112_0027916 | |||
| 3110 | Ga0496112_0028785 | |||
| 3111 | Ga0496112_0248046 | |||
| 3112 | Ga0496112_0270924 | |||
| 3113 | Ga0496113_0010063 | |||
| 3114 | Ga0496113_0168466 | |||
| 3115 | Ga0496113_0219647 | |||
| 3116 | Ga0496114_0008449 | |||
| 3117 | Ga0496114_0020456 | |||
| 3118 | Ga0496114_0038579 | |||
| 3119 | Ga0496114_0134807 | |||
| 3120 | Ga0496115_0013729 | |||
| 3121 | Ga0496116_0009705 | |||
| 3122 | Ga0496116_0026735 | |||
| 3123 | Ga0496117_0037255 | |||
| 3124 | Ga0496118_0009367 | |||
| 3125 | Ga0496118_0015550 | |||
| 3126 | Ga0496121_0017571 | |||
| 3127 | Ga0496121_0067230 | |||
| 3128 | Ga0496121_0077877 | |||
| 3129 | Ga0496121_0141252 | |||
| 3130 | Ga0496121_0170361 | |||
| 3131 | Ga0496121_0227373 | |||
| 3132 | Ga0496122_0000408 | |||
| 3133 | Ga0496123_0000124 | |||
| 3134 | Ga0496123_0000188 | |||
| 3135 | Ga0496123_0119361 | |||
| 3136 | Ga0496125_0000060 | |||
| 3137 | Ga0496125_0000939 | |||
| 3138 | Ga0496125_0003316 | |||
| 3139 | Ga0496125_0012543 | |||
| 3140 | Ga0496125_0038850 | |||
| 3141 | Ga0496126_0061276 | |||
| 3142 | Ga0496126_0066290 | |||
| 3143 | Ga0495678_058853 | |||
| 3144 | Ga0501033_0221879 | |||
| 3145 | Ga0501034_0002706 | |||
| 3146 | Ga0501034_0049783 | |||
| 3147 | Ga0501034_0049918 | |||
| 3148 | Ga0501034_0077092 | |||
| 3149 | Ga0501034_0101177 | |||
| 3150 | Ga0501036_0036902 | |||
| 3151 | Ga0501036_0115181 | |||
| 3152 | Ga0501037_0093781 | |||
| 3153 | Ga0501038_0023765 | |||
| 3154 | Ga0501038_0079258 | |||
| 3155 | Ga0501039_0001773 | |||
| 3156 | Ga0501039_0010820 | |||
| 3157 | Ga0501039_0032989 | |||
| 3158 | Ga0501039_0051640 | |||
| 3159 | Ga0501039_0056245 | |||
| 3160 | Ga0501039_0187571 | |||
| 3161 | Ga0501040_0005843 | |||
| 3162 | Ga0501040_0007299 | |||
| 3163 | Ga0501040_0016338 | |||
| 3164 | Ga0501040_0022260 | |||
| 3165 | Ga0501041_0001572 | |||
| 3166 | Ga0501041_0005336 | |||
| 3167 | Ga0501041_0034766 | |||
| 3168 | Ga0501042_0003040 | |||
| 3169 | Ga0501042_0011136 | |||
| 3170 | Ga0501042_0063919 | |||
| 3171 | Ga0501043_0149735 | |||
| 3172 | Ga0501046_0010010 | |||
| 3173 | Ga0501047_0075613 | |||
| 3174 | Ga0501047_0240411 | |||
| 3175 | Ga0501048_0016231 | |||
| 3176 | Ga0501067_0056290 | |||
| 3177 | Ga0501067_0082717 | |||
| 3178 | Ga0501068_0014530 | |||
| 3179 | Ga0501070_0054730 | |||
| 3180 | Ga0501070_0070807 | |||
| 3181 | Ga0501070_0316420 | |||
| 3182 | Ga0501071_0000373 | |||
| 3183 | Ga0501071_0016292 | |||
| 3184 | Ga0501071_0019722 | |||
| 3185 | Ga0501071_0021607 | |||
| 3186 | Ga0501072_0001156 | |||
| 3187 | Ga0501072_0002674 | |||
| 3188 | Ga0501072_0010678 | |||
| 3189 | Ga0501072_0018804 | |||
| 3190 | Ga0501072_0069898 | |||
| 3191 | Ga0501073_0005691 | |||
| 3192 | Ga0501073_0162819 | |||
| 3193 | Ga0501074_0066911 | |||
| 3194 | Ga0501074_0124449 | |||
| 3195 | Ga0501074_0131313 | |||
