F495608

General Info

Members Datasets Scaffolds Average Seq Length
1760 737 3520 400

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10000770|Ga0105238_1000077014
Length 423
Sequence MLNPGSGEVVCYHGSPFETGRAFGVVMFRRMLLAVLIVAAALPLGAHAQPIRIGELNSYKVFPAFLEPYRKGMELARDEVNAAGGVLGRPIEIVSRDDGGTPGDAVRVAEELVARERVAMLMGTYASNVGLAVADFAKQRRVLFLAAEPLTDKIVWDDGNAYTFRLRASTYMQTAMLVPEAAKLGKKRWAIVYPNYEYGQAATATFKQQMIARMGAGNVEFVEQATPLGKIEPGPVVQALLDAKPDAIFSSLFGPDLARFVREGELRGLFKDRPVVDLLGGEPEYLDPLKDEAPVGWLVTGYPWYSIETSEHRKFRAAYQAKFNDYPRLGSVVGYTAVKSAAAAIARAGSTDTDKLVAAMRDLPVDMPFGRIEFRAIDHQSTMGAYVGRTAVKDGKGIMVDWHYADGKDFLPPDDVVRKLRKE

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
70 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
71 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
80 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
112 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
116 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
117 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
118 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
119 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
121 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
122 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
123 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
124 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
125 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
126 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
127 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
128 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
129 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
130 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
132 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
133 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
134 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
135 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
136 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
137 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
138 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
142 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
143 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
145 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
146 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
147 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
148 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
152 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
153 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
154 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
155 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
156 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
157 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
158 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
159 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
160 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
161 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
162 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
163 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
164 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
165 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
166 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
167 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
168 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
169 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
170 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
172 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
173 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
174 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
176 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
177 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
180 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
182 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
183 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
184 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
187 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
188 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
189 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
193 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
196 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
198 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
201 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
269 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
270 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
272 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
273 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
280 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
282 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
284 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
288 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
289 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
290 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
291 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
292 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
293 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
294 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
295 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
296 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
297 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
298 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
299 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
300 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
301 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
302 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
303 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
304 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
305 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
306 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
307 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
308 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
309 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
310 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
311 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
312 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
313 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
314 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
315 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
316 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
317 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
318 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
319 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
320 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
321 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
322 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
323 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
324 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
325 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
326 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
327 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
328 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
329 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
330 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
331 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
332 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
333 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
334 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
335 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
336 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
337 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
338 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
339 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
340 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
341 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
342 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
343 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
344 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
345 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
346 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
347 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
348 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
349 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
350 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
351 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
352 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
353 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
354 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
355 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
356 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
357 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
358 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
359 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
360 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
361 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
362 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
363 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
364 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
365 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
366 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
367 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
368 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
369 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
370 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
371 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
372 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
373 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
374 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
375 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
376 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
377 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
378 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
379 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
380 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
381 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
382 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
383 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
384 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
385 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
386 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
387 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
388 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
389 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
390 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
391 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
392 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
393 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
394 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
395 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
396 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
397 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
398 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
399 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
400 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
401 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
402 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
403 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
404 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
405 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
406 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
407 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
408 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
409 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
410 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
411 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
412 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
413 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
414 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
415 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
416 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
417 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
418 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
419 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
420 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
421 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
422 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
423 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
424 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
425 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
426 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
427 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
428 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
429 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
430 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
431 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
432 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
433 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
434 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
435 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
436 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
437 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
438 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
439 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
440 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
441 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
442 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
443 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
444 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
445 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
446 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
447 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
448 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
449 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
450 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
451 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
452 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
453 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
454 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
455 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
456 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
457 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
458 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
459 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
460 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
461 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
462 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
463 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
464 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
465 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
473 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
474 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
478 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
479 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
480 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
481 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
482 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
483 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
484 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