| 3196 | Ga0501075_0000936 | |||
| 3197 | Ga0501075_0028293 | |||
| 3198 | Ga0501075_0093655 | |||
| 3199 | Ga0501075_0112563 | |||
| 3200 | Ga0501076_0000368 | |||
| 3201 | Ga0501076_0000723 | |||
| 3202 | Ga0501076_0008694 | |||
| 3203 | Ga0501076_0067779 | |||
| 3204 | Ga0501076_0107612 | |||
| 3205 | Ga0501076_0149854 | |||
| 3206 | Ga0501077_0007614 | |||
| 3207 | Ga0501077_0010717 | |||
| 3208 | Ga0501077_0084935 | |||
| 3209 | Ga0501079_0004391 | |||
| 3210 | Ga0501079_0006780 | |||
| 3211 | Ga0501079_0019212 | |||
| 3212 | Ga0501079_0242440 | |||
| 3213 | Ga0501080_0000884 | |||
| 3214 | Ga0501080_0014279 | |||
| 3215 | Ga0501080_0018314 | |||
| 3216 | Ga0501080_0059029 | |||
| 3217 | Ga0501081_0008922 | |||
| 3218 | Ga0501081_0012105 | |||
| 3219 | Ga0501081_0162389 | |||
| 3220 | Ga0501081_0174342 | |||
| 3221 | Ga0501083_0099888 | |||
| 3222 | Ga0501262_000676 | |||
| 3223 | Ga0501035_0160942 | |||
| 3224 | Ga0501035_0185716 | |||
| 3225 | Ga0501044_0014975 | |||
| 3226 | Ga0501044_0040015 | |||
| 3227 | Ga0501044_0042184 | |||
| 3228 | Ga0501044_0206525 | |||
| 3229 | Ga0501045_0000263 | |||
| 3230 | Ga0501045_0007193 | |||
| 3231 | Ga0501045_0009377 | |||
| 3232 | Ga0501045_0203571 | |||
| 3233 | nmdc:mga03683_67597_c1 | |||
| 3234 | nmdc:mga03n38_28823_c1 | |||
| 3235 | nmdc:mga00v17_33302_c1 | |||
| 3236 | nmdc:mga00v17_62148_c1 | |||
| 3237 | nmdc:mga0yw44_14606_c1 | |||
| 3238 | nmdc:mga0yw44_28991_c1 | |||
| 3239 | nmdc:mga0yw44_86618_c1 | |||
| 3240 | nmdc:mga0k408_130547_c1 | |||
| 3241 | nmdc:mga0k408_38350_c1 | |||
| 3242 | nmdc:mga0k408_5966_c1 | |||
| 3243 | nmdc:mga0k408_6258_c1 | |||
| 3244 | nmdc:mga0k408_91149_c1 | |||
| 3245 | nmdc:mga0k408_9812_c1 | |||
| 3246 | nmdc:mga06z11_5930_c1 | |||
| 3247 | nmdc:mga06z11_71560_c1 | |||
| 3248 | nmdc:mga06z11_79424_c1 | |||
| 3249 | nmdc:mga04h51_30499_c1 | |||
| 3250 | nmdc:mga07m45_114474_c1 | |||
| 3251 | nmdc:mga07m45_1563_c1 | |||
| 3252 | nmdc:mga07m45_20110_c1 | |||
| 3253 | nmdc:mga07m45_2696_c2 | |||
| 3254 | nmdc:mga07m45_3774_c1 | |||
| 3255 | nmdc:mga07m45_577_c1 | |||
| 3256 | nmdc:mga05p37_758_c1 | |||
| 3257 | nmdc:mga05p37_8_c1 | |||
| 3258 | nmdc:mga09592_101343_c1 | |||
| 3259 | nmdc:mga09592_12310_c1 | |||
| 3260 | nmdc:mga09592_130039_c1 | |||
| 3261 | nmdc:mga09592_5994_c1 | |||
| 3262 | nmdc:mga0qj67_727_c1 | |||
| 3263 | nmdc:mga06r32_131218_c1 | |||
| 3264 | nmdc:mga06r32_2_c2 | |||
| 3265 | nmdc:mga06r32_40790_c1 | |||
| 3266 | nmdc:mga06r32_5553_c1 | |||
| 3267 | nmdc:mga08y16_10189_c1 | |||
| 3268 | nmdc:mga08y16_141939_c1 | |||
| 3269 | nmdc:mga08y16_40523_c1 | |||
| 3270 | nmdc:mga08y16_7868_c1 | |||
| 3271 | nmdc:mga0n895_103893_c1 | |||
| 3272 | nmdc:mga0n895_10501_c1 | |||
| 3273 | nmdc:mga0n895_126353_c1 | |||
| 3274 | nmdc:mga0n895_13715_c1 | |||
| 3275 | nmdc:mga0n895_1569_c1 | |||
| 3276 | nmdc:mga0n895_2878_c1 | |||
| 3277 | nmdc:mga0n895_29379_c1 | |||
| 3278 | nmdc:mga0rr50_261772_c1 | |||
| 3279 | nmdc:mga0rr50_47223_c1 | |||
| 3280 | nmdc:mga08x19_103071_c1 | |||
| 3281 | nmdc:mga08x19_10771_c1 | |||
| 3282 | nmdc:mga0a205_146335_c1 | |||
| 3283 | nmdc:mga0a205_226174_c1 | |||
| 3284 | nmdc:mga0sz30_183_c2 | |||
| 3285 | Ga0495601_0062656 | |||
| 3286 | Ga0495612_0056450 | |||
| 3287 | Ga0495595_0015766 | |||
| 3288 | Ga0495619_0009928 | |||
| 3289 | Ga0500578_0148542 | |||
| 3290 | Ga0500651_0000306 | |||
| 3291 | Ga0500566_0000003 | |||
| 3292 | Ga0500571_000025 | |||
| 3293 | Ga0500572_002602 | |||
| 3294 | Ga0500595_002313 | |||
| 3295 | Ga0500607_053840 | |||
| 3296 | Ga0500608_003401 | |||
| 3297 | Ga0500608_077346 | |||
| 3298 | Ga0500618_004010 | |||
| 3299 | Ga0500658_0039107 | |||
| 3300 | Ga0500559_0001626 | |||
| 3301 | Ga0500559_0002366 | |||
| 3302 | Ga0500574_003346 | |||
| 3303 | Ga0500603_000184 | |||
| 3304 | Ga0500616_0000725 | |||
| 3305 | Ga0500630_001089 | |||
| 3306 | Ga0500634_0037391 | |||
| 3307 | Ga0500639_000033 | |||
| 3308 | Ga0500639_086147 | |||
| 3309 | Ga0500636_0000042 | |||
| 3310 | Ga0500637_0094416 | |||
| 3311 | Ga0500596_001686 | |||
| 3312 | Ga0500596_004563 | |||
| 3313 | Ga0500601_000553 | |||
| 3314 | Ga0501084_0047911 | |||
| 3315 | Ga0501084_0177745 | |||
| 3316 | Ga0501084_0190447 | |||
| 3317 | Ga0500661_004312 | |||
| 3318 | Ga0501082_0001125 | |||
| 3319 | Ga0501082_0011010 | |||
| 3320 | Ga0501082_0236387 | |||
| 3321 | Ga0530510_0000286 | |||
| 3322 | Ga0530510_0000862 | |||
| 3323 | Ga0530510_0067151 | |||
| 3324 | 2509148370 | |||
| 3325 | 2511248212 | |||
| 3326 | 2511252324 | |||
| 3327 | 2513228504 | |||
| 3328 | 2513622353 | |||
| 3329 | 2513640530 | |||
| 3330 | 2513645448 | |||
| 3331 | 2513657153 | |||
| 3332 | 2513693739 | |||
| 3333 | 2513701716 | |||
| 3334 | 2513863161 | |||
| 3335 | 2513873134 | |||
| 3336 | 2513892626 | |||
| 3337 | 2513919161 | |||
| 3338 | 2514016521 | |||
| 3339 | 2517102627 | |||
| 3340 | 2517891146 | |||
| 3341 | 2524465597 | |||
| 3342 | 2524533670 | |||
| 3343 | 2528848702 | |||
| 3344 | 2550697506 | |||
| 3345 | 2553003411 | |||
| 3346 | 2587755956 | |||
| 3347 | 2617346997 | |||
| 3348 | 2643864154 | |||
| 3349 | 2643981047 | |||
| 3350 | 2643992454 | |||
| 3351 | 2644029503 | |||
| 3352 | 2644163353 | |||
| 3353 | 2644292143 | |||
| 3354 | 2644303104 | |||
| 3355 | 2644305856 | |||
| 3356 | 2644326638 | |||
| 3357 | 2644396988 | |||
| 3358 | 2644469340 | |||
| 3359 | 2671123252 | |||
| 3360 | 2723843482 | |||
| 3361 | 2738724072 | |||
| 3362 | 2738883437 | |||
| 3363 | 2739247507 | |||
| 3364 | 2739284757 | |||
| 3365 | 2739610807 | |||
| 3366 | 2793066489 | |||
| 3367 | 2805914967 | |||
| 3368 | 2809034915 | |||
| 3369 | 2809131656 | |||
| 3370 | 2809151278 | |||
| 3371 | 2818239675 | |||
| 3372 | 2819594133 | |||
| 3373 | 2821450574 | |||