485 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
486 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
487 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
488 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
489 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
490 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
491 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
492 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
493 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
495 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
496 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
497 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
498 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
499 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
500 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
501 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
502 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
503 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
504 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
505 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
506 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
507 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
508 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
509 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
510 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
511 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
512 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
513 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
514 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
515 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
516 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
517 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
518 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
519 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
520 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
521 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
522 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
523 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
524 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
525 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
526 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
527 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
528 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
529 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
530 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
531 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
532 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
533 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
534 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
535 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
536 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
537 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
538 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
539 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
540 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
541 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
542 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
543 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
544 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
545 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
546 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
547 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
548 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
549 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
550 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
551 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
552 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
553 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
554 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
555 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
556 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
557 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
558 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
559 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
560 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
561 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
562 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
563 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
564 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
565 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
566 2643221570 Acidovorax sp. Root568 Isolate Unclassified
567 2643221594 Achromobacter sp. Root170 Isolate Unclassified
568 2643221596 Acidovorax sp. Root70 Isolate Unclassified
569 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
570 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
571 2643221652 Acidovorax sp. Root402 Isolate Unclassified
572 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
573 2643221658 Variovorax sp. Root411 Isolate Unclassified
574 2643221672 Variovorax sp. Root434 Isolate Unclassified
575 2643221683 Variovorax sp. Root473 Isolate Unclassified
576 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
577 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
578 2738541277 Variovorax sp. GV051 Isolate Unclassified
579 2738541307 Variovorax sp. GV008 Isolate Unclassified
580 2738543013 Variovorax sp. BT01 Isolate Unclassified
581 2738543019 Variovorax sp. GV040 Isolate Unclassified
582 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
583 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
584 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
585 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
586 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
587 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
588 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
589 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
590 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
591 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
592 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
593 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
594 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
595 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
596 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
597 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
598 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
599 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
600 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
601 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
602 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
603 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
604 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
605 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
606 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
607 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
608 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
609 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
610 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
611 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
612 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
613 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
614 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
615 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
616 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
617 2842677519 Variovorax sp. R-72495 Isolate Unclassified
618 2842733646 Variovorax sp. R-72446 Isolate Unclassified
619 2842747753 Variovorax sp. R-72060 Isolate Unclassified
620 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
621 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
622 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
623 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
624 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
625 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
626 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
627 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
628 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
629 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
630 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
631 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
632 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
633 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
634 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
635 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
636 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
637 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
638 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
639 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
640 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
641 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
642 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
643 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
644 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
645 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
646 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
647 2904456579 Variovorax sp. 2002 Isolate Unclassified
648 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
649 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
650 2904699407
651 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
652 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
653 2906610324
654 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
655 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
656 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
657 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
658 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
659 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
660 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
661 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
662 2922368715
663 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
664 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
665 2922425934
666 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
667 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
668 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
669 2929520902 Variovorax beijingensis 502 Isolate Unclassified
670 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
671 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
672 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
673 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
674 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
675 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
676 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
677 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
678 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
679 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
680 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
681 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
682 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
683 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
684 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
685 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
686 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
687 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
688 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
689 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
690 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
691 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
692 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
693 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
694 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
695 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
696 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
697 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
698 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
699 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
700 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
701 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
702 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
703 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
704 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
705 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
706 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
707 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
708 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
709 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
710 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
711 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
712 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
713 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
714 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
715 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
716 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
717 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
718 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
719 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
720 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
721 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
722 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
723 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
724 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
725 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
726 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
727 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
728 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
729 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
730 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
731 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
732 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
733 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
734 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
735 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
736 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
737 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.84
Metatranscriptomes 0.17
Isolates 10.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.28
Nodule 6.36
Rhizoplane 3.75
Rhizosphere 71.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10000770 3300009551 Bacteria 33391
2 JGI25155J39150_1000348 3300002704 Bacteria 14622
3 JGI25155J39150_1000397 3300002704 Bacteria 12180
4 JGI25156J39149_1000039 3300002705 Bacteria 107108
5 JGI25154J39366_1000059 3300002738 Bacteria 107114
6 JGI25154J39366_1000162 3300002738 Bacteria 51833
7 JGI25157J39369_1000057 3300002741 Bacteria 107108
8 JGI25152J39213_1003210 3300002773 Bacteria 5685
9 JGI25150J39212_1001186 3300002774 Bacteria 7741
10 JGI25159J45721_1000497 3300002987 Bacteria 18012
11 JGI25159J45721_1003112 3300002987 Bacteria 5987
12 JGI25159J45721_1017927 3300002987 Bacteria 1445
13 JGI25151J46595_10001481 3300003187 Bacteria 15850
14 JGI25151J46595_10004147 3300003187 Bacteria 7742
15 JGI25151J46595_10004723 3300003187 Bacteria 7158
16 JGI25153J46596_10004260 3300003215 Bacteria 7742
17 JGI25153J46596_10006245 3300003215 Bacteria 6092
18 JGI25160J50197_1000228 3300003354 Bacteria 44139
19 JGI25160J50197_1004539 3300003354 Bacteria 5987
20 JGI25161J50226_1000171 3300003374 Bacteria 44139
21 JGI25161J50226_1006232 3300003374 Bacteria 2190
22 Ga0006562J51391_1036868 3300003578 Bacteria 5740
23 JGI25404J52841_10007941 3300003659 Bacteria 2251
24 JGI25404J52841_10009477 3300003659 Bacteria 2082
25 Ga0055532_1000018 3300003758 Bacteria 305466
26 Ga0055535_1008422 3300003761 Bacteria 1864
27 Ga0055526_1007445 3300003771 Bacteria 5685
28 Ga0055537_1001030 3300003773 Bacteria 12595
29 Ga0055537_1001074 3300003773 Bacteria 12117
30 Ga0055537_1002754 3300003773 Bacteria 5685
31 Ga0055524_1005449 3300003775 Bacteria 5685
32 Ga0055536_1000981 3300003781 Bacteria 18125
33 Ga0055536_1003501 3300003781 Bacteria 8412
34 Ga0055536_1021260 3300003781 Bacteria 1974
35 Ga0055534_1000371 3300003784 Bacteria 28124
36 Ga0055534_1002905 3300003784 Bacteria 5685
37 Ga0055528_1003578 3300003790 Bacteria 7742
38 Ga0055528_1014888 3300003790 Bacteria 2844
39 Ga0055530_10008883 3300003791 Bacteria 3951
40 Ga0055540_1014156 3300003792 Bacteria 2394
41 Ga0055531_10012862 3300003794 Bacteria 3900
42 Ga0055531_10024389 3300003794 Bacteria 2234
43 JGI25405J52794_10013526 3300003911 Bacteria 1584
44 Ga0055543_1001492 3300004625 Bacteria 9204
45 Ga0055543_1002183 3300004625 Bacteria 6722
46 Ga0055543_1002866 3300004625 Bacteria 5433
47 Ga0065165_1002034 3300005262 Bacteria 18805
48 Ga0065165_1002156 3300005262 Bacteria 17812
49 Ga0065165_1004137 3300005262 Bacteria 9320
50 Ga0065714_10029414 3300005288 Bacteria 1899
51 Ga0070658_10043586 3300005327 Bacteria 3624
52 Ga0070658_10202646 3300005327 Bacteria 1674
53 Ga0070676_10014784 3300005328 Bacteria 4294
54 Ga0070676_10021242 3300005328 Bacteria 3633
55 Ga0070683_100020403 3300005329 Bacteria 5897
56 Ga0070683_100080691 3300005329 Bacteria 3045
57 Ga0070690_100024193 3300005330 Bacteria 3733
58 Ga0070670_100006216 3300005331 Bacteria 10099
59 Ga0070670_100010932 3300005331 Bacteria 7753
60 Ga0070670_100020925 3300005331 Bacteria 5627
61 Ga0070670_100024850 3300005331 Bacteria 5154
62 Ga0070670_100026734 3300005331 Bacteria 4963
63 Ga0070670_100034308 3300005331 Bacteria 4367
64 Ga0070670_100097687 3300005331 Bacteria 2526
65 Ga0070670_100254077 3300005331 Bacteria 1532
66 Ga0068869_100001034 3300005334 Bacteria 16191
67 Ga0068869_100007415 3300005334 Bacteria 7008
68 Ga0070666_10005594 3300005335 Bacteria 7712
69 Ga0070666_10010734 3300005335 Bacteria 5731
70 Ga0070666_10064662 3300005335 Bacteria 2481
71 Ga0070680_100000789 3300005336 Bacteria 22263
72 Ga0070680_100019987 3300005336 Bacteria 5309
73 Ga0070680_100020435 3300005336 Bacteria 5256
74 Ga0070682_100025351 3300005337 Bacteria 3537
75 Ga0068868_100008066 3300005338 Bacteria 7532
76 Ga0068868_100009673 3300005338 Bacteria 6958
77 Ga0068868_100035445 3300005338 Bacteria 3857
78 Ga0068868_100058041 3300005338 Bacteria 3059
79 Ga0068868_100083366 3300005338 Bacteria 2566
80 Ga0068868_100176045 3300005338 Bacteria 1773
81 Ga0070660_100002643 3300005339 Bacteria 12320
82 Ga0070660_100012054 3300005339 Bacteria 6169
83 Ga0070660_100110595 3300005339 Bacteria 2185
84 Ga0070689_100002767 3300005340 Bacteria 11507
85 Ga0070691_10001775 3300005341 Bacteria 9374
86 Ga0070661_100001036 3300005344 Bacteria 19652
87 Ga0070661_100076907 3300005344 Bacteria 2460
88 Ga0070661_100086187 3300005344 Bacteria 2322
89 Ga0070692_10010384 3300005345 Bacteria 4234
90 Ga0070668_100005979 3300005347 Bacteria 9030
91 Ga0070668_100010299 3300005347 Bacteria 6942
92 Ga0070668_100046663 3300005347 Bacteria 3328
93 Ga0070668_100074690 3300005347 Bacteria 2645
94 Ga0070668_100160684 3300005347 Bacteria 1823
95 Ga0070669_100000706 3300005353 Bacteria 24466
96 Ga0070669_100002383 3300005353 Bacteria 13599
97 Ga0070669_100058804 3300005353 Bacteria 2822
98 Ga0070669_100100200 3300005353 Bacteria 2184
99 Ga0070675_100005756 3300005354 Bacteria 9481
100 Ga0070675_100006313 3300005354 Bacteria 9098
101 Ga0070675_100012135 3300005354 Bacteria 6756
102 Ga0070675_100014622 3300005354 Bacteria 6189
103 Ga0070675_100030287 3300005354 Bacteria 4368
104 Ga0070675_100361590 3300005354 Bacteria 1289
105 Ga0070671_100002238 3300005355 Bacteria 14934
106 Ga0070671_100011061 3300005355 Bacteria 7245
107 Ga0070671_100055325 3300005355 Bacteria 3301
108 Ga0070671_100056246 3300005355 Bacteria 3273
109 Ga0070671_100140698 3300005355 Bacteria 2036
110 Ga0070671_100152595 3300005355 Bacteria 1951
111 Ga0070674_100012268 3300005356 Bacteria 5259
112 Ga0070674_100110275 3300005356 Bacteria 2019
113 Ga0070673_100001120 3300005364 Bacteria 15374
114 Ga0070673_100002595 3300005364 Bacteria 11039
115 Ga0070673_100002922 3300005364 Bacteria 10528
116 Ga0070673_100007394 3300005364 Bacteria 7239
117 Ga0070673_100008204 3300005364 Bacteria 6931
118 Ga0070673_100028980 3300005364 Bacteria 4124
119 Ga0070673_100042964 3300005364 Bacteria 3489
120 Ga0070688_100022547 3300005365 Bacteria 3693
121 Ga0070659_100000182 3300005366 Bacteria 48054
122 Ga0070659_100193834 3300005366 Bacteria 1671
123 Ga0070659_100264107 3300005366 Bacteria 1429
124 Ga0070667_100004260 3300005367 Bacteria 12083
125 Ga0070667_100005889 3300005367 Bacteria 10212
126 Ga0070667_100073642 3300005367 Bacteria 2912
127 Ga0070667_100076324 3300005367 Bacteria 2861
128 Ga0070667_100105822 3300005367 Bacteria 2435
129 Ga0070667_100180403 3300005367 Bacteria 1867
130 Ga0070667_100184200 3300005367 Bacteria 1848
131 Ga0070667_100200102 3300005367 Bacteria 1772
132 Ga0070667_100208869 3300005367 Bacteria 1735
133 Ga0070709_10030069 3300005434 Bacteria 3256
134 Ga0070709_10125521 3300005434 Bacteria 1745
135 Ga0070714_100015456 3300005435 Bacteria 6142
136 Ga0070714_100053815 3300005435 Bacteria 3437
137 Ga0070713_100000097 3300005436 Bacteria 55735
138 Ga0070713_100018700 3300005436 Bacteria 5269
139 Ga0070713_100357050 3300005436 Bacteria 1357
140 Ga0070710_10003116 3300005437 Bacteria 7854
141 Ga0070710_10016099 3300005437 Bacteria 3799
142 Ga0070701_10027118 3300005438 Bacteria 2802
143 Ga0070711_100004189 3300005439 Bacteria 8475
144 Ga0070711_100026980 3300005439 Bacteria 3767
145 Ga0070711_100040688 3300005439 Bacteria 3136
146 Ga0070705_100001008 3300005440 Bacteria 15668
147 Ga0070705_100002250 3300005440 Bacteria 9775
148 Ga0070700_100000507 3300005441 Bacteria 19399
149 Ga0070700_100009539 3300005441 Bacteria 5336
150 Ga0070700_100139578 3300005441 Bacteria 1645
151 Ga0070694_100001273 3300005444 Bacteria 14642
152 Ga0070694_100023987 3300005444 Bacteria 3932
153 Ga0070694_100036132 3300005444 Bacteria 3271
154 Ga0070708_100036981 3300005445 Bacteria 4257
155 Ga0070708_100047590 3300005445 Bacteria 3789
156 Ga0070663_100007054 3300005455 Bacteria 6812
157 Ga0070663_100012111 3300005455 Bacteria 5444
158 Ga0070663_100028572 3300005455 Bacteria 3798
159 Ga0070663_100041202 3300005455 Bacteria 3238
160 Ga0070663_100048993 3300005455 Bacteria 2998
161 Ga0070663_100110399 3300005455 Bacteria 2065
162 Ga0070678_100001572 3300005456 Bacteria 12234
163 Ga0070678_100062917 3300005456 Bacteria 2743
164 Ga0070678_100075042 3300005456 Bacteria 2543
165 Ga0070678_100103116 3300005456 Bacteria 2215
166 Ga0070662_100000120 3300005457 Bacteria 43782
167 Ga0070662_100025661 3300005457 Bacteria 4072
168 Ga0070662_100045286 3300005457 Bacteria 3155
169 Ga0070662_100173022 3300005457 Bacteria 1697
170 Ga0070681_10000235 3300005458 Bacteria 43570
171 Ga0070681_10052911 3300005458 Bacteria 4048
172 Ga0070681_10098937 3300005458 Bacteria 2863
173 Ga0070681_10163907 3300005458 Bacteria 2146
174 Ga0070681_10189790 3300005458 Bacteria 1975
175 Ga0068867_100000699 3300005459 Bacteria 22369
176 Ga0068867_100001479 3300005459 Bacteria 16259
177 Ga0068867_100022330 3300005459 Bacteria 4524
178 Ga0068867_100031990 3300005459 Bacteria 3801
179 Ga0068867_100042529 3300005459 Bacteria 3324
180 Ga0070685_10068444 3300005466 Bacteria 2097
181 Ga0070706_100005279 3300005467 Bacteria 12318
182 Ga0070706_100026812 3300005467 Bacteria 5301
183 Ga0070706_100065693 3300005467 Bacteria 3355
184 Ga0070706_100160570 3300005467 Bacteria 2098
185 Ga0070707_100014058 3300005468 Bacteria 7500
186 Ga0070707_100172193 3300005468 Bacteria 2110
187 Ga0070707_100231857 3300005468 Bacteria 1797
188 Ga0070698_100000346 3300005471 Bacteria 47866
189 Ga0070698_100030448 3300005471 Bacteria 5594
190 Ga0070699_100008587 3300005518 Bacteria 8852
191 Ga0070699_100097488 3300005518 Bacteria 2575
192 Ga0070679_100008198 3300005530 Bacteria 9822
193 Ga0070679_100067454 3300005530 Bacteria 3568
194 Ga0070679_100138837 3300005530 Bacteria 2411
195 Ga0070679_100243192 3300005530 Bacteria 1757
196 Ga0070684_100012356 3300005535 Bacteria 6840
197 Ga0070684_100053346 3300005535 Bacteria 3519
198 Ga0070684_100100932 3300005535 Bacteria 2578
199 Ga0070697_100038951 3300005536 Bacteria 3841
200 Ga0070697_100080330 3300005536 Bacteria 2686
201 Ga0068853_100001080 3300005539 Bacteria 19275
202 Ga0068853_100012124 3300005539 Bacteria 7011
203 Ga0068853_100065882 3300005539 Bacteria 3144
204 Ga0068853_100148707 3300005539 Bacteria 2107
205 Ga0068853_100249045 3300005539 Bacteria 1630
206 Ga0068853_100289906 3300005539 Bacteria 1511
207 Ga0070672_100008837 3300005543 Bacteria 6918
208 Ga0070672_100011179 3300005543 Bacteria 6254
209 Ga0070672_100012802 3300005543 Bacteria 5906
210 Ga0070672_100033629 3300005543 Bacteria 3884
211 Ga0070672_100035679 3300005543 Bacteria 3781
212 Ga0070672_100044056 3300005543 Bacteria 3445
213 Ga0070672_100124753 3300005543 Bacteria 2111
214 Ga0070672_100136229 3300005543 Bacteria 2022
215 Ga0070686_100000451 3300005544 Bacteria 25364
216 Ga0070695_100000113 3300005545 Bacteria 35966
217 Ga0070695_100004445 3300005545 Bacteria 8235
218 Ga0070695_100059389 3300005545 Bacteria 2476
219 Ga0070695_100100914 3300005545 Bacteria 1943
220 Ga0070696_100001794 3300005546 Bacteria 14067
221 Ga0070696_100029810 3300005546 Bacteria 3732
222 Ga0070693_100006920 3300005547 Bacteria 5514
223 Ga0070665_100002511 3300005548 Bacteria 20168
224 Ga0070665_100005013 3300005548 Bacteria 13734
225 Ga0070665_100020157 3300005548 Bacteria 6694
226 Ga0070665_100024935 3300005548 Bacteria 6028
227 Ga0070665_100054839 3300005548 Bacteria 3997
228 Ga0070665_100083512 3300005548 Bacteria 3199
229 Ga0070665_100090011 3300005548 Bacteria 3074
230 Ga0070665_100259817 3300005548 Bacteria 1738
231 Ga0070704_100001744 3300005549 Bacteria 11877
232 Ga0070704_100031607 3300005549 Bacteria 3563
233 Ga0070704_100104705 3300005549 Bacteria 2140
234 Ga0068855_100003059 3300005563 Bacteria 20475
235 Ga0068855_100004880 3300005563 Bacteria 16367
236 Ga0068855_100044092 3300005563 Bacteria 5280
237 Ga0068855_100116191 3300005563 Bacteria 3067
238 Ga0068855_100133255 3300005563 Bacteria 2836
239 Ga0070664_100000226 3300005564 Bacteria 40249
240 Ga0070664_100006946 3300005564 Bacteria 9122
241 Ga0070664_100008588 3300005564 Bacteria 8264
242 Ga0070664_100068450 3300005564 Bacteria 3035
243 Ga0070664_100082392 3300005564 Bacteria 2774
244 Ga0070664_100093702 3300005564 Bacteria 2603
245 Ga0070664_100205357 3300005564 Bacteria 1759
246 Ga0068857_100009219 3300005577 Bacteria 8561
247 Ga0068857_100012359 3300005577 Bacteria 7430
248 Ga0068857_100017621 3300005577 Bacteria 6262
249 Ga0068854_100004976 3300005578 Bacteria 8377
250 Ga0068854_100091425 3300005578 Bacteria 2265
251 Ga0068856_100002965 3300005614 Bacteria 17396
252 Ga0068856_100004533 3300005614 Bacteria 13815
253 Ga0068856_100006452 3300005614 Bacteria 11507
254 Ga0068856_100034528 3300005614 Bacteria 4954
255 Ga0068856_100035978 3300005614 Bacteria 4855
256 Ga0068856_100046152 3300005614 Bacteria 4292
257 Ga0068856_100060037 3300005614 Bacteria 3757
258 Ga0068856_100108343 3300005614 Bacteria 2774
259 Ga0068856_100132592 3300005614 Bacteria 2496
260 Ga0068856_100197998 3300005614 Bacteria 2023
261 Ga0068856_100204117 3300005614 Bacteria 1991
262 Ga0068856_100342019 3300005614 Bacteria 1514
263 Ga0070702_100000240 3300005615 Bacteria 18563
264 Ga0070702_100108560 3300005615 Bacteria 1716
265 Ga0068852_100000458 3300005616 Bacteria 26975
266 Ga0068852_100002866 3300005616 Bacteria 11957
267 Ga0068852_100003345 3300005616 Bacteria 11194
268 Ga0068852_100044052 3300005616 Bacteria 3787
269 Ga0068852_100050792 3300005616 Bacteria 3555
270 Ga0068852_100361619 3300005616 Bacteria 1420
271 Ga0068859_100001046 3300005617 Bacteria 28371
272 Ga0068859_100004628 3300005617 Bacteria 14018
273 Ga0068859_100005100 3300005617 Bacteria 13340
274 Ga0068859_100011777 3300005617 Bacteria 8788
275 Ga0068859_100131360 3300005617 Bacteria 2576
276 Ga0068859_100371126 3300005617 Bacteria 1526
277 Ga0068859_100432532 3300005617 Bacteria 1412
278 Ga0068864_100001845 3300005618 Bacteria 17426
279 Ga0068864_100006755 3300005618 Bacteria 9398
280 Ga0068864_100033625 3300005618 Bacteria 4360
281 Ga0068864_100060757 3300005618 Bacteria 3272
282 Ga0068864_100100205 3300005618 Bacteria 2567
283 Ga0068866_10000744 3300005718 Bacteria 14729
284 Ga0068866_10022984 3300005718 Bacteria 2894
285 Ga0068861_100000550 3300005719 Bacteria 22119
286 Ga0068861_100009710 3300005719 Bacteria 6653
287 Ga0068861_100011045 3300005719 Bacteria 6275
288 Ga0068861_100012089 3300005719 Bacteria 6016
289 Ga0068861_100016696 3300005719 Bacteria 5200
290 Ga0068861_100197378 3300005719 Bacteria 1687
291 Ga0068851_10004220 3300005834 Bacteria 6466
292 Ga0068870_10014703 3300005840 Bacteria 3702
293 Ga0068863_100003310 3300005841 Bacteria 15908
294 Ga0068863_100004932 3300005841 Bacteria 13155
295 Ga0068863_100024146 3300005841 Bacteria 5800
296 Ga0068863_100026315 3300005841 Bacteria 5551
297 Ga0068863_100056419 3300005841 Bacteria 3719
298 Ga0068863_100162307 3300005841 Bacteria 2141
299 Ga0068858_100001886 3300005842 Bacteria 21412
300 Ga0068858_100009824 3300005842 Bacteria 9102
301 Ga0068858_100054622 3300005842 Bacteria 3693
302 Ga0068858_100059335 3300005842 Bacteria 3536
303 Ga0068858_100115612 3300005842 Bacteria 2507
304 Ga0068860_100000995 3300005843 Bacteria 31354
305 Ga0068860_100002455 3300005843 Bacteria 19466
306 Ga0068860_100004676 3300005843 Bacteria 13977
307 Ga0068860_100006826 3300005843 Bacteria 11441
308 Ga0068860_100011997 3300005843 Bacteria 8534
309 Ga0068860_100017959 3300005843 Bacteria 6890
310 Ga0068860_100027734 3300005843 Bacteria 5454
311 Ga0068860_100043605 3300005843 Bacteria 4279
312 Ga0068862_100001897 3300005844 Bacteria 18976
313 Ga0068862_100007683 3300005844 Bacteria 8923
314 Ga0068862_100011352 3300005844 Bacteria 7356
315 Ga0068862_100018082 3300005844 Bacteria 5871
316 Ga0068862_100023649 3300005844 Bacteria 5150
317 Ga0068862_100048060 3300005844 Bacteria 3642
318 Ga0068862_100060608 3300005844 Bacteria 3251
319 Ga0068862_100062934 3300005844 Bacteria 3192
320 Ga0068862_100070581 3300005844 Bacteria 3015
321 Ga0081455_10002128 3300005937 Bacteria 23616
322 Ga0081455_10005931 3300005937 Bacteria 13260
323 Ga0081455_10007164 3300005937 Bacteria 11793
324 Ga0081455_10008105 3300005937 Bacteria 10967
325 Ga0081455_10056129 3300005937 Bacteria 3346
326 Ga0081455_10067942 3300005937 Bacteria 2968
327 Ga0081538_10062089 3300005981 Bacteria 2133
328 Ga0081540_1008063 3300005983 Bacteria 7404
329 Ga0081540_1010718 3300005983 Bacteria 6177
330 Ga0081540_1011457 3300005983 Bacteria 5923
331 Ga0081540_1027323 3300005983 Bacteria 3236
332 Ga0081540_1081211 3300005983 Bacteria 1459
333 Ga0081539_10000199 3300005985 Bacteria 139305
334 Ga0081539_10008807 3300005985 Bacteria 8643
335 Ga0081539_10035474 3300005985 Bacteria 2997
336 Ga0070717_10226606 3300006028 Bacteria 1644
337 Ga0075365_10081210 3300006038 Bacteria 2196
338 Ga0075365_10120135 3300006038 Bacteria 1812
339 Ga0075368_10049277 3300006042 Bacteria 1671
340 Ga0075363_100033317 3300006048 Bacteria 2681
341 Ga0075363_100038226 3300006048 Bacteria 2523
342 Ga0075364_10000449 3300006051 Bacteria 20713
343 Ga0075364_10001306 3300006051 Bacteria 13411
344 Ga0075364_10041388 3300006051 Bacteria 2992