| 3374 | 2824602357 | |||
| 3375 | 2824610549 | |||
| 3376 | 2824618109 | |||
| 3377 | 2824626777 | |||
| 3378 | 2824636588 | |||
| 3379 | 2824645122 | |||
| 3380 | 2824654326 | |||
| 3381 | 2824661589 | |||
| 3382 | 2824672038 | |||
| 3383 | 2824679862 | |||
| 3384 | 2824688637 | |||
| 3385 | 2824697127 | |||
| 3386 | 2824705091 | |||
| 3387 | 2824715717 | |||
| 3388 | 2824725200 | |||
| 3389 | 2824754372 | |||
| 3390 | 2824767871 | |||
| 3391 | 2824775253 | |||
| 3392 | 2834645881 | |||
| 3393 | 2838123351 | |||
| 3394 | 2841946645 | |||
| 3395 | 2841954122 | |||
| 3396 | 2841960975 | |||
| 3397 | 2841969500 | |||
| 3398 | 2841974616 | |||
| 3399 | 2841983825 | |||
| 3400 | 2842679386 | |||
| 3401 | 2842738338 | |||
| 3402 | 2842750554 | |||
| 3403 | 2844319405 | |||
| 3404 | 2847936581 | |||
| 3405 | 2847946925 | |||
| 3406 | 2849078964 | |||
| 3407 | 2852622440 | |||
| 3408 | 2857578439 | |||
| 3409 | 2874611603 | |||
| 3410 | 2874632268 | |||
| 3411 | 2879088075 | |||
| 3412 | 2879108342 | |||
| 3413 | 2879117467 | |||
| 3414 | 2881672533 | |||
| 3415 | 2881929559 | |||
| 3416 | 2884816086 | |||
| 3417 | 2884839435 | |||
| 3418 | 2884856755 | |||
| 3419 | 2885193315 | |||
| 3420 | 2885413317 | |||
| 3421 | 2888384474 | |||
| 3422 | 2888393436 | |||
| 3423 | 2888424924 | |||
| 3424 | 2894023396 | |||
| 3425 | 2896158101 | |||
| 3426 | 2903734347 | |||
| 3427 | 2903752233 | |||
| 3428 | 2904435008 | |||
| 3429 | 2904451537 | |||
| 3430 | 2904458394 | |||
| 3431 | 2904543190 | |||
| 3432 | 2904698954 | |||
| 3433 | 2904701025 | |||
| 3434 | 2904715095 | |||
| 3435 | 2906605591 | |||
| 3436 | 2906616326 | |||
| 3437 | 2906627163 | |||
| 3438 | 2906641531 | |||
| 3439 | 2906646195 | |||
| 3440 | 2906662891 | |||
| 3441 | 2908741466 | |||
| 3442 | 2908758751 | |||
| 3443 | 2919466499 | |||
| 3444 | 2922361738 | |||
| 3445 | 2922374886 | |||
| 3446 | 2922387012 | |||
| 3447 | 2922400429 | |||
| 3448 | 2922431676 | |||
| 3449 | 2923511539 | |||
| 3450 | 2928090405 | |||
| 3451 | 2929160424 | |||
| 3452 | 2929524029 | |||
| 3453 | 2929621930 | |||
| 3454 | 2929629763 | |||
| 3455 | 2932422932 | |||
| 3456 | 2932788797 | |||
| 3457 | 2932812771 | |||
| 3458 | 2932819137 | |||
| 3459 | 2932830463 | |||
| 3460 | 2933583794 | |||
| 3461 | 2935616757 | |||
| 3462 | 2935635776 | |||
| 3463 | 2935641913 | |||
| 3464 | 2935673044 | |||
| 3465 | 2935675849 | |||
| 3466 | 2935685846 | |||
| 3467 | 2935697908 | |||
| 3468 | 2935705686 | |||
| 3469 | 2935714398 | |||
| 3470 | 2935725017 | |||
| 3471 | 2935732624 | |||
| 3472 | 2935742003 | |||
| 3473 | 2935751811 | |||
| 3474 | 2935765068 | |||
| 3475 | 2935802664 | |||
| 3476 | 2935813506 | |||
| 3477 | 2935830080 | |||
| 3478 | 2935837998 | |||
| 3479 | 2935855381 | |||
| 3480 | 2935867375 | |||
| 3481 | 2935875806 | |||
| 3482 | 2935996470 | |||
| 3483 | 2936003750 | |||
| 3484 | 2936042455 | |||