345 Ga0075364_10041828 3300006051 Bacteria 2976
346 Ga0075432_10004252 3300006058 Bacteria 4876
347 Ga0070715_10007524 3300006163 Bacteria 3753
348 Ga0070716_100025770 3300006173 Bacteria 3142
349 Ga0070712_100005468 3300006175 Bacteria 7868
350 Ga0070712_100025225 3300006175 Bacteria 3949
351 Ga0075362_10007655 3300006177 Bacteria 4103
352 Ga0075362_10017916 3300006177 Bacteria 2924
353 Ga0075362_10036312 3300006177 Bacteria 2155
354 Ga0075367_10022998 3300006178 Bacteria 3502
355 Ga0075367_10058895 3300006178 Bacteria 2286
356 Ga0075367_10091962 3300006178 Bacteria 1846
357 Ga0075369_10039228 3300006186 Bacteria 2022
358 Ga0075366_10003108 3300006195 Bacteria 8682
359 Ga0075366_10020960 3300006195 Bacteria 3798
360 Ga0075366_10034499 3300006195 Bacteria 2980
361 Ga0075366_10048359 3300006195 Bacteria 2522
362 Ga0075366_10090760 3300006195 Bacteria 1830
363 Ga0075366_10101532 3300006195 Bacteria 1726
364 Ga0097621_100181066 3300006237 Bacteria 1821
365 Ga0097621_100235597 3300006237 Bacteria 1599
366 Ga0097621_100362827 3300006237 Bacteria 1291
367 Ga0075370_10016491 3300006353 Bacteria 3975
368 Ga0075370_10016870 3300006353 Bacteria 3937
369 Ga0075370_10016996 3300006353 Bacteria 3923
370 Ga0075370_10039884 3300006353 Bacteria 2647
371 Ga0075370_10091130 3300006353 Bacteria 1758
372 Ga0075370_10107767 3300006353 Bacteria 1616
373 Ga0068871_100001073 3300006358 Bacteria 18331
374 Ga0068871_100026391 3300006358 Bacteria 4532
375 Ga0068871_100051176 3300006358 Bacteria 3344
376 Ga0068871_100101091 3300006358 Bacteria 2416
377 Ga0068871_100119593 3300006358 Bacteria 2224
378 Ga0068871_100126027 3300006358 Bacteria 2167
379 Ga0068871_100255065 3300006358 Bacteria 1529
380 Ga0075428_100001002 3300006844 Bacteria 29936
381 Ga0075428_100010339 3300006844 Bacteria 10356
382 Ga0075428_100018888 3300006844 Bacteria 7624
383 Ga0075428_100195292 3300006844 Bacteria 2189
384 Ga0075428_100410183 3300006844 Bacteria 1452
385 Ga0075430_100008058 3300006846 Bacteria 8906
386 Ga0075431_100000071 3300006847 Bacteria 59366
387 Ga0075431_100007105 3300006847 Bacteria 11124
388 Ga0075431_100046776 3300006847 Bacteria 4463
389 Ga0075431_100245954 3300006847 Bacteria 1818
390 Ga0075433_10100040 3300006852 Bacteria 2567
391 Ga0075434_100000004 3300006871 Bacteria 112839
392 Ga0075434_100001086 3300006871 Bacteria 22255
393 Ga0075434_100003417 3300006871 Bacteria 14208
394 Ga0075434_100081205 3300006871 Bacteria 3239
395 Ga0075434_100081590 3300006871 Bacteria 3231
396 Ga0075434_100123733 3300006871 Bacteria 2603
397 Ga0075429_100000051 3300006880 Bacteria 55896
398 Ga0075429_100009199 3300006880 Bacteria 8578
399 Ga0075429_100063395 3300006880 Bacteria 3220
400 Ga0068865_100001146 3300006881 Bacteria 15365
401 Ga0068865_100013695 3300006881 Bacteria 5135
402 Ga0068865_100043597 3300006881 Bacteria 3067
403 Ga0068865_100077454 3300006881 Bacteria 2376
404 Ga0068865_100197862 3300006881 Bacteria 1558
405 Ga0075436_100000331 3300006914 Bacteria 30168
406 Ga0075436_100031681 3300006914 Bacteria 3642
407 Ga0097620_100001046 3300006931 Bacteria 28371
408 Ga0097620_100004627 3300006931 Bacteria 14018
409 Ga0097620_100005100 3300006931 Bacteria 13340
410 Ga0097620_100011776 3300006931 Bacteria 8788
411 Ga0097620_100131360 3300006931 Bacteria 2576
412 Ga0097620_100371106 3300006931 Bacteria 1526
413 Ga0097620_100432534 3300006931 Bacteria 1412
414 Ga0099825_1027213 3300006941 Bacteria 2935
415 Ga0099824_1014858 3300006942 Bacteria 7583
416 Ga0099822_1003531 3300006943 Bacteria 20044
417 Ga0099826_10017935 3300006948 Bacteria 5347
418 Ga0075435_100000313 3300007076 Bacteria 29845
419 Ga0075435_100018126 3300007076 Bacteria 5343
420 Ga0075435_100028667 3300007076 Bacteria 4367
421 Ga0075435_100102689 3300007076 Bacteria 2370
422 Ga0075435_100118661 3300007076 Bacteria 2205
423 Ga0075435_100122701 3300007076 Bacteria 2169
424 Ga0075435_100239513 3300007076 Bacteria 1543
425 Ga0099794_10023907 3300007265 Bacteria 2800
426 Ga0105251_10025368 3300009011 Bacteria 3033
427 Ga0105244_10004646 3300009036 Bacteria 9378
428 Ga0105240_10000250 3300009093 Bacteria 107111
429 Ga0105240_10005077 3300009093 Bacteria 19731
430 Ga0105240_10005554 3300009093 Bacteria 18768
431 Ga0105240_10035358 3300009093 Bacteria 6440
432 Ga0105240_10167477 3300009093 Bacteria 2605
433 Ga0105240_10229755 3300009093 Bacteria 2157
434 Ga0105240_10318126 3300009093 Bacteria 1775
435 Ga0111539_10003132 3300009094 Bacteria 21897
436 Ga0111539_10010804 3300009094 Bacteria 11495
437 Ga0111539_10047411 3300009094 Bacteria 5134
438 Ga0111539_10052402 3300009094 Bacteria 4857
439 Ga0111539_10076125 3300009094 Bacteria 3952
440 Ga0111539_10113136 3300009094 Bacteria 3184
441 Ga0105245_10014889 3300009098 Bacteria 6774
442 Ga0105245_10054950 3300009098 Bacteria 3576
443 Ga0105247_10010424 3300009101 Bacteria 5618
444 Ga0105247_10027421 3300009101 Bacteria 3444
445 Ga0105247_10130989 3300009101 Bacteria 1635
446 Ga0114129_10000009 3300009147 Bacteria 149356
447 Ga0114129_10000337 3300009147 Bacteria 54884
448 Ga0114129_10120173 3300009147 Bacteria 3618
449 Ga0105243_10000915 3300009148 Bacteria 27703
450 Ga0105243_10001591 3300009148 Bacteria 19795
451 Ga0105243_10027411 3300009148 Bacteria 4365
452 Ga0105243_10137416 3300009148 Bacteria 2081
453 Ga0105243_10186934 3300009148 Bacteria 1806
454 Ga0105241_10002214 3300009174 Bacteria 14629
455 Ga0105241_10011671 3300009174 Bacteria 6448
456 Ga0105242_10000945 3300009176 Bacteria 22671
457 Ga0105242_10095819 3300009176 Bacteria 2506
458 Ga0105248_10004085 3300009177 Bacteria 16142
459 Ga0105248_10014014 3300009177 Bacteria 8821
460 Ga0105248_10036026 3300009177 Bacteria 5534
461 Ga0105237_10000806 3300009545 Bacteria 42774
462 Ga0105237_10037340 3300009545 Bacteria 4912
463 Ga0105237_10068354 3300009545 Bacteria 3546
464 Ga0105237_10083206 3300009545 Bacteria 3192
465 Ga0105237_10091804 3300009545 Bacteria 3026
466 Ga0105237_10112524 3300009545 Bacteria 2714
467 Ga0105237_10202255 3300009545 Bacteria 1986
468 Ga0105238_10014862 3300009551 Bacteria 7875
469 Ga0105238_10073324 3300009551 Bacteria 3418
470 Ga0105238_10077770 3300009551 Bacteria 3309
471 Ga0105249_10000975 3300009553 Bacteria 25356
472 Ga0105249_10006665 3300009553 Bacteria 10054
473 Ga0105249_10274324 3300009553 Bacteria 1681
474 Ga0105249_10313131 3300009553 Bacteria 1579
475 Ga0105249_10389405 3300009553 Bacteria 1422
476 Ga0105239_10000292 3300010375 Bacteria 73809
477 Ga0105239_10055870 3300010375 Bacteria 4331
478 Ga0105239_10065549 3300010375 Bacteria 3989
479 Ga0105239_10078771 3300010375 Bacteria 3626
480 Ga0105239_10099166 3300010375 Bacteria 3220
481 Ga0105239_10354637 3300010375 Bacteria 1656
482 Ga0105239_10419615 3300010375 Bacteria 1516
483 Ga0105246_10056261 3300011119 Bacteria 2718
484 Ga0105246_10093617 3300011119 Bacteria 2171
485 Ga0105246_10094888 3300011119 Bacteria 2159
486 Ga0105246_10181185 3300011119 Bacteria 1622
487 Ga0157373_10008298 3300013100 Bacteria 7717
488 Ga0157373_10009650 3300013100 Bacteria 7123
489 Ga0157373_10035104 3300013100 Bacteria 3601
490 Ga0157371_10000769 3300013102 Bacteria 37033
491 Ga0157370_10008286 3300013104 Bacteria 11216
492 Ga0157370_10008739 3300013104 Bacteria 10892
493 Ga0157370_10010979 3300013104 Bacteria 9500
494 Ga0157370_10012141 3300013104 Bacteria 8959
495 Ga0157370_10029684 3300013104 Bacteria 5363
496 Ga0157370_10056276 3300013104 Bacteria 3743
497 Ga0157370_10078446 3300013104 Bacteria 3110
498 Ga0157370_10176423 3300013104 Bacteria 1986
499 Ga0157369_10008103 3300013105 Bacteria 12040
500 Ga0157369_10044792 3300013105 Bacteria 4814
501 Ga0157369_10077758 3300013105 Bacteria 3556
502 Ga0157369_10156297 3300013105 Bacteria 2409
503 Ga0157369_10298009 3300013105 Bacteria 1678
504 Ga0157374_10001486 3300013296 Bacteria 19795
505 Ga0157374_10006780 3300013296 Bacteria 9737
506 Ga0157374_10046727 3300013296 Bacteria 4011
507 Ga0157374_10080670 3300013296 Bacteria 3086
508 Ga0157374_10356313 3300013296 Bacteria 1454
509 Ga0157378_10000844 3300013297 Bacteria 28388
510 Ga0157378_10079380 3300013297 Bacteria 2963
511 Ga0157378_10092014 3300013297 Bacteria 2758
512 Ga0157378_10192977 3300013297 Bacteria 1922
513 Ga0157378_10197493 3300013297 Bacteria 1901
514 Ga0163162_10005722 3300013306 Bacteria 12018
515 Ga0163162_10018632 3300013306 Bacteria 6802
516 Ga0163162_10074028 3300013306 Bacteria 3464
517 Ga0163162_10079077 3300013306 Bacteria 3355
518 Ga0163162_10140144 3300013306 Bacteria 2531
519 Ga0163162_10177704 3300013306 Bacteria 2254
520 Ga0163162_10251441 3300013306 Bacteria 1899
521 Ga0157372_10004681 3300013307 Bacteria 14529
522 Ga0157372_10006187 3300013307 Bacteria 12722
523 Ga0157372_10007871 3300013307 Bacteria 11328
524 Ga0157372_10024035 3300013307 Bacteria 6612
525 Ga0157372_10229700 3300013307 Bacteria 2151
526 Ga0157372_10360707 3300013307 Bacteria 1693
527 Ga0157375_10002482 3300013308 Bacteria 15973
528 Ga0157375_10021511 3300013308 Bacteria 5916
529 Ga0157375_10030198 3300013308 Bacteria 5108
530 Ga0157375_10031394 3300013308 Bacteria 5022
531 Ga0157375_10055972 3300013308 Bacteria 3891
532 Ga0157375_10073768 3300013308 Bacteria 3432
533 Ga0157375_10096977 3300013308 Bacteria 3022
534 Ga0157375_10373761 3300013308 Bacteria 1592
535 Ga0163163_10003555 3300014325 Bacteria 13230
536 Ga0163163_10007010 3300014325 Bacteria 9900
537 Ga0163163_10016615 3300014325 Bacteria 6842
538 Ga0163163_10028233 3300014325 Bacteria 5386
539 Ga0163163_10056064 3300014325 Bacteria 3895
540 Ga0163163_10103916 3300014325 Bacteria 2866
541 Ga0163163_10200477 3300014325 Bacteria 2044
542 Ga0157380_10002048 3300014326 Bacteria 13485
543 Ga0157380_10032105 3300014326 Bacteria 4036
544 Ga0157380_10032106 3300014326 Bacteria 4036
545 Ga0157380_10075159 3300014326 Bacteria 2745
546 Ga0157380_10093331 3300014326 Bacteria 2488
547 Ga0157380_10113689 3300014326 Bacteria 2280
548 Ga0182008_10021837 3300014497 Bacteria 3285
549 Ga0182008_10032465 3300014497 Bacteria 2623
550 Ga0182008_10049084 3300014497 Bacteria 2095
551 Ga0157377_10057796 3300014745 Bacteria 2207
552 Ga0157379_10000542 3300014968 Bacteria 30483
553 Ga0157379_10003892 3300014968 Bacteria 12729
554 Ga0157379_10045142 3300014968 Bacteria 3934
555 Ga0157379_10131429 3300014968 Bacteria 2253
556 Ga0157379_10151476 3300014968 Bacteria 2092
557 Ga0157379_10306548 3300014968 Bacteria 1448
558 Ga0157376_10010104 3300014969 Bacteria 6892
559 Ga0157376_10060761 3300014969 Bacteria 3175
560 Ga0157376_10065423 3300014969 Bacteria 3070
561 Ga0182006_1003114 3300015261 Bacteria 8686
562 Ga0183362_10004 3300015683 Bacteria 569303
563 Ga0163161_10000198 3300017792 Bacteria 55260
564 Ga0163161_10004824 3300017792 Bacteria 9395
565 Ga0163161_10054872 3300017792 Bacteria 2892
566 Ga0163161_10087527 3300017792 Bacteria 2301
567 Ga0163161_10103861 3300017792 Bacteria 2118
568 Ga0163161_10124173 3300017792 Bacteria 1942
569 Ga0163161_10131830 3300017792 Bacteria 1886
570 Ga0197907_11408047 3300020069 Bacteria 1540
571 Ga0213874_10027747 3300021377 Bacteria 1613
572 Ga0213876_10067981 3300021384 Bacteria 1882
573 Ga0213871_10004080 3300021441 Bacteria 2886
574 Ga0224712_10020465 3300022467 Bacteria 2247
575 Ga0209435_100007 3300025206 Bacteria 516857
576 Ga0209436_105003 3300025208 Bacteria 3152
577 Ga0209147_100017 3300025229 Bacteria 516857
578 Ga0209563_101866 3300025230 Bacteria 5126
579 Ga0209437_100272 3300025233 Bacteria 77336
580 Ga0209258_100297 3300025242 Bacteria 81353
581 Ga0207425_1000697 3300025245 Bacteria 18206
582 Ga0209646_1000061 3300025246 Bacteria 255495
583 Ga0209646_1000096 3300025246 Bacteria 182388
584 Ga0209026_1000052 3300025250 Bacteria 248897
585 Ga0209026_1002209 3300025250 Bacteria 7522
586 Ga0209677_102108 3300025253 Bacteria 7820
587 Ga0209677_105443 3300025253 Bacteria 3318
588 Ga0209148_1000500 3300025254 Bacteria 39994
589 Ga0209759_1000174 3300025256 Bacteria 107149
590 Ga0209759_1000537 3300025256 Bacteria 39856
591 Ga0209129_1000168 3300025258 Bacteria 96922
592 Ga0209129_1001716 3300025258 Bacteria 11808
593 Ga0209233_1001496 3300025261 Bacteria 9193
594 Ga0209233_1012236 3300025261 Bacteria 2493
595 Ga0209565_1000078 3300025263 Bacteria 160838
596 Ga0209565_1000350 3300025263 Bacteria 40579
597 Ga0209565_1000992 3300025263 Bacteria 14592
598 Ga0209455_1006056 3300025272 Bacteria 3634
599 Ga0209455_1009658 3300025272 Bacteria 2513
600 Ga0209673_1000516 3300025273 Bacteria 63268
601 Ga0209673_1000627 3300025273 Bacteria 53883
602 Ga0209673_1010584 3300025273 Bacteria 3873
603 Ga0209130_1000440 3300025284 Bacteria 44209
604 Ga0209130_1000798 3300025284 Bacteria 26769
605 Ga0209130_1001805 3300025284 Bacteria 12467
606 Ga0209130_1008121 3300025284 Bacteria 3139
607 Ga0209675_1000355 3300025291 Bacteria 39556
608 Ga0209675_1000916 3300025291 Bacteria 18805
609 Ga0209675_1000925 3300025291 Bacteria 18727
610 Ga0209675_1002231 3300025291 Bacteria 10121
611 Ga0209675_1005267 3300025291 Bacteria 5458
612 Ga0209676_1000312 3300025292 Bacteria 95234
613 Ga0209676_1000403 3300025292 Bacteria 78171
614 Ga0209676_1003118 3300025292 Bacteria 10641
615 Ga0209676_1041466 3300025292 Bacteria 1286
616 Ga0209025_1000242 3300025294 Bacteria 128169
617 Ga0209025_1000378 3300025294 Bacteria 92632
618 Ga0209025_1001004 3300025294 Bacteria 41792
619 Ga0209025_1065104 3300025294 Bacteria 1333
620 Ga0209564_1000157 3300025295 Bacteria 164758
621 Ga0209564_1006742 3300025295 Bacteria 6097
622 Ga0209758_1000042 3300025297 Bacteria 407145
623 Ga0209758_1002409 3300025297 Bacteria 19162
624 Ga0209758_1012843 3300025297 Bacteria 4639
625 Ga0209050_1001555 3300025298 Bacteria 23938
626 Ga0209050_1002543 3300025298 Bacteria 15245
627 Ga0209256_1000724 3300025299 Bacteria 43561
628 Ga0209256_1035123 3300025299 Bacteria 1327
629 Ga0207426_1000055 3300025302 Bacteria 374450
630 Ga0207426_1000238 3300025302 Bacteria 124393
631 Ga0207426_1000428 3300025302 Bacteria 68777
632 Ga0207426_1002351 3300025302 Bacteria 12330
633 Ga0207426_1030684 3300025302 Bacteria 1761
634 Ga0207426_1037474 3300025302 Bacteria 1533
635 Ga0209051_1000286 3300025303 Bacteria 81784
636 Ga0209051_1000376 3300025303 Bacteria 63531
637 Ga0209051_1000655 3300025303 Bacteria 39161
638 Ga0209051_1005994 3300025303 Bacteria 6947
639 Ga0209051_1007305 3300025303 Bacteria 6063
640 Ga0209257_1000215 3300025304 Bacteria 136521
641 Ga0209257_1002370 3300025304 Bacteria 18884
642 Ga0209257_1011096 3300025304 Bacteria 4410
643 Ga0209257_1012170 3300025304 Bacteria 4022
644 Ga0209257_1022478 3300025304 Bacteria 2249
645 Ga0209257_1023675 3300025304 Bacteria 2152
646 Ga0207697_10014602 3300025315 Bacteria 3255
647 Ga0207697_10029265 3300025315 Bacteria 2253
648 Ga0207656_10016183 3300025321 Bacteria 2900
649 Ga0207655_1003433 3300025728 Bacteria 11793
650 Ga0207713_1016034 3300025735 Bacteria 3819
651 Ga0207682_10012567 3300025893 Bacteria 3305
652 Ga0207692_10000845 3300025898 Bacteria 10979
653 Ga0207692_10004717 3300025898 Bacteria 5410
654 Ga0207642_10008441 3300025899 Bacteria 3534
655 Ga0207642_10105054 3300025899 Bacteria 1426
656 Ga0207688_10072893 3300025901 Bacteria 1951
657 Ga0207680_10048692 3300025903 Bacteria 2519
658 Ga0207680_10050541 3300025903 Bacteria 2481
659 Ga0207647_10006516 3300025904 Bacteria 8486
660 Ga0207647_10045018 3300025904 Bacteria 2754
661 Ga0207685_10004501 3300025905 Bacteria 3554
662 Ga0207699_10004348 3300025906 Bacteria 6777
663 Ga0207699_10008314 3300025906 Bacteria 5115
664 Ga0207645_10000187 3300025907 Bacteria 49829
665 Ga0207645_10000236 3300025907 Bacteria 45713
666 Ga0207645_10037265 3300025907 Bacteria 3120
667 Ga0207645_10088550 3300025907 Bacteria 1990
668 Ga0207645_10109515 3300025907 Bacteria 1787
669 Ga0207643_10022515 3300025908 Bacteria 3469
670 Ga0207643_10068297 3300025908 Bacteria 2042
671 Ga0207654_10007014 3300025911 Bacteria 5674
672 Ga0207654_10014569 3300025911 Bacteria 4063
673 Ga0207654_10122401 3300025911 Bacteria 1636
674 Ga0207707_10007114 3300025912 Bacteria 9748
675 Ga0207707_10007388 3300025912 Bacteria 9570
676 Ga0207707_10017925 3300025912 Bacteria 6173
677 Ga0207707_10068237 3300025912 Bacteria 3098
678 Ga0207695_10000008 3300025913 Bacteria 1058268
679 Ga0207695_10000615 3300025913 Bacteria 71501
680 Ga0207695_10025000 3300025913 Bacteria 6700
681 Ga0207695_10049084 3300025913 Bacteria 4452
682 Ga0207695_10099403 3300025913 Bacteria 2907
683 Ga0207695_10159680 3300025913 Bacteria 2187
684 Ga0207695_10167863 3300025913 Bacteria 2122
685 Ga0207695_10216393 3300025913 Bacteria 1825
686 Ga0207695_10241549 3300025913 Bacteria 1707
687 Ga0207671_10011165 3300025914 Bacteria 7335
688 Ga0207671_10030267 3300025914 Bacteria 4038
689 Ga0207671_10048900 3300025914 Bacteria 3130
690 Ga0207671_10056947 3300025914 Bacteria 2897
691 Ga0207693_10001388 3300025915 Bacteria 21472
692 Ga0207693_10002380 3300025915 Bacteria 16317
693 Ga0207693_10019236 3300025915 Bacteria 5435
694 Ga0207693_10236822 3300025915 Bacteria 1433
695 Ga0207663_10000515 3300025916 Bacteria 16967
696 Ga0207663_10043229 3300025916 Bacteria 2757
697 Ga0207663_10124966 3300025916 Bacteria 1768
698 Ga0207660_10012876 3300025917 Bacteria 5477
699 Ga0207660_10035751 3300025917 Bacteria 3451
700 Ga0207660_10042551 3300025917 Bacteria 3189
701 Ga0207660_10047995 3300025917 Bacteria 3021
702 Ga0207660_10090458 3300025917 Bacteria 2268
703 Ga0207662_10000233 3300025918 Bacteria 25755
704 Ga0207657_10000102 3300025919 Bacteria 82096
705 Ga0207657_10000250 3300025919 Bacteria 57310
706 Ga0207657_10004866 3300025919 Bacteria 14133
707 Ga0207657_10007662 3300025919 Bacteria 11045
708 Ga0207657_10020898 3300025919 Bacteria 6178
709 Ga0207657_10036021 3300025919 Bacteria 4432
710 Ga0207657_10062444 3300025919 Bacteria 3189
711 Ga0207657_10066317 3300025919 Bacteria 3073
712 Ga0207649_10030080 3300025920 Bacteria 3213
713 Ga0207652_10003521 3300025921 Bacteria 12909
714 Ga0207652_10007056 3300025921 Bacteria 9054
715 Ga0207652_10196633 3300025921 Bacteria 1814
716 Ga0207646_10068594 3300025922 Bacteria 3167
717 Ga0207646_10153213 3300025922 Bacteria 2079
718 Ga0207646_10185421 3300025922 Bacteria 1879
719 Ga0207646_10321466 3300025922 Bacteria 1398
720 Ga0207681_10001251 3300025923 Bacteria 16395
721 Ga0207681_10005840 3300025923 Bacteria 7546
722 Ga0207681_10028920 3300025923 Bacteria 3594
723 Ga0207681_10046404 3300025923 Bacteria 2922
724 Ga0207681_10074720 3300025923 Bacteria 2375
725 Ga0207681_10265589 3300025923 Bacteria 1345
726 Ga0207694_10055785 3300025924 Bacteria 3067
727 Ga0207694_10066581 3300025924 Bacteria 2810
728 Ga0207694_10332411 3300025924 Bacteria 1256
729 Ga0207650_10005839 3300025925 Bacteria 8400
730 Ga0207650_10015099 3300025925 Bacteria 5373
731 Ga0207650_10018209 3300025925 Bacteria 4926
732 Ga0207650_10036293 3300025925 Bacteria 3586
733 Ga0207659_10005194 3300025926 Bacteria 7884
734 Ga0207659_10017441 3300025926 Bacteria 4691
735 Ga0207659_10017845 3300025926 Bacteria 4643
736 Ga0207659_10030124 3300025926 Bacteria 3704
737 Ga0207659_10074910 3300025926 Bacteria 2482
738 Ga0207687_10000552 3300025927 Bacteria 25163
739 Ga0207687_10002722 3300025927 Bacteria 11964
740 Ga0207687_10019251 3300025927 Bacteria 4520
741 Ga0207687_10030964 3300025927 Bacteria 3613
742 Ga0207687_10033203 3300025927 Bacteria 3499
743 Ga0207687_10174019 3300025927 Bacteria 1662
744 Ga0207700_10000062 3300025928 Bacteria 66509
745 Ga0207700_10027270 3300025928 Bacteria 3998
746 Ga0207700_10036858 3300025928 Bacteria 3536
747 Ga0207700_10173653 3300025928 Bacteria 1800
748 Ga0207664_10001592 3300025929 Bacteria 14920
749 Ga0207664_10008636 3300025929 Bacteria 7121
750 Ga0207664_10023886 3300025929 Bacteria 4587
751 Ga0207664_10081537 3300025929 Bacteria 2633
752 Ga0207644_10008758 3300025931 Bacteria 6624
753 Ga0207644_10009820 3300025931 Bacteria 6294
754 Ga0207644_10026050 3300025931 Bacteria 4026
755 Ga0207644_10034755 3300025931 Bacteria 3528
756 Ga0207644_10089922 3300025931 Bacteria 2286
757 Ga0207644_10124426 3300025931 Bacteria 1967
758 Ga0207690_10001799 3300025932 Bacteria 13173
759 Ga0207690_10182296 3300025932 Bacteria 1582
760 Ga0207690_10237399 3300025932 Bacteria 1402
761 Ga0207706_10000095 3300025933 Bacteria 92378
762 Ga0207706_10015953 3300025933 Bacteria 6788
763 Ga0207706_10027452 3300025933 Bacteria 5089
764 Ga0207706_10030841 3300025933 Bacteria 4781
765 Ga0207706_10118637 3300025933 Bacteria 2326
766 Ga0207706_10165670 3300025933 Bacteria 1942
767 Ga0207686_10000989 3300025934 Bacteria 16915
768 Ga0207709_10000092 3300025935 Bacteria 139154
769 Ga0207709_10001455 3300025935 Bacteria 16481
770 Ga0207709_10006663 3300025935 Bacteria 6478
771 Ga0207709_10060202 3300025935 Bacteria 2366
772 Ga0207670_10003492 3300025936 Bacteria 8342
773 Ga0207669_10003427 3300025937 Bacteria 6858
774 Ga0207669_10006265 3300025937 Bacteria 5421
775 Ga0207704_10000547 3300025938 Bacteria 16748
776 Ga0207704_10002119 3300025938 Bacteria 8893
777 Ga0207704_10042711 3300025938 Bacteria 2670
778 Ga0207665_10011003 3300025939 Bacteria 5938
779 Ga0207665_10015264 3300025939 Bacteria 5044
780 Ga0207665_10044837 3300025939 Bacteria 2959
781 Ga0207665_10160962 3300025939 Bacteria 1614
782 Ga0207691_10000305 3300025940 Bacteria 48776
783 Ga0207691_10001872 3300025940 Bacteria 20567
784 Ga0207691_10006614 3300025940 Bacteria 11192
785 Ga0207691_10007383 3300025940 Bacteria 10591
786 Ga0207691_10008924 3300025940 Bacteria 9624
787 Ga0207691_10022644 3300025940 Bacteria 5925
788 Ga0207691_10030534 3300025940 Bacteria 5035
789 Ga0207691_10030672 3300025940 Bacteria 5022
790 Ga0207691_10046211 3300025940 Bacteria 4003
791 Ga0207691_10056047 3300025940 Bacteria 3591
792 Ga0207691_10087765 3300025940 Bacteria 2790
793 Ga0207691_10159818 3300025940 Bacteria 1977
794 Ga0207691_10198110 3300025940 Bacteria 1749
795 Ga0207711_10001126 3300025941 Bacteria 25546
796 Ga0207711_10020916 3300025941 Bacteria 5462
797 Ga0207711_10050804 3300025941 Bacteria 3550
798 Ga0207689_10002282 3300025942 Bacteria 17945
799 Ga0207689_10002780 3300025942 Bacteria 16182
800 Ga0207689_10004782 3300025942 Bacteria 12211
801 Ga0207689_10020951 3300025942 Bacteria 5495
802 Ga0207689_10025866 3300025942 Bacteria 4916
803 Ga0207689_10069380 3300025942 Bacteria 2896
804 Ga0207689_10121118 3300025942 Bacteria 2152
805 Ga0207679_10016304 3300025945 Bacteria 4932
806 Ga0207679_10107154 3300025945 Bacteria 2198
807 Ga0207679_10152752 3300025945 Bacteria 1881
808 Ga0207679_10260121 3300025945 Bacteria 1480
809 Ga0207667_10004358 3300025949 Bacteria 17337
810 Ga0207667_10009599 3300025949 Bacteria 11387
811 Ga0207667_10017754 3300025949 Bacteria 8002
812 Ga0207667_10073105 3300025949 Bacteria 3563
813 Ga0207667_10089507 3300025949 Bacteria 3181
814 Ga0207667_10101035 3300025949 Bacteria 2975
815 Ga0207667_10152756 3300025949 Bacteria 2376
816 Ga0207667_10174570 3300025949 Bacteria 2208
817 Ga0207651_10002756 3300025960 Bacteria 8438
818 Ga0207651_10018649 3300025960 Bacteria 4136
819 Ga0207651_10032573 3300025960 Bacteria 3350
820 Ga0207651_10033399 3300025960 Bacteria 3318
821 Ga0207651_10037613 3300025960 Bacteria 3172
822 Ga0207651_10113146 3300025960 Bacteria 2042
823 Ga0207651_10172911 3300025960 Bacteria 1705
824 Ga0207651_10240589 3300025960 Bacteria 1475
825 Ga0207712_10002814 3300025961 Bacteria 11139
826 Ga0207712_10151136 3300025961 Bacteria 1793
827 Ga0207668_10005820 3300025972 Bacteria 7262
828 Ga0207668_10007591 3300025972 Bacteria 6456
829 Ga0207668_10011214 3300025972 Bacteria 5440
830 Ga0207668_10019431 3300025972 Bacteria 4296
831 Ga0207668_10050285 3300025972 Bacteria 2872
832 Ga0207668_10082183 3300025972 Bacteria 2339
833 Ga0207668_10102095 3300025972 Bacteria 2133
834 Ga0207668_10121507 3300025972 Bacteria 1978
835 Ga0207640_10035942 3300025981 Bacteria 3105
836 Ga0207640_10054084 3300025981 Bacteria 2624
837 Ga0207640_10059190 3300025981 Bacteria 2527
838 Ga0207640_10083649 3300025981 Bacteria 2189
839 Ga0207658_10004062 3300025986 Bacteria 10216
840 Ga0207658_10013833 3300025986 Bacteria 5521
841 Ga0207658_10146753 3300025986 Bacteria 1917
842 Ga0207677_10000926 3300026023 Bacteria 16380
843 Ga0207677_10005445 3300026023 Bacteria 6911
844 Ga0207677_10006472 3300026023 Bacteria 6430
845 Ga0207677_10010738 3300026023 Bacteria 5191
846 Ga0207677_10031143 3300026023 Bacteria 3414
847 Ga0207703_10000552 3300026035 Bacteria 38477
848 Ga0207703_10001501 3300026035 Bacteria 21293
849 Ga0207703_10016718 3300026035 Bacteria 5722
850 Ga0207703_10077643 3300026035 Bacteria 2757
851 Ga0207639_10044654 3300026041 Bacteria 3333
852 Ga0207639_10045118 3300026041 Bacteria 3318
853 Ga0207639_10048208 3300026041 Bacteria 3223
854 Ga0207639_10074437 3300026041 Bacteria 2667
855 Ga0207639_10139600 3300026041 Bacteria 2017
856 Ga0207639_10228656 3300026041 Bacteria 1611
857 Ga0207678_10020643 3300026067 Bacteria 5775
858 Ga0207678_10036306 3300026067 Bacteria 4290
859 Ga0207678_10094994 3300026067 Bacteria 2547
860 Ga0207678_10099182 3300026067 Bacteria 2488
861 Ga0207708_10002518 3300026075 Bacteria 13474
862 Ga0207708_10004176 3300026075 Bacteria 10616
863 Ga0207708_10082165 3300026075 Bacteria 2476
864 Ga0207702_10001309 3300026078 Bacteria 24941
865 Ga0207702_10021617 3300026078 Bacteria 5328
866 Ga0207702_10025993 3300026078 Bacteria 4860
867 Ga0207702_10062465 3300026078 Bacteria 3181
868 Ga0207702_10089750 3300026078 Bacteria 2688
869 Ga0207702_10169036 3300026078 Bacteria 2003
870 Ga0207641_10010854 3300026088 Bacteria 7462
871 Ga0207641_10040599 3300026088 Bacteria 3897
872 Ga0207641_10050538 3300026088 Bacteria 3517
873 Ga0207641_10050730 3300026088 Bacteria 3511
874 Ga0207641_10065372 3300026088 Bacteria 3111
875 Ga0207641_10074094 3300026088 Bacteria 2936
876 Ga0207641_10132086 3300026088 Bacteria 2243
877 Ga0207641_10264493 3300026088 Bacteria 1612
878 Ga0207648_10002355 3300026089 Bacteria 20391
879 Ga0207648_10004793 3300026089 Bacteria 13810
880 Ga0207648_10008777 3300026089 Bacteria 9739
881 Ga0207648_10012840 3300026089 Bacteria 7823
882 Ga0207648_10013617 3300026089 Bacteria 7552
883 Ga0207648_10014379 3300026089 Bacteria 7313
884 Ga0207648_10023176 3300026089 Bacteria 5568
885 Ga0207648_10033406 3300026089 Bacteria 4538
886 Ga0207648_10074787 3300026089 Bacteria 2953
887 Ga0207648_10147770 3300026089 Bacteria 2073
888 Ga0207648_10334233 3300026089 Bacteria 1363
889 Ga0207676_10001004 3300026095 Bacteria 21721
890 Ga0207676_10006584 3300026095 Bacteria 8214
891 Ga0207676_10029335 3300026095 Bacteria 4117
892 Ga0207676_10032673 3300026095 Bacteria 3924
893 Ga0207676_10039828 3300026095 Bacteria 3598
894 Ga0207676_10061120 3300026095 Bacteria 2982
895 Ga0207676_10149817 3300026095 Bacteria 2008
896 Ga0207676_10181790 3300026095 Bacteria 1842
897 Ga0207674_10000131 3300026116 Bacteria 88017
898 Ga0207674_10000326 3300026116 Bacteria 60670
899 Ga0207674_10007985 3300026116 Bacteria 12281
900 Ga0207674_10017015 3300026116 Bacteria 7938
901 Ga0207674_10018761 3300026116 Bacteria 7506
902 Ga0207674_10101788 3300026116 Bacteria 2853
903 Ga0207674_10108501 3300026116 Bacteria 2752
904 Ga0207675_100001604 3300026118 Bacteria 22664
905 Ga0207675_100003012 3300026118 Bacteria 16522
906 Ga0207675_100003839 3300026118 Bacteria 14619
907 Ga0207675_100005164 3300026118 Bacteria 12569
908 Ga0207675_100063462 3300026118 Bacteria 3451
909 Ga0207675_100144245 3300026118 Bacteria 2263
910 Ga0207675_100265152 3300026118 Bacteria 1666
911 Ga0207683_10000012 3300026121 Bacteria 134768
912 Ga0207683_10001281 3300026121 Bacteria 22746
913 Ga0207683_10001607 3300026121 Bacteria 20316
914 Ga0207683_10003558 3300026121 Bacteria 13588
915 Ga0207683_10024843 3300026121 Bacteria 5163
916 Ga0207683_10025806 3300026121 Bacteria 5069
917 Ga0207683_10070414 3300026121 Bacteria 3090
918 Ga0207683_10083926 3300026121 Bacteria 2831
919 Ga0207683_10182154 3300026121 Bacteria 1905
920 Ga0207698_10010991 3300026142 Bacteria 5851
921 Ga0207698_10023151 3300026142 Bacteria 4334
922 Ga0207698_10024354 3300026142 Bacteria 4247
923 Ga0207698_10035244 3300026142 Bacteria 3658
924 Ga0207698_10075023 3300026142 Bacteria 2700
925 Ga0209389_1000107 3300027296 Bacteria 74129
926 Ga0209389_1002563 3300027296 Bacteria 14077
927 Ga0209589_1000011 3300027357 Bacteria 236981
928 Ga0209589_1000036 3300027357 Bacteria 131278
929 Ga0209969_1005608 3300027360 Bacteria 1765
930 Ga0209489_100006 3300027361 Bacteria 475698
931 Ga0209489_100012 3300027361 Bacteria 236981
932 Ga0209489_115889 3300027361 Bacteria 4339
933 Ga0209489_115890 3300027361 Bacteria 4339
934 Ga0209700_100005 3300027363 Bacteria 573969
935 Ga0209700_100019 3300027363 Bacteria 236981
936 Ga0209967_1000511 3300027364 Bacteria 5096
937 Ga0209981_1001823 3300027378 Bacteria 2703
938 Ga0210000_1002564 3300027462 Bacteria 2592
939 Ga0209995_1001143 3300027471 Bacteria 4078
940 Ga0209968_1003859 3300027526 Bacteria 2250
941 Ga0209999_1001594 3300027543 Bacteria 3905
942 Ga0209999_1012519 3300027543 Bacteria 1537
943 Ga0209282_1021775 3300027666 Bacteria 4046
944 Ga0209971_1003964 3300027682 Bacteria 3503
945 Ga0209813_10010027 3300027866 Bacteria 2439
946 Ga0209974_10000445 3300027876 Bacteria 13695
947 Ga0207428_10000610 3300027907 Bacteria 42207
948 Ga0207428_10006909 3300027907 Bacteria 10401
949 Ga0268266_10002874 3300028379 Bacteria 17897
950 Ga0268266_10006338 3300028379 Bacteria 10846
951 Ga0268266_10012839 3300028379 Bacteria 7232
952 Ga0268266_10015598 3300028379 Bacteria 6512
953 Ga0268266_10034249 3300028379 Bacteria 4319
954 Ga0268266_10042648 3300028379 Bacteria 3876
955 Ga0268266_10200834 3300028379 Bacteria 1825
956 Ga0268266_10206171 3300028379 Bacteria 1801
957 Ga0268266_10247698 3300028379 Bacteria 1647
958 Ga0268265_10001521 3300028380 Bacteria 19348
959 Ga0268265_10003158 3300028380 Bacteria 11997
960 Ga0268265_10014343 3300028380 Bacteria 5397
961 Ga0268265_10021079 3300028380 Bacteria 4559
962 Ga0268265_10053207 3300028380 Bacteria 3066
963 Ga0268264_10000940 3300028381 Bacteria 30212
964 Ga0268264_10002908 3300028381 Bacteria 14883
965 Ga0268264_10023563 3300028381 Bacteria 5019
966 Ga0268264_10026248 3300028381 Bacteria 4758
967 Ga0268264_10075073 3300028381 Bacteria 2874
968 Ga0268264_10080564 3300028381 Bacteria 2780
969 Ga0268264_10092250 3300028381 Bacteria 2614
970 Ga0268264_10242934 3300028381 Bacteria 1669
971 Ga0268264_10326908 3300028381 Bacteria 1452
972 Ga0265334_10006395 3300028573 Bacteria 5079
973 Ga0307517_10002655 3300028786 Bacteria 28561
974 Ga0307517_10096177 3300028786 Bacteria 2375
975 Ga0307517_10146755 3300028786 Bacteria 1634
976 Ga0307515_10000043 3300028794 Bacteria 304612
977 Ga0307515_10000997 3300028794 Bacteria 64733
978 Ga0307515_10005007 3300028794 Bacteria 27028
979 Ga0307515_10034195 3300028794 Bacteria 8334
980 Ga0307515_10104042 3300028794 Bacteria 3397
981 Ga0316177_1144764 3300030731 Bacteria 3679
982 Ga0314311_1228247 3300030733 Bacteria 4335
983 Ga0316178_1010387 3300030735 Bacteria 4481
984 Ga0316183_1086850 3300030742 Bacteria 2106
985 Ga0316181_1069579 3300030744 Bacteria 2120
986 Ga0265332_10004724 3300031238 Bacteria 6353
987 Ga0265329_10002279 3300031242 Bacteria 8800
988 Ga0265339_10054753 3300031249 Bacteria 2166
989 Ga0265331_10000350 3300031250 Bacteria 48905
990 Ga0265327_10008774 3300031251 Bacteria 7461
991 Ga0307513_10000034 3300031456 Bacteria 185012
992 Ga0307513_10002789 3300031456 Bacteria 23982
993 Ga0307513_10009006 3300031456 Bacteria 12664
994 Ga0307513_10029154 3300031456 Bacteria 6296
995 Ga0307509_10004612 3300031507 Bacteria 19754
996 Ga0307509_10005248 3300031507 Bacteria 18145