| 3485 | 2939633593 | |||
| 3486 | 2940557386 | |||
| 3487 | 2941512387 | |||
| 3488 | 2941520108 | |||
| 3489 | 2941528257 | |||
| 3490 | 2941539336 | |||
| 3491 | 2945915454 | |||
| 3492 | 2945950552 | |||
| 3493 | 2945974815 | |||
| 3494 | 2945989144 | |||
| 3495 | 2954770014 | |||
| 3496 | 2990714767 | |||
| 3497 | 3005481475 | |||
| 3498 | 3005484657 | |||
| 3499 | 3005510669 | |||
| 3500 | 3005587692 | |||
| 3501 | 3005599606 | |||
| 3502 | 3005722643 | |||
| 3503 | 8003405145 | |||
| 3504 | 8006939242 | |||
| 3505 | 8006966853 | |||
| 3506 | 8006978900 | |||
| 3507 | 8006994635 | |||
| 3508 | 8016521830 | |||
| 3509 | 8017063824 | |||
| 3510 | 8019565101 | |||
| 3511 | 8019575205 | |||
| 3512 | 8019583172 | |||
| 3513 | 8019618174 | |||
| 3514 | 8019658927 | |||
| 3515 | 8048749031 | |||
| 3516 | 8055226651 | |||
| 3517 | 8055745904 | |||
| 3518 | 8056680897 | |||
| 3519 | 8056690606 | |||
| 3520 | 8056968394 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3i45-assembly1.cif.gz_A | crystal structure of putative twin-arginine translocation pathway signal protein from rhodospirillum rubrum atcc 11170 | 0.9927 | 36 | 409 |
| 3i45-assembly1.cif.gz_A | crystal structure of putative twin-arginine translocation pathway signal protein from rhodospirillum rubrum atcc 11170 | 0.9797 | 36 | 409 |
| 4eyk-assembly1.cif.gz_A | crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris bisb5 in complex with 3,4-dihydroxy benzoic acid | 0.9058 | 36 | 392 |
| 3td9-assembly1.cif.gz_A-2 | crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution | 0.8901 | 37 | 388 |
| 4evr-assembly1.cif.gz_A | crystal structure of abc transporter from r. palustris - solute binding protein (rpa0668) in complex with benzoate | 0.8829 | 36 | 391 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3i45A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9884 | 36 | 367 | 3.40.50.2300 |
| 3i45A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.976 | 155 | 409 | 3.40.50.2300 |
| 3i45A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9706 | 155 | 409 | 3.40.50.2300 |
| 3i45A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9636 | 36 | 367 | 3.40.50.2300 |
| af_Q9SHV1_60_153_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9289 | 75 | 140 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E7F3V2-F1-model_v4 | Leucine-binding protein domain-containing protein | 0.9644 | 99 | 392 |
GO:0006865
|
| AF-A0A3B8H8H4-F1-model_v4 | Leucine-binding protein domain-containing protein | 0.946 | 58 | 224 |
|
| AF-W4MB19-F1-model_v4 | Leucine-binding protein domain-containing protein | 0.9418 | 99 | 406 |
|
| AF-A0A2E7F3V2-F1-model_v4 | Leucine-binding protein domain-containing protein | 0.9335 | 99 | 392 |
GO:0006865
|
| AF-A0A7C3RB38-F1-model_v4 | Leucine-binding protein domain-containing protein | 0.9257 | 36 | 409 |
GO:0006865
|