997 Ga0307509_10012825 3300031507 Bacteria 9976
998 Ga0307509_10122339 3300031507 Bacteria 2577
999 Ga0307408_100000548 3300031548 Bacteria 32373
1000 Ga0307408_100026129 3300031548 Bacteria 4005
1001 Ga0307408_100028905 3300031548 Bacteria 3835
1002 Ga0307408_100160228 3300031548 Bacteria 1786
1003 Ga0307408_100335977 3300031548 Bacteria 1277
1004 Ga0307508_10000450 3300031616 Bacteria 49283
1005 Ga0265314_10000412 3300031711 Bacteria 57508
1006 Ga0307516_10000851 3300031730 Bacteria 41827
1007 Ga0307516_10003913 3300031730 Bacteria 18775
1008 Ga0307516_10004352 3300031730 Bacteria 17513
1009 Ga0307516_10016764 3300031730 Bacteria 7650
1010 Ga0307516_10021101 3300031730 Bacteria 6715
1011 Ga0307405_10003700 3300031731 Bacteria 7094
1012 Ga0307405_10062009 3300031731 Bacteria 2366
1013 Ga0307405_10075847 3300031731 Bacteria 2179
1014 Ga0307413_10014837 3300031824 Bacteria 3973
1015 Ga0307413_10034139 3300031824 Bacteria 2904
1016 Ga0307410_10004349 3300031852 Bacteria 7309
1017 Ga0307406_10000252 3300031901 Bacteria 32401
1018 Ga0307406_10003266 3300031901 Bacteria 8836
1019 Ga0307407_10003718 3300031903 Bacteria 6330
1020 Ga0307407_10037735 3300031903 Bacteria 2672
1021 Ga0307412_10002295 3300031911 Bacteria 10590
1022 Ga0307412_10021748 3300031911 Bacteria 3922
1023 Ga0307412_10041107 3300031911 Bacteria 2994
1024 Ga0307412_10047853 3300031911 Bacteria 2810
1025 Ga0307412_10245617 3300031911 Bacteria 1387
1026 Ga0307412_10247899 3300031911 Bacteria 1381
1027 Ga0307409_100002844 3300031995 Bacteria 9155
1028 Ga0307409_100146642 3300031995 Bacteria 2042
1029 Ga0307409_100180960 3300031995 Bacteria 1866
1030 Ga0307409_100184763 3300031995 Bacteria 1849
1031 Ga0307409_100240104 3300031995 Bacteria 1649
1032 Ga0307416_100184015 3300032002 Bacteria 1961
1033 Ga0307416_100226173 3300032002 Bacteria 1799
1034 Ga0307416_100240084 3300032002 Bacteria 1755
1035 Ga0307414_10110857 3300032004 Bacteria 2088
1036 Ga0307414_10125952 3300032004 Bacteria 1979
1037 Ga0307411_10007755 3300032005 Bacteria 5501
1038 Ga0307411_10140477 3300032005 Bacteria 1780
1039 Ga0307415_100011785 3300032126 Bacteria 5022
1040 Ga0307415_100173912 3300032126 Bacteria 1682
1041 Ga0316583_10012723 3300032133 Bacteria 3036
1042 Ga0307507_10047573 3300033179 Bacteria 4186
1043 Ga0307510_10000109 3300033180 Bacteria 65353
1044 Ga0307510_10014792 3300033180 Bacteria 9235
1045 Ga0315911_1000003 3300033442 Bacteria 502217
1046 Ga0373926_0020461 3300035083 Bacteria 2286
1047 Ga0373926_0053100 3300035083 Bacteria 1466
1048 Ga0373934_0000122 3300035086 Bacteria 28187
1049 Ga0373934_0003712 3300035086 Bacteria 5620
1050 Ga0373940_0014767 3300035088 Bacteria 1910
1051 Ga0373944_0002441 3300035089 Bacteria 4719
1052 Ga0373944_0017518 3300035089 Bacteria 2035
1053 Ga0373944_0025274 3300035089 Bacteria 1747
1054 Ga0373951_0019282 3300035091 Bacteria 1554
1055 Ga0373923_0001868 3300035111 Bacteria 6268
1056 Ga0373923_0057258 3300035111 Bacteria 1648
1057 Ga0373932_0007459 3300035112 Bacteria 2603
1058 Ga0373936_0014020 3300035113 Bacteria 3061
1059 Ga0373939_0017052 3300035114 Bacteria 1924
1060 Ga0373945_0002362 3300035116 Bacteria 5921
1061 Ga0373945_0010415 3300035116 Bacteria 3061
1062 Ga0373953_0003552 3300035117 Bacteria 4875
1063 Ga0373954_0000174 3300035118 Bacteria 23102
1064 Ga0373954_0000449 3300035118 Bacteria 15402
1065 Ga0373954_0002684 3300035118 Bacteria 7486
1066 Ga0373954_0007283 3300035118 Bacteria 4836
1067 Ga0373954_0008944 3300035118 Bacteria 4407
1068 Ga0373954_0055388 3300035118 Bacteria 1866
1069 Ga0373956_0000054 3300035119 Bacteria 38916
1070 Ga0373956_0014793 3300035119 Bacteria 3262
1071 Ga0373957_0001739 3300035120 Bacteria 5997
1072 Ga0373957_0003860 3300035120 Bacteria 4494
1073 Ga0373957_0004716 3300035120 Bacteria 4170
1074 Ga0373943_0004691 3300035170 Bacteria 6182
1075 Ga0373955_0002291 3300035172 Bacteria 8323
1076 Ga0373955_0031289 3300035172 Bacteria 2786
1077 Ga0373955_0079730 3300035172 Bacteria 1848
1078 Ga0373942_0017293 3300035207 Bacteria 1776
1079 Ga0373962_0005867 3300035242 Bacteria 2964
1080 Ga0373924_0003449 3300035410 Bacteria 5440
1081 Ga0373924_0006114 3300035410 Bacteria 4297
1082 Ga0373924_0019126 3300035410 Bacteria 2650
1083 Ga0373924_0073167 3300035410 Bacteria 1448
1084 Ga0373931_0006471 3300035691 Bacteria 5476
1085 Ga0373935_0007402 3300035692 Bacteria 6570
1086 Ga0373935_0007934 3300035692 Bacteria 6368
1087 Ga0373935_0011968 3300035692 Bacteria 5212
1088 Ga0373935_0065650 3300035692 Bacteria 2330
1089 Ga0373935_0065896 3300035692 Bacteria 2325
1090 Ga0373927_0005049 3300035695 Bacteria 9136
1091 Ga0373927_0008390 3300035695 Bacteria 6949
1092 Ga0373927_0010118 3300035695 Bacteria 6308
1093 Ga0373927_0029106 3300035695 Bacteria 3599
1094 Ga0373927_0034249 3300035695 Bacteria 3304
1095 Ga0373927_0049493 3300035695 Bacteria 2717
1096 Ga0373927_0091638 3300035695 Bacteria 1974
1097 Ga0373933_0000782 3300035724 Bacteria 19413
1098 Ga0373933_0008072 3300035724 Bacteria 5746
1099 Ga0373933_0012960 3300035724 Bacteria 4612
1100 Ga0373933_0088040 3300035724 Bacteria 1913
1101 Ga0373933_0178186 3300035724 Bacteria 1355
1102 Ga0373947_0015681 3300035725 Bacteria 4353
1103 Ga0373947_0098568 3300035725 Bacteria 1833
1104 Ga0373937_0000590 3300036401 Bacteria 32251
1105 Ga0373937_0001198 3300036401 Bacteria 21774
1106 Ga0373937_0022602 3300036401 Bacteria 5656
1107 Ga0373937_0035822 3300036401 Bacteria 4519
1108 Ga0373937_0286396 3300036401 Bacteria 1556
1109 Ga0316582_0005485 3300036647 Bacteria 6541
1110 Ga0373925_0009683 3300037068 Bacteria 7010
1111 Ga0373925_0016652 3300037068 Bacteria 5324
1112 Ga0373925_0105673 3300037068 Bacteria 2170
1113 Ga0373925_0128155 3300037068 Bacteria 1976
1114 Ga0373925_0172471 3300037068 Bacteria 1708
1115 Ga0395899_0187655 3300037312 Bacteria 1448
1116 Ga0395900_0001586 3300037418 Bacteria 26897
1117 Ga0395900_0054523 3300037418 Bacteria 4116
1118 Ga0395900_0070956 3300037418 Bacteria 3580
1119 Ga0395898_0018855 3300037466 Bacteria 7030
1120 Ga0395898_0031129 3300037466 Bacteria 5335
1121 Ga0395898_0035905 3300037466 Bacteria 4925
1122 Ga0395898_0067374 3300037466 Bacteria 3466
1123 Ga0395898_0098090 3300037466 Bacteria 2814
1124 Ga0395898_0123792 3300037466 Bacteria 2477
1125 Ga0395898_0205184 3300037466 Bacteria 1881
1126 Ga0395905_0055068 3300037471 Bacteria 3723
1127 Ga0395905_0203655 3300037471 Bacteria 1855
1128 Ga0395905_0285136 3300037471 Bacteria 1538
1129 Ga0316581_0006616 3300037588 Bacteria 3076
1130 Ga0436364_0175508 3300037853 Bacteria 2467
1131 Ga0436364_1468890 3300037853 Bacteria 3472
1132 Ga0395901_0001544 3300038443 Bacteria 23862
1133 Ga0395901_0009907 3300038443 Bacteria 9660
1134 Ga0395901_0014285 3300038443 Bacteria 8084
1135 Ga0395901_0034663 3300038443 Bacteria 5214
1136 Ga0395901_0077928 3300038443 Bacteria 3459
1137 Ga0395901_0244032 3300038443 Bacteria 1872
1138 Ga0395901_0338812 3300038443 Bacteria 1554
1139 Ga0395901_0378743 3300038443 Bacteria 1457
1140 Ga0395901_0425223 3300038443 Bacteria 1361
1141 Ga0436365_1860619 3300039437 Bacteria 2795
1142 Ga0436360_0269953 3300039438 Bacteria 1391
1143 Ga0436360_0914350 3300039438 Bacteria 7514
1144 Ga0439436_0005119 3300041404 Bacteria 4018
1145 Ga0439466_0004842 3300041411 Bacteria 5178
1146 Ga0451800_1323902 3300041459 Bacteria 1543
1147 Ga0439441_001747 3300042001 Bacteria 2927
1148 Ga0439441_004454 3300042001 Bacteria 2124
1149 Ga0439442_007829 3300042002 Bacteria 2156
1150 Ga0439432_006320 3300042006 Bacteria 4237
1151 Ga0439449_0009382 3300042007 Bacteria 3709
1152 Ga0450911_001006 3300042115 Bacteria 7214
1153 Ga0439446_0000182 3300042156 Bacteria 11066
1154 Ga0439446_0004139 3300042156 Bacteria 3657
1155 Ga0439434_0000753 3300042435 Bacteria 9302
1156 Ga0439434_0026983 3300042435 Bacteria 1735
1157 Ga0439435_0010096 3300042436 Bacteria 2231
1158 Ga0439444_0010178 3300042437 Bacteria 1498
1159 Ga0439460_0011018 3300042461 Bacteria 2326
1160 Ga0466972_0000122 3300044658 Bacteria 65679
1161 Ga0466965_0014791 3300044683 Bacteria 3696
1162 Ga0466966_0008365 3300044684 Bacteria 6853
1163 Ga0466966_0020376 3300044684 Bacteria 4361
1164 Ga0466961_0000038 3300044693 Bacteria 80721
1165 Ga0466971_0088447 3300044719 Bacteria 1417
1166 Ga0466957_0069481 3300044842 Bacteria 2176
1167 Ga0466957_0229669 3300044842 Bacteria 1228
1168 Ga0466959_0009876 3300045049 Bacteria 6803
1169 Ga0466959_0071972 3300045049 Bacteria 2503
1170 Ga0451576_0001864 3300045051 Bacteria 34040
1171 Ga0451576_0004679 3300045051 Bacteria 17624
1172 Ga0451576_0015696 3300045051 Bacteria 8384
1173 Ga0466967_0152177 3300045976 Bacteria 2163
1174 Ga0495592_0000160 3300046454 Bacteria 59404
1175 Ga0495592_0000163 3300046454 Bacteria 59199
1176 Ga0495592_0001343 3300046454 Bacteria 17024
1177 Ga0495592_0009664 3300046454 Bacteria 7259
1178 Ga0495592_0031488 3300046454 Bacteria 4008
1179 Ga0495603_0041723 3300046455 Bacteria 2743
1180 Ga0495629_0171883 3300046459 Bacteria 1504
1181 Ga0495641_0012566 3300046461 Bacteria 4723
1182 Ga0495651_0000881 3300046462 Bacteria 23351
1183 Ga0495651_0013912 3300046462 Bacteria 6222
1184 Ga0495651_0068424 3300046462 Bacteria 2707
1185 Ga0495653_0045866 3300046463 Bacteria 3386
1186 Ga0495653_0120810 3300046463 Bacteria 1868
1187 Ga0495580_0019423 3300046472 Bacteria 5049
1188 Ga0495580_0060427 3300046472 Bacteria 2663
1189 Ga0495582_0001076 3300046473 Bacteria 15333
1190 Ga0495582_0008434 3300046473 Bacteria 5685
1191 Ga0495639_0001255 3300046475 Bacteria 11434
1192 Ga0495639_0004716 3300046475 Bacteria 5861
1193 Ga0495639_0005054 3300046475 Bacteria 5666
1194 Ga0495639_0010412 3300046475 Bacteria 4006
1195 Ga0495639_0014938 3300046475 Bacteria 3365
1196 Ga0495662_0002396 3300046476 Bacteria 9424
1197 Ga0495662_0091002 3300046476 Bacteria 1487
1198 Ga0495664_0024586 3300046477 Bacteria 3502
1199 Ga0495594_0015836 3300046499 Bacteria 3966
1200 Ga0495594_0052150 3300046499 Bacteria 2252
1201 Ga0495607_0001888 3300046501 Bacteria 17773
1202 Ga0495608_0000112 3300046511 Bacteria 57935
1203 Ga0495608_0078079 3300046511 Bacteria 2155
1204 Ga0495610_0013320 3300046512 Bacteria 4892
1205 Ga0495610_0042766 3300046512 Bacteria 2263
1206 Ga0495616_0018427 3300046513 Bacteria 3832
1207 Ga0495618_0031487 3300046514 Bacteria 3318
1208 Ga0495620_0051678 3300046515 Bacteria 1748
1209 Ga0495628_0000931 3300046516 Bacteria 26852
1210 Ga0495628_0005171 3300046516 Bacteria 11469
1211 Ga0495628_0056050 3300046516 Bacteria 3103
1212 Ga0495628_0098401 3300046516 Bacteria 2259
1213 Ga0495628_0138512 3300046516 Bacteria 1858
1214 Ga0495630_0002409 3300046517 Bacteria 12985
1215 Ga0495631_0000660 3300046518 Bacteria 22275
1216 Ga0495632_0008995 3300046519 Bacteria 6060
1217 Ga0495643_0017469 3300046522 Bacteria 4192
1218 Ga0495666_0010469 3300046526 Bacteria 4623
1219 Ga0495666_0081289 3300046526 Bacteria 1533
1220 Ga0495642_0021710 3300046528 Bacteria 2526
1221 Ga0495652_0010373 3300046529 Bacteria 8443
1222 Ga0495652_0041978 3300046529 Bacteria 3945
1223 Ga0495652_0055601 3300046529 Bacteria 3365
1224 Ga0495652_0084990 3300046529 Bacteria 2601
1225 Ga0495665_0001558 3300046531 Bacteria 12233
1226 Ga0495665_0002382 3300046531 Bacteria 10158
1227 Ga0495665_0005107 3300046531 Bacteria 7079
1228 Ga0495665_0059015 3300046531 Bacteria 2026
1229 Ga0495640_0008789 3300046533 Bacteria 7904
1230 Ga0495640_0036716 3300046533 Bacteria 3460
1231 Ga0495640_0038067 3300046533 Bacteria 3386
1232 Ga0495586_0004819 3300046535 Bacteria 7211
1233 Ga0495586_0005688 3300046535 Bacteria 6668
1234 Ga0495586_0049507 3300046535 Bacteria 2272
1235 Ga0495586_0102747 3300046535 Bacteria 1587
1236 Ga0495587_0039563 3300046536 Bacteria 2821
1237 Ga0495598_0009416 3300046537 Bacteria 2308
1238 Ga0495597_0000271 3300046542 Bacteria 47044
1239 Ga0495597_0016916 3300046542 Bacteria 3439
1240 Ga0495645_0000592 3300046543 Bacteria 24955
1241 Ga0495645_0021371 3300046543 Bacteria 4678
1242 Ga0495645_0031168 3300046543 Bacteria 3884
1243 Ga0495645_0163303 3300046543 Bacteria 1538
1244 Ga0495668_0006479 3300046616 Bacteria 7661
1245 Ga0495634_0047458 3300046642 Bacteria 2893
1246 Ga0495625_0000146 3300046660 Bacteria 108123
1247 Ga0495625_0000337 3300046660 Bacteria 71532
1248 Ga0495625_0015391 3300046660 Bacteria 6061
1249 Ga0495625_0016801 3300046660 Bacteria 5746
1250 Ga0495625_0023947 3300046660 Bacteria 4655
1251 Ga0495635_0008975 3300046663 Bacteria 6979
1252 Ga0495635_0029727 3300046663 Bacteria 3800
1253 Ga0495661_0004974 3300046665 Bacteria 9492
1254 Ga0495588_0005084 3300046674 Bacteria 5844
1255 Ga0495588_0053535 3300046674 Bacteria 2081
1256 Ga0495657_0029626 3300046675 Bacteria 3837
1257 Ga0495599_0020376 3300046678 Bacteria 4130
1258 Ga0495599_0025468 3300046678 Bacteria 3703
1259 Ga0495623_0012442 3300046679 Bacteria 5508
1260 Ga0495647_0003916 3300046681 Bacteria 4804
1261 Ga0495647_0004228 3300046681 Bacteria 4648
1262 Ga0495647_0006474 3300046681 Bacteria 3880
1263 Ga0495647_0006981 3300046681 Bacteria 3763
1264 Ga0495658_0006398 3300046683 Bacteria 5786
1265 Ga0495658_0014450 3300046683 Bacteria 4035
1266 Ga0495658_0018307 3300046683 Bacteria 3639
1267 Ga0495658_0047719 3300046683 Bacteria 2412
1268 Ga0495669_0002266 3300046684 Bacteria 7892
1269 Ga0495613_0017768 3300046689 Bacteria 5300
1270 Ga0495613_0019748 3300046689 Bacteria 5021
1271 Ga0495613_0027380 3300046689 Bacteria 4242
1272 Ga0495624_0007501 3300046690 Bacteria 7651
1273 Ga0495624_0027634 3300046690 Bacteria 3714
1274 Ga0495624_0040501 3300046690 Bacteria 2984
1275 Ga0495649_0011645 3300046694 Bacteria 5153
1276 Ga0495600_0000413 3300046809 Bacteria 22111
1277 Ga0495581_0003251 3300047315 Bacteria 9316
1278 Ga0495604_0051220 3300047317 Bacteria 3201
1279 Ga0495674_0009334 3300047319 Bacteria 9327
1280 Ga0495672_0011717 3300047320 Bacteria 6166
1281 Ga0495676_0004847 3300047321 Bacteria 12342
1282 Ga0495676_0027757 3300047321 Bacteria 4849
1283 Ga0495676_0033347 3300047321 Bacteria 4339
1284 Ga0495680_0003144 3300047322 Bacteria 16455
1285 Ga0495680_0030418 3300047322 Bacteria 4408
1286 Ga0495680_0066319 3300047322 Bacteria 2763
1287 Ga0495680_0071548 3300047322 Bacteria 2640
1288 Ga0495687_004820 3300047443 Bacteria 8886
1289 Ga0495687_017610 3300047443 Bacteria 3557
1290 Ga0495687_022383 3300047443 Bacteria 3034
1291 Ga0495675_0018241 3300047444 Bacteria 4453
1292 Ga0495675_0075459 3300047444 Bacteria 2125
1293 Ga0495685_027576 3300047447 Bacteria 1954
1294 Ga0495673_0072245 3300047469 Bacteria 1449
1295 Ga0495681_0062573 3300047470 Bacteria 1711
1296 Ga0495684_0042716 3300047471 Bacteria 3471
1297 Ga0496100_0030763 3300048903 Bacteria 3332
1298 Ga0496100_0184125 3300048903 Bacteria 1512
1299 Ga0496100_0202541 3300048903 Bacteria 1447
1300 Ga0496101_0000648 3300048904 Bacteria 20964
1301 Ga0496101_0008563 3300048904 Bacteria 6687
1302 Ga0496101_0015153 3300048904 Bacteria 5190
1303 Ga0496101_0022950 3300048904 Bacteria 4303
1304 Ga0496102_0006708 3300048905 Bacteria 9832
1305 Ga0496102_0009709 3300048905 Bacteria 8274
1306 Ga0496102_0021133 3300048905 Bacteria 5755
1307 Ga0496102_0025539 3300048905 Bacteria 5260
1308 Ga0496102_0045525 3300048905 Bacteria 3984
1309 Ga0496102_0048945 3300048905 Bacteria 3844
1310 Ga0496103_0010060 3300048906 Bacteria 5593
1311 Ga0496103_0020553 3300048906 Bacteria 3967
1312 Ga0496103_0066360 3300048906 Bacteria 2252
1313 Ga0496103_0086628 3300048906 Bacteria 1974
1314 Ga0496104_0009873 3300048907 Bacteria 8520
1315 Ga0496104_0010866 3300048907 Bacteria 8142
1316 Ga0496104_0013631 3300048907 Bacteria 7329
1317 Ga0496104_0017610 3300048907 Bacteria 6509
1318 Ga0496104_0023744 3300048907 Bacteria 5639
1319 Ga0496104_0324337 3300048907 Bacteria 1453
1320 Ga0496105_0004124 3300048908 Bacteria 10892
1321 Ga0496105_0020682 3300048908 Bacteria 5320
1322 Ga0496105_0026867 3300048908 Bacteria 4697
1323 Ga0496105_0062665 3300048908 Bacteria 3069
1324 Ga0496106_0013736 3300048909 Bacteria 5980
1325 Ga0496106_0071440 3300048909 Bacteria 2653
1326 Ga0496106_0131483 3300048909 Bacteria 1963
1327 Ga0496106_0147962 3300048909 Bacteria 1851
1328 Ga0496107_0010282 3300048910 Bacteria 6497
1329 Ga0496107_0014148 3300048910 Bacteria 5586
1330 Ga0496107_0111178 3300048910 Bacteria 2014
1331 Ga0496107_0114631 3300048910 Bacteria 1983
1332 Ga0496108_0004526 3300048911 Bacteria 11195
1333 Ga0496108_0034837 3300048911 Bacteria 4183
1334 Ga0496108_0090160 3300048911 Bacteria 2606
1335 Ga0496109_0009137 3300048912 Bacteria 8439
1336 Ga0496109_0124537 3300048912 Bacteria 2402
1337 Ga0496109_0136115 3300048912 Bacteria 2295
1338 Ga0496109_0141421 3300048912 Bacteria 2250
1339 Ga0496109_0300190 3300048912 Bacteria 1514
1340 Ga0496109_0324861 3300048912 Bacteria 1452
1341 Ga0496109_0332129 3300048912 Bacteria 1435
1342 Ga0496110_0007558 3300048913 Bacteria 8681
1343 Ga0496110_0058595 3300048913 Bacteria 3392
1344 Ga0496110_0162407 3300048913 Bacteria 2025
1345 Ga0496110_0253393 3300048913 Bacteria 1602
1346 Ga0496111_0080941 3300048914 Bacteria 2370
1347 Ga0496112_0002865 3300048915 Bacteria 14019
1348 Ga0496112_0008850 3300048915 Bacteria 9033
1349 Ga0496112_0027916 3300048915 Bacteria 5445
1350 Ga0496112_0028785 3300048915 Bacteria 5366
1351 Ga0496112_0248046 3300048915 Bacteria 1732
1352 Ga0496112_0270924 3300048915 Bacteria 1646
1353 Ga0496113_0010063 3300048916 Bacteria 6238
1354 Ga0496113_0168466 3300048916 Bacteria 1734
1355 Ga0496113_0219647 3300048916 Bacteria 1514
1356 Ga0496114_0008449 3300048917 Bacteria 8158
1357 Ga0496114_0020456 3300048917 Bacteria 5372
1358 Ga0496114_0038579 3300048917 Bacteria 3953
1359 Ga0496114_0134807 3300048917 Bacteria 2135
1360 Ga0496115_0013729 3300048918 Bacteria 6133
1361 Ga0496116_0009705 3300048919 Bacteria 8179
1362 Ga0496116_0026735 3300048919 Bacteria 4210
1363 Ga0496117_0037255 3300048920 Bacteria 3625
1364 Ga0496118_0009367 3300048921 Bacteria 9915
1365 Ga0496118_0015550 3300048921 Bacteria 7038
1366 Ga0496121_0017571 3300048924 Bacteria 7293
1367 Ga0496121_0067230 3300048924 Bacteria 2905
1368 Ga0496121_0077877 3300048924 Bacteria 2638
1369 Ga0496121_0141252 3300048924 Bacteria 1786
1370 Ga0496121_0170361 3300048924 Bacteria 1582
1371 Ga0496121_0227373 3300048924 Bacteria 1309
1372 Ga0496122_0000408 3300048925 Bacteria 91323
1373 Ga0496123_0000124 3300048926 Bacteria 158327
1374 Ga0496123_0000188 3300048926 Bacteria 125135
1375 Ga0496123_0119361 3300048926 Bacteria 1487
1376 Ga0496125_0000060 3300048928 Bacteria 264143
1377 Ga0496125_0000939 3300048928 Bacteria 45810
1378 Ga0496125_0003316 3300048928 Bacteria 19699
1379 Ga0496125_0012543 3300048928 Bacteria 8404
1380 Ga0496125_0038850 3300048928 Bacteria 4110
1381 Ga0496126_0061276 3300048929 Bacteria 3380
1382 Ga0496126_0066290 3300048929 Bacteria 3228
1383 Ga0495678_058853 3300049459 Bacteria 1451
1384 Ga0501033_0221879 3300049570 Bacteria 1345
1385 Ga0501034_0002706 3300049571 Bacteria 20879
1386 Ga0501034_0049783 3300049571 Bacteria 4228
1387 Ga0501034_0049918 3300049571 Bacteria 4221
1388 Ga0501034_0077092 3300049571 Bacteria 3339
1389 Ga0501034_0101177 3300049571 Bacteria 2876
1390 Ga0501036_0036902 3300049572 Bacteria 4135
1391 Ga0501036_0115181 3300049572 Bacteria 2271
1392 Ga0501037_0093781 3300049573 Bacteria 2171
1393 Ga0501038_0023765 3300049574 Bacteria 5476
1394 Ga0501038_0079258 3300049574 Bacteria 2770
1395 Ga0501039_0001773 3300049575 Bacteria 15943
1396 Ga0501039_0010820 3300049575 Bacteria 6951
1397 Ga0501039_0032989 3300049575 Bacteria 3994
1398 Ga0501039_0051640 3300049575 Bacteria 3181
1399 Ga0501039_0056245 3300049575 Bacteria 3047
1400 Ga0501039_0187571 3300049575 Bacteria 1626
1401 Ga0501040_0005843 3300049576 Bacteria 7965
1402 Ga0501040_0007299 3300049576 Bacteria 7160
1403 Ga0501040_0016338 3300049576 Bacteria 4911
1404 Ga0501040_0022260 3300049576 Bacteria 4240
1405 Ga0501041_0001572 3300049577 Bacteria 12703
1406 Ga0501041_0005336 3300049577 Bacteria 7521
1407 Ga0501041_0034766 3300049577 Bacteria 3052
1408 Ga0501042_0003040 3300049578 Bacteria 10436
1409 Ga0501042_0011136 3300049578 Bacteria 6060
1410 Ga0501042_0063919 3300049578 Bacteria 2630
1411 Ga0501043_0149735 3300049579 Bacteria 1826
1412 Ga0501046_0010010 3300049580 Bacteria 8167
1413 Ga0501047_0075613 3300049581 Bacteria 3241
1414 Ga0501047_0240411 3300049581 Bacteria 1661
1415 Ga0501048_0016231 3300049582 Bacteria 5490
1416 Ga0501067_0056290 3300049583 Bacteria 2179
1417 Ga0501067_0082717 3300049583 Bacteria 1780
1418 Ga0501068_0014530 3300049584 Bacteria 4503
1419 Ga0501070_0054730 3300049586 Bacteria 3309
1420 Ga0501070_0070807 3300049586 Bacteria 2887
1421 Ga0501070_0316420 3300049586 Bacteria 1270
1422 Ga0501071_0000373 3300049587 Bacteria 21984
1423 Ga0501071_0016292 3300049587 Bacteria 5111
1424 Ga0501071_0019722 3300049587 Bacteria 4680
1425 Ga0501071_0021607 3300049587 Bacteria 4483
1426 Ga0501072_0001156 3300049588 Bacteria 19636
1427 Ga0501072_0002674 3300049588 Bacteria 13366
1428 Ga0501072_0010678 3300049588 Bacteria 6992
1429 Ga0501072_0018804 3300049588 Bacteria 5330
1430 Ga0501072_0069898 3300049588 Bacteria 2772
1431 Ga0501073_0005691 3300049589 Bacteria 9323
1432 Ga0501073_0162819 3300049589 Bacteria 1545
1433 Ga0501074_0066911 3300049590 Bacteria 2584
1434 Ga0501074_0124449 3300049590 Bacteria 1844
1435 Ga0501074_0131313 3300049590 Bacteria 1792
1436 Ga0501075_0000936 3300049591 Bacteria 18548
1437 Ga0501075_0028293 3300049591 Bacteria 4137
1438 Ga0501075_0093655 3300049591 Bacteria 2280
1439 Ga0501075_0112563 3300049591 Bacteria 2069
1440 Ga0501076_0000368 3300049592 Bacteria 28011
1441 Ga0501076_0000723 3300049592 Bacteria 21344
1442 Ga0501076_0008694 3300049592 Bacteria 7458
1443 Ga0501076_0067779 3300049592 Bacteria 2850
1444 Ga0501076_0107612 3300049592 Bacteria 2252
1445 Ga0501076_0149854 3300049592 Bacteria 1897
1446 Ga0501077_0007614 3300049593 Bacteria 6684
1447 Ga0501077_0010717 3300049593 Bacteria 5708
1448 Ga0501077_0084935 3300049593 Bacteria 2006
1449 Ga0501079_0004391 3300049741 Bacteria 10441
1450 Ga0501079_0006780 3300049741 Bacteria 8616
1451 Ga0501079_0019212 3300049741 Bacteria 5220
1452 Ga0501079_0242440 3300049741 Bacteria 1408
1453 Ga0501080_0000884 3300049742 Bacteria 24518
1454 Ga0501080_0014279 3300049742 Bacteria 7315
1455 Ga0501080_0018314 3300049742 Bacteria 6481
1456 Ga0501080_0059029 3300049742 Bacteria 3571
1457 Ga0501081_0008922 3300049743 Bacteria 6516
1458 Ga0501081_0012105 3300049743 Bacteria 5655
1459 Ga0501081_0162389 3300049743 Bacteria 1610
1460 Ga0501081_0174342 3300049743 Bacteria 1553
1461 Ga0501083_0099888 3300049744 Bacteria 1914
1462 Ga0501262_000676 3300049759 Bacteria 3958
1463 Ga0501035_0160942 3300049822 Bacteria 1943
1464 Ga0501035_0185716 3300049822 Bacteria 1789
1465 Ga0501044_0014975 3300049823 Bacteria 8361
1466 Ga0501044_0040015 3300049823 Bacteria 4888
1467 Ga0501044_0042184 3300049823 Bacteria 4747
1468 Ga0501044_0206525 3300049823 Bacteria 1920
1469 Ga0501045_0000263 3300049824 Bacteria 30506
1470 Ga0501045_0007193 3300049824 Bacteria 7722
1471 Ga0501045_0009377 3300049824 Bacteria 6843
1472 Ga0501045_0203571 3300049824 Bacteria 1475
1473 nmdc:mga03683_67597_c1 3300050489 Bacteria 1521
1474 nmdc:mga03n38_28823_c1 3300050490 Bacteria 2318
1475 nmdc:mga00v17_33302_c1 3300050491 Bacteria 3053
1476 nmdc:mga00v17_62148_c1 3300050491 Bacteria 2297
1477 nmdc:mga0yw44_14606_c1 3300050492 Bacteria 4176
1478 nmdc:mga0yw44_28991_c1 3300050492 Bacteria 3191
1479 nmdc:mga0yw44_86618_c1 3300050492 Bacteria 1973
1480 nmdc:mga0k408_130547_c1 3300050493 Bacteria 1492
1481 nmdc:mga0k408_38350_c1 3300050493 Bacteria 2750
1482 nmdc:mga0k408_5966_c1 3300050493 Bacteria 6501
1483 nmdc:mga0k408_6258_c1 3300050493 Bacteria 6350
1484 nmdc:mga0k408_91149_c1 3300050493 Bacteria 1791
1485 nmdc:mga0k408_9812_c1 3300050493 Bacteria 5171
1486 nmdc:mga06z11_5930_c1 3300050494 Bacteria 4935
1487 nmdc:mga06z11_71560_c1 3300050494 Bacteria 1836
1488 nmdc:mga06z11_79424_c1 3300050494 Bacteria 1756
1489 nmdc:mga04h51_30499_c1 3300050495 Bacteria 1697
1490 nmdc:mga07m45_114474_c1 3300050496 Bacteria 1555
1491 nmdc:mga07m45_1563_c1 3300050496 Bacteria 10535
1492 nmdc:mga07m45_20110_c1 3300050496 Bacteria 3624
1493 nmdc:mga07m45_2696_c2 3300050496 Bacteria 3813
1494 nmdc:mga07m45_3774_c1 3300050496 Bacteria 7328
1495 nmdc:mga07m45_577_c1 3300050496 Bacteria 15597
1496 nmdc:mga05p37_758_c1 3300050507 Bacteria 35839
1497 nmdc:mga05p37_8_c1 3300050507 Bacteria 153982
1498 nmdc:mga09592_101343_c1 3300050508 Bacteria 2467
1499 nmdc:mga09592_12310_c1 3300050508 Bacteria 6966
1500 nmdc:mga09592_130039_c1 3300050508 Bacteria 2166
1501 nmdc:mga09592_5994_c1 3300050508 Bacteria 9912
1502 nmdc:mga0qj67_727_c1 3300050509 Bacteria 22392
1503 nmdc:mga06r32_131218_c1 3300050510 Bacteria 2478
1504 nmdc:mga06r32_2_c2 3300050510 Bacteria 135779
1505 nmdc:mga06r32_40790_c1 3300050510 Bacteria 4408
1506 nmdc:mga06r32_5553_c1 3300050510 Bacteria 11365
1507 nmdc:mga08y16_10189_c1 3300050511 Bacteria 9871
1508 nmdc:mga08y16_141939_c1 3300050511 Bacteria 2497
1509 nmdc:mga08y16_40523_c1 3300050511 Bacteria 4882
1510 nmdc:mga08y16_7868_c1 3300050511 Bacteria 11161
1511 nmdc:mga0n895_103893_c1 3300050512 Bacteria 2853
1512 nmdc:mga0n895_10501_c1 3300050512 Bacteria 8190
1513 nmdc:mga0n895_126353_c1 3300050512 Bacteria 2581
1514 nmdc:mga0n895_13715_c1 3300050512 Bacteria 7327
1515 nmdc:mga0n895_1569_c1 3300050512 Bacteria 17184
1516 nmdc:mga0n895_2878_c1 3300050512 Bacteria 13655
1517 nmdc:mga0n895_29379_c1 3300050512 Bacteria 5242
1518 nmdc:mga0rr50_261772_c1 3300050513 Bacteria 1439
1519 nmdc:mga0rr50_47223_c1 3300050513 Bacteria 3175
1520 nmdc:mga08x19_103071_c1 3300050514 Bacteria 1895
1521 nmdc:mga08x19_10771_c1 3300050514 Bacteria 5497
1522 nmdc:mga0a205_146335_c1 3300050515 Bacteria 2263
1523 nmdc:mga0a205_226174_c1 3300050515 Bacteria 1755
1524 nmdc:mga0sz30_183_c2 3300050516 Bacteria 16792
1525 Ga0495601_0062656 3300053077 Bacteria 2362
1526 Ga0495612_0056450 3300053078 Bacteria 1621
1527 Ga0495595_0015766 3300053084 Bacteria 3225
1528 Ga0495619_0009928 3300053085 Bacteria 5995
1529 Ga0500578_0148542 3300053086 Bacteria 1461
1530 Ga0500651_0000306 3300053093 Bacteria 28273
1531 Ga0500566_0000003 3300053094 Bacteria 166820
1532 Ga0500571_000025 3300053110 Bacteria 52183
1533 Ga0500572_002602 3300053111 Bacteria 4288
1534 Ga0500595_002313 3300053119 Bacteria 9533
1535 Ga0500607_053840 3300053121 Bacteria 2132
1536 Ga0500608_003401 3300053122 Bacteria 5958
1537 Ga0500608_077346 3300053122 Bacteria 1575
1538 Ga0500618_004010 3300053125 Bacteria 4850
1539 Ga0500658_0039107 3300053134 Bacteria 1893
1540 Ga0500559_0001626 3300053136 Bacteria 12489
1541 Ga0500559_0002366 3300053136 Bacteria 9829
1542 Ga0500574_003346 3300053141 Bacteria 2818
1543 Ga0500603_000184 3300053150 Bacteria 16166
1544 Ga0500616_0000725 3300053153 Bacteria 38124
1545 Ga0500630_001089 3300053159 Bacteria 12674
1546 Ga0500634_0037391 3300053161 Bacteria 2640
1547 Ga0500639_000033 3300053163 Bacteria 68969
1548 Ga0500639_086147 3300053163 Bacteria 1573
1549 Ga0500636_0000042 3300053177 Bacteria 69412
1550 Ga0500637_0094416 3300053178 Bacteria 1733
1551 Ga0500596_001686 3300053735 Bacteria 4475
1552 Ga0500596_004563 3300053735 Bacteria 2527
1553 Ga0500601_000553 3300053737 Bacteria 5521
1554 Ga0501084_0047911 3300054114 Bacteria 3579
1555 Ga0501084_0177745 3300054114 Bacteria 1797
1556 Ga0501084_0190447 3300054114 Bacteria 1730
1557 Ga0500661_004312 3300055283 Bacteria 2661
1558 Ga0501082_0001125 3300060353 Bacteria 23645
1559 Ga0501082_0011010 3300060353 Bacteria 7777
1560 Ga0501082_0236387 3300060353 Bacteria 1590
1561 Ga0530510_0000286 3300061734 Bacteria 32044
1562 Ga0530510_0000862 3300061734 Bacteria 19989
1563 Ga0530510_0067151 3300061734 Bacteria 2601
1564 2509148370 2508501128 Bacteria 8613869
1565 2511248212 2511231003 Bacteria 5606035
1566 2511252324 2511231003 Bacteria 5606035
1567 2513228504 2513020051 Bacteria 6053213
1568 2513622353 2513237092 Bacteria 8341956
1569 2513640530 2513237094 Bacteria 8789602
1570 2513645448 2513237095 Bacteria 8976980
1571 2513657153 2513237096 Bacteria 8722461
1572 2513693739 2513237101 Bacteria 7952346
1573 2513701716 2513237102 Bacteria 7703324
1574 2513863161 2513237137 Bacteria 9558895
1575 2513873134 2513237139 Bacteria 8737671
1576 2513892626 2513237141 Bacteria 8496279
1577 2513919161 2513237145 Bacteria 8979722
1578 2514016521 2513237161 Bacteria 8871253
1579 2517102627 2517093001 Bacteria 9002274
1580 2517891146 2517572143 Bacteria 9484767
1581 2524465597 2524023210 Bacteria 9029266
1582 2524533670 2524023228 Bacteria 10118060
1583 2528848702 2528768022 Bacteria 10457665
1584 2550697506 2548876994 Bacteria 4904866
1585 2553003411 2551306416 Bacteria 6152985
1586 2587755956 2585428062 Bacteria 6842168
1587 2617346997 2617270735 Bacteria 9163226
1588 2643864154 2643221570 Bacteria 5103772
1589 2643981047 2643221594 Bacteria 5811388
1590 2643992454 2643221596 Bacteria 5006805
1591 2644029503 2643221603 Bacteria 6147767
1592 2644163353 2643221628 Bacteria 5745828
1593 2644292143 2643221652 Bacteria 5140275
1594 2644303104 2643221654 Bacteria 5273570
1595 2644305856 2643221654 Bacteria 5273570
1596 2644326638 2643221658 Bacteria 6064537
1597 2644396988 2643221672 Bacteria 6322190
1598 2644469340 2643221683 Bacteria 5749203
1599 2671123252 2667528175 Bacteria 7532676
1600 2723843482 2721755755 Bacteria 8322773
1601 2738724072 2738541277 Bacteria 7458140
1602 2738883437 2738541307 Bacteria 8606193
1603 2739247507 2738543013 Bacteria 5618633
1604 2739284757 2738543019 Bacteria 7459457
1605 2739610807 2739367655 Bacteria 4051151
1606 2793066489 2791355197 Bacteria 8420563
1607 2805914967 2802429603 Bacteria 8777136
1608 2809034915 2808606395 Bacteria 6020352
1609 2809131656 2808606415 Bacteria 4576710
1610 2809151278 2808606419 Bacteria 4576925
1611 2818239675 2816332527 Bacteria 8933356
1612 2819594133 2818991445 Bacteria 4955017
1613 2821450574 2821443989 Bacteria 7658172
1614 2824602357 2824600985 Bacteria 8488197
1615 2824610549 2824609381 Bacteria 8672835
1616 2824618109 2824617872 Bacteria 8814715
1617 2824626777 2824626560 Bacteria 8813858
1618 2824636588 2824635225 Bacteria 8785348
1619 2824645122 2824644064 Bacteria 8743947
1620 2824654326 2824653114 Bacteria 8493680
1621 2824661589 2824661429 Bacteria 9877870
1622 2824672038 2824671348 Bacteria 8369588
1623 2824679862 2824679649 Bacteria 8248951
1624 2824688637 2824687955 Bacteria 8360029
1625 2824697127 2824696289 Bacteria 8335049
1626 2824705091 2824704595 Bacteria 9667483
1627 2824715717 2824714736 Bacteria 8717648
1628 2824725200 2824723954 Bacteria 8758240
1629 2824754372 2824753945 Bacteria 9787441
1630 2824767871 2824763712 Bacteria 9792355
1631 2824775253 2824773399 Bacteria 8360218
1632 2834645881 2834641062 Bacteria 5559922
1633 2838123351 2838122688 Bacteria 8803140
1634 2841946645 2841941048 Bacteria 8688029
1635 2841954122 2841949485 Bacteria 8680857
1636 2841960975 2841957949 Bacteria 8652217
1637 2841969500 2841966195 Bacteria 8673214
1638 2841974616 2841974524 Bacteria 8931498
1639 2841983825 2841983080 Bacteria 8395090
1640 2842679386 2842677519 Bacteria 5615038
1641 2842738338 2842733646 Bacteria 5716726
1642 2842750554 2842747753 Bacteria 5578255
1643 2844319405 2844315083 Bacteria 8138177
1644 2847936581 2847930680 Bacteria 9342022
1645 2847946925 2847939898 Bacteria 8606328
1646 2849078964 2849076700 Bacteria 7039503
1647 2852622440 2852618963 Bacteria 4577824
1648 2857578439 2857576091 Bacteria 5465855
1649 2874611603 2874604998 Bacteria 7834745
1650 2874632268 2874628541 Bacteria 8630250
1651 2879088075 2879083081 Bacteria 8587928
1652 2879108342 2879099564 Bacteria 10442239
1653 2879117467 2879110137 Bacteria 8907982
1654 2881672533 2881665667 Bacteria 8175609
1655 2881929559 2881927736 Bacteria 3993927
1656 2884816086 2884811622 Bacteria 5552861
1657 2884839435 2884836552 Bacteria 5219991
1658 2884856755 2884852848 Bacteria 5221161
1659 2885193315 2885192300 Bacteria 5882526
1660 2885413317 2885409591 Bacteria 9235467
1661 2888384474 2888378607 Bacteria 9652610
1662 2888393436 2888388044 Bacteria 7304136
1663 2888424924 2888419890 Bacteria 7857137
1664 2894023396 2894023352 Bacteria 5167372
1665 2896158101 2896154374 Bacteria 5221518
1666 2903734347 2903727486 Bacteria 8281579
1667 2903752233 2903748898 Bacteria 9972761
1668 2904435008 2904434214 Bacteria 6230908
1669 2904451537 2904449895 Bacteria 6927402
1670 2904458394 2904456579 Bacteria 6819253
1671 2904543190 2904541872 Bacteria 8915136
1672 2904698954 2904690495 Bacteria 9412302
1673 2904701025
1674 2904715095 2904711408 Bacteria 9771557
1675 2906605591 2906602504 Bacteria 8295279
1676 2906616326
1677 2906627163 2906626472 Bacteria 8826946
1678 2906641531 2906635258 Bacteria 8601019
1679 2906646195 2906643746 Bacteria 8722424
1680 2906662891 2906660503 Bacteria 8595048
1681 2908741466 2908739725 Bacteria 8628932
1682 2908758751 2908756301 Bacteria 8864324
1683 2919466499 2919462493 Bacteria 5817112
1684 2922361738 2922361189 Bacteria 7436256
1685 2922374886
1686 2922387012 2922386360 Bacteria 7017218
1687 2922400429 2922393267 Bacteria 8285685
1688 2922431676
1689 2923511539 2923510766 Bacteria 5926163
1690 2928090405 2928084124 Bacteria 7159212
1691 2929160424 2929160207 Bacteria 9075316
1692 2929524029 2929520902 Bacteria 6765052
1693 2929621930 2929615660 Bacteria 9193770
1694 2929629763 2929624759 Bacteria 9339455
1695 2932422932 2932422444 Bacteria 4678430
1696 2932788797 2932784394 Bacteria 9704911
1697 2932812771 2932809354 Bacteria 9135765
1698 2932819137 2932818245 Bacteria 9955613
1699 2932830463 2932828146 Bacteria 9745859
1700 2933583794 2933577622 Bacteria 9116884
1701 2935616757 2935616580 Bacteria 9032984
1702 2935635776 2935630451 Bacteria 8169952
1703 2935641913 2935638405 Bacteria 10015038
1704 2935673044 2935665750 Bacteria 9571747
1705 2935675849 2935675223 Bacteria 9928132
1706 2935685846 2935684952 Bacteria 9590419
1707 2935697908 2935694250 Bacteria 9291695
1708 2935705686 2935703347 Bacteria 10242284
1709 2935714398 2935713505 Bacteria 9608509
1710 2935725017 2935722832 Bacteria 9608746
1711 2935732624 2935732158 Bacteria 9706831
1712 2935742003 2935741537 Bacteria 9707219
1713 2935751811 2935750917 Bacteria 9590372
1714 2935765068 2935760218 Bacteria 9817913
1715 2935802664 2935801545 Bacteria 9301974
1716 2935813506 2935810662 Bacteria 9401221
1717 2935830080 2935827899 Bacteria 10038562
1718 2935837998 2935837841 Bacteria 9454360
1719 2935855381 2935855204 Bacteria 9035059
1720 2935867375 2935864058 Bacteria 9784707
1721 2935875806 2935873716 Bacteria 9632195
1722 2935996470 2935992306 Bacteria 9802711
1723 2936003750 2936002035 Bacteria 9362176
1724 2936042455 2936037263 Bacteria 9446081
1725 2939633593 2939631187 Bacteria 6118131
1726 2940557386 2940556831 Bacteria 9590747
1727 2941512387 2941507105 Bacteria 8166816
1728 2941520108 2941515067 Bacteria 8166720
1729 2941528257 2941523033 Bacteria 8169134
1730 2941539336 2941538514 Bacteria 9402094
1731 2945915454 2945909444 Bacteria 7065066
1732 2945950552 2945945610 Bacteria 5951079
1733 2945974815 2945972063 Bacteria 6086495
1734 2945989144 2945984333 Bacteria 7358892
1735 2954770014 2954767861 Bacteria 5535784
1736 2990714767 2990710928 Bacteria 5002431
1737 3005481475 3005474847 Bacteria 9259049
1738 3005484657 3005483717 Bacteria 7877331
1739 3005510669 3005506211 Bacteria 6943378
1740 3005587692 3005587118 Bacteria 7794411
1741 3005599606 3005594810 Bacteria 8716512
1742 3005722643 3005718088 Bacteria 8283608
1743 8003405145 8003400568 Bacteria 5535898
1744 8006939242 8006933436 Bacteria 10410654
1745 8006966853 8006964411 Bacteria 8966052
1746 8006978900 8006973647 Bacteria 10679141
1747 8006994635 8006994254 Bacteria 8309700
1748 8016521830 8016511872 Bacteria 9921665
1749 8017063824 8017057580 Bacteria 10023680
1750 8019565101 8019555841 Bacteria 9642137
1751 8019575205 8019565922 Bacteria 9639779
1752 8019583172 8019576017 Bacteria 10049540
1753 8019618174 8019608314 Bacteria 10042931
1754 8019658927 8019648815 Bacteria 10014479
1755 8048749031 8048746797 Bacteria 3557226
1756 8055226651 8055225921 Bacteria 3341787
1757 8055745904 8055742211 Bacteria 9226248
1758 8056680897 8056673599 Bacteria 7871253
1759 8056690606 8056689827 Bacteria 6712655
1760 8056968394 8056967851 Bacteria 9038162
1761 Ga0105238_10000770
1762 JGI25155J39150_1000348
1763 JGI25155J39150_1000397
1764 JGI25156J39149_1000039
1765 JGI25154J39366_1000059
1766 JGI25154J39366_1000162
1767 JGI25157J39369_1000057
1768 JGI25152J39213_1003210
1769 JGI25150J39212_1001186
1770 JGI25159J45721_1000497
1771 JGI25159J45721_1003112
1772 JGI25159J45721_1017927
1773 JGI25151J46595_10001481
1774 JGI25151J46595_10004147
1775 JGI25151J46595_10004723
1776 JGI25153J46596_10004260
1777 JGI25153J46596_10006245
1778 JGI25160J50197_1000228
1779 JGI25160J50197_1004539
1780 JGI25161J50226_1000171
1781 JGI25161J50226_1006232
1782 Ga0006562J51391_1036868
1783 JGI25404J52841_10007941
1784 JGI25404J52841_10009477
1785 Ga0055532_1000018
1786 Ga0055535_1008422
1787 Ga0055526_1007445
1788 Ga0055537_1001030
1789 Ga0055537_1001074
1790 Ga0055537_1002754
1791 Ga0055524_1005449
1792 Ga0055536_1000981
1793 Ga0055536_1003501
1794 Ga0055536_1021260
1795 Ga0055534_1000371
1796 Ga0055534_1002905
1797 Ga0055528_1003578
1798 Ga0055528_1014888
1799 Ga0055530_10008883
1800 Ga0055540_1014156
1801 Ga0055531_10012862
1802 Ga0055531_10024389
1803 JGI25405J52794_10013526
1804 Ga0055543_1001492
1805 Ga0055543_1002183
1806 Ga0055543_1002866
1807 Ga0065165_1002034
1808 Ga0065165_1002156
1809 Ga0065165_1004137
1810 Ga0065714_10029414
1811 Ga0070658_10043586
1812 Ga0070658_10202646
1813 Ga0070676_10014784
1814 Ga0070676_10021242
1815 Ga0070683_100020403
1816 Ga0070683_100080691
1817 Ga0070690_100024193
1818 Ga0070670_100006216
1819 Ga0070670_100010932
1820 Ga0070670_100020925
1821 Ga0070670_100024850
1822 Ga0070670_100026734
1823 Ga0070670_100034308
1824 Ga0070670_100097687
1825 Ga0070670_100254077
1826 Ga0068869_100001034
1827 Ga0068869_100007415
1828 Ga0070666_10005594
1829 Ga0070666_10010734
1830 Ga0070666_10064662
1831 Ga0070680_100000789
1832 Ga0070680_100019987
1833 Ga0070680_100020435
1834 Ga0070682_100025351
1835 Ga0068868_100008066
1836 Ga0068868_100009673
1837 Ga0068868_100035445
1838 Ga0068868_100058041
1839 Ga0068868_100083366
1840 Ga0068868_100176045
1841 Ga0070660_100002643
1842 Ga0070660_100012054
1843 Ga0070660_100110595
1844 Ga0070689_100002767
1845 Ga0070691_10001775
1846 Ga0070661_100001036
1847 Ga0070661_100076907
1848 Ga0070661_100086187
1849 Ga0070692_10010384
1850 Ga0070668_100005979
1851 Ga0070668_100010299
1852 Ga0070668_100046663
1853 Ga0070668_100074690
1854 Ga0070668_100160684
1855 Ga0070669_100000706
1856 Ga0070669_100002383
1857 Ga0070669_100058804
1858 Ga0070669_100100200
1859 Ga0070675_100005756
1860 Ga0070675_100006313
1861 Ga0070675_100012135
1862 Ga0070675_100014622
1863 Ga0070675_100030287
1864 Ga0070675_100361590
1865 Ga0070671_100002238
1866 Ga0070671_100011061
1867 Ga0070671_100055325
1868 Ga0070671_100056246
1869 Ga0070671_100140698
1870 Ga0070671_100152595
1871 Ga0070674_100012268
1872 Ga0070674_100110275
1873 Ga0070673_100001120
1874 Ga0070673_100002595
1875 Ga0070673_100002922
1876 Ga0070673_100007394
1877 Ga0070673_100008204
1878 Ga0070673_100028980
1879 Ga0070673_100042964
1880 Ga0070688_100022547
1881 Ga0070659_100000182
1882 Ga0070659_100193834
1883 Ga0070659_100264107
1884 Ga0070667_100004260
1885 Ga0070667_100005889
1886 Ga0070667_100073642
1887 Ga0070667_100076324
1888 Ga0070667_100105822
1889 Ga0070667_100180403
1890 Ga0070667_100184200
1891 Ga0070667_100200102
1892 Ga0070667_100208869
1893 Ga0070709_10030069
1894 Ga0070709_10125521
1895 Ga0070714_100015456
1896 Ga0070714_100053815
1897 Ga0070713_100000097
1898 Ga0070713_100018700
1899 Ga0070713_100357050
1900 Ga0070710_10003116
1901 Ga0070710_10016099
1902 Ga0070701_10027118
1903 Ga0070711_100004189
1904 Ga0070711_100026980
1905 Ga0070711_100040688
1906 Ga0070705_100001008
1907 Ga0070705_100002250
1908 Ga0070700_100000507
1909 Ga0070700_100009539
1910 Ga0070700_100139578
1911 Ga0070694_100001273
1912 Ga0070694_100023987
1913 Ga0070694_100036132
1914 Ga0070708_100036981
1915 Ga0070708_100047590
1916 Ga0070663_100007054
1917 Ga0070663_100012111
1918 Ga0070663_100028572
1919 Ga0070663_100041202
1920 Ga0070663_100048993
1921 Ga0070663_100110399
1922 Ga0070678_100001572
1923 Ga0070678_100062917
1924 Ga0070678_100075042
1925 Ga0070678_100103116
1926 Ga0070662_100000120
1927 Ga0070662_100025661
1928 Ga0070662_100045286
1929 Ga0070662_100173022
1930 Ga0070681_10000235
1931 Ga0070681_10052911
1932 Ga0070681_10098937
1933 Ga0070681_10163907
1934 Ga0070681_10189790
1935 Ga0068867_100000699
1936 Ga0068867_100001479
1937 Ga0068867_100022330
1938 Ga0068867_100031990
1939 Ga0068867_100042529
1940 Ga0070685_10068444
1941 Ga0070706_100005279
1942 Ga0070706_100026812
1943 Ga0070706_100065693
1944 Ga0070706_100160570
1945 Ga0070707_100014058
1946 Ga0070707_100172193
1947 Ga0070707_100231857
1948 Ga0070698_100000346
1949 Ga0070698_100030448
1950 Ga0070699_100008587
1951 Ga0070699_100097488
1952 Ga0070679_100008198
1953 Ga0070679_100067454
1954 Ga0070679_100138837
1955 Ga0070679_100243192
1956 Ga0070684_100012356
1957 Ga0070684_100053346
1958 Ga0070684_100100932
1959 Ga0070697_100038951
1960 Ga0070697_100080330
1961 Ga0068853_100001080
1962 Ga0068853_100012124
1963 Ga0068853_100065882
1964 Ga0068853_100148707
1965 Ga0068853_100249045
1966 Ga0068853_100289906
1967 Ga0070672_100008837
1968 Ga0070672_100011179
1969 Ga0070672_100012802
1970 Ga0070672_100033629
1971 Ga0070672_100035679
1972 Ga0070672_100044056
1973 Ga0070672_100124753
1974 Ga0070672_100136229
1975 Ga0070686_100000451
1976 Ga0070695_100000113
1977 Ga0070695_100004445
1978 Ga0070695_100059389
1979 Ga0070695_100100914
1980 Ga0070696_100001794
1981 Ga0070696_100029810
1982 Ga0070693_100006920
1983 Ga0070665_100002511
1984 Ga0070665_100005013
1985 Ga0070665_100020157
1986 Ga0070665_100024935
1987 Ga0070665_100054839
1988 Ga0070665_100083512
1989 Ga0070665_100090011
1990 Ga0070665_100259817
1991 Ga0070704_100001744
1992 Ga0070704_100031607
1993 Ga0070704_100104705
1994 Ga0068855_100003059
1995 Ga0068855_100004880
1996 Ga0068855_100044092
1997 Ga0068855_100116191
1998 Ga0068855_100133255
1999 Ga0070664_100000226
2000 Ga0070664_100006946
2001 Ga0070664_100008588
2002 Ga0070664_100068450
2003 Ga0070664_100082392
2004 Ga0070664_100093702
2005 Ga0070664_100205357
2006 Ga0068857_100009219
2007 Ga0068857_100012359
2008 Ga0068857_100017621
2009 Ga0068854_100004976
2010 Ga0068854_100091425
2011 Ga0068856_100002965
2012 Ga0068856_100004533
2013 Ga0068856_100006452
2014 Ga0068856_100034528
2015 Ga0068856_100035978
2016 Ga0068856_100046152
2017 Ga0068856_100060037
2018 Ga0068856_100108343
2019 Ga0068856_100132592
2020 Ga0068856_100197998
2021 Ga0068856_100204117
2022 Ga0068856_100342019
2023 Ga0070702_100000240
2024 Ga0070702_100108560
2025 Ga0068852_100000458
2026 Ga0068852_100002866
2027 Ga0068852_100003345
2028 Ga0068852_100044052
2029 Ga0068852_100050792
2030 Ga0068852_100361619
2031 Ga0068859_100001046
2032 Ga0068859_100004628
2033 Ga0068859_100005100
2034 Ga0068859_100011777
2035 Ga0068859_100131360
2036 Ga0068859_100371126
2037 Ga0068859_100432532
2038 Ga0068864_100001845
2039 Ga0068864_100006755
2040 Ga0068864_100033625
2041 Ga0068864_100060757
2042 Ga0068864_100100205
2043 Ga0068866_10000744
2044 Ga0068866_10022984
2045 Ga0068861_100000550
2046 Ga0068861_100009710
2047 Ga0068861_100011045
2048 Ga0068861_100012089
2049 Ga0068861_100016696
2050 Ga0068861_100197378
2051 Ga0068851_10004220
2052 Ga0068870_10014703
2053 Ga0068863_100003310
2054 Ga0068863_100004932
2055 Ga0068863_100024146
2056 Ga0068863_100026315
2057 Ga0068863_100056419
2058 Ga0068863_100162307
2059 Ga0068858_100001886
2060 Ga0068858_100009824
2061 Ga0068858_100054622
2062 Ga0068858_100059335
2063 Ga0068858_100115612
2064 Ga0068860_100000995
2065 Ga0068860_100002455
2066 Ga0068860_100004676
2067 Ga0068860_100006826
2068 Ga0068860_100011997
2069 Ga0068860_100017959
2070 Ga0068860_100027734
2071 Ga0068860_100043605
2072 Ga0068862_100001897
2073 Ga0068862_100007683
2074 Ga0068862_100011352
2075 Ga0068862_100018082
2076 Ga0068862_100023649
2077 Ga0068862_100048060
2078 Ga0068862_100060608
2079 Ga0068862_100062934
2080 Ga0068862_100070581
2081 Ga0081455_10002128
2082 Ga0081455_10005931
2083 Ga0081455_10007164
2084 Ga0081455_10008105
2085 Ga0081455_10056129
2086 Ga0081455_10067942
2087 Ga0081538_10062089
2088 Ga0081540_1008063
2089 Ga0081540_1010718
2090 Ga0081540_1011457
2091 Ga0081540_1027323
2092 Ga0081540_1081211
2093 Ga0081539_10000199
2094 Ga0081539_10008807
2095 Ga0081539_10035474
2096 Ga0070717_10226606
2097 Ga0075365_10081210
2098 Ga0075365_10120135
2099 Ga0075368_10049277
2100 Ga0075363_100033317
2101 Ga0075363_100038226
2102 Ga0075364_10000449
2103 Ga0075364_10001306
2104 Ga0075364_10041388
2105 Ga0075364_10041828
2106 Ga0075432_10004252
2107 Ga0070715_10007524
2108 Ga0070716_100025770
2109 Ga0070712_100005468
2110 Ga0070712_100025225
2111 Ga0075362_10007655
2112 Ga0075362_10017916
2113 Ga0075362_10036312
2114 Ga0075367_10022998
2115 Ga0075367_10058895
2116 Ga0075367_10091962
2117 Ga0075369_10039228
2118 Ga0075366_10003108
2119 Ga0075366_10020960
2120 Ga0075366_10034499
2121 Ga0075366_10048359
2122 Ga0075366_10090760
2123 Ga0075366_10101532
2124 Ga0097621_100181066
2125 Ga0097621_100235597
2126 Ga0097621_100362827
2127 Ga0075370_10016491
2128 Ga0075370_10016870
2129 Ga0075370_10016996
2130 Ga0075370_10039884
2131 Ga0075370_10091130
2132 Ga0075370_10107767
2133 Ga0068871_100001073
2134 Ga0068871_100026391
2135 Ga0068871_100051176
2136 Ga0068871_100101091
2137 Ga0068871_100119593
2138 Ga0068871_100126027
2139 Ga0068871_100255065
2140 Ga0075428_100001002
2141 Ga0075428_100010339
2142 Ga0075428_100018888
2143 Ga0075428_100195292
2144 Ga0075428_100410183
2145 Ga0075430_100008058
2146 Ga0075431_100000071
2147 Ga0075431_100007105
2148 Ga0075431_100046776
2149 Ga0075431_100245954
2150 Ga0075433_10100040
2151 Ga0075434_100000004
2152 Ga0075434_100001086
2153 Ga0075434_100003417
2154 Ga0075434_100081205
2155 Ga0075434_100081590
2156 Ga0075434_100123733
2157 Ga0075429_100000051
2158 Ga0075429_100009199
2159 Ga0075429_100063395
2160 Ga0068865_100001146
2161 Ga0068865_100013695
2162 Ga0068865_100043597
2163 Ga0068865_100077454
2164 Ga0068865_100197862
2165 Ga0075436_100000331
2166 Ga0075436_100031681
2167 Ga0097620_100001046
2168 Ga0097620_100004627
2169 Ga0097620_100005100
2170 Ga0097620_100011776
2171 Ga0097620_100131360
2172 Ga0097620_100371106
2173 Ga0097620_100432534
2174 Ga0099825_1027213
2175 Ga0099824_1014858
2176 Ga0099822_1003531
2177 Ga0099826_10017935
2178 Ga0075435_100000313
2179 Ga0075435_100018126
2180 Ga0075435_100028667
2181 Ga0075435_100102689
2182 Ga0075435_100118661
2183 Ga0075435_100122701
2184 Ga0075435_100239513
2185 Ga0099794_10023907
2186 Ga0105251_10025368
2187 Ga0105244_10004646
2188 Ga0105240_10000250
2189 Ga0105240_10005077
2190 Ga0105240_10005554
2191 Ga0105240_10035358
2192 Ga0105240_10167477
2193 Ga0105240_10229755
2194 Ga0105240_10318126
2195 Ga0111539_10003132
2196 Ga0111539_10010804
2197 Ga0111539_10047411
2198 Ga0111539_10052402
2199 Ga0111539_10076125
2200 Ga0111539_10113136
2201 Ga0105245_10014889
2202 Ga0105245_10054950
2203 Ga0105247_10010424
2204 Ga0105247_10027421
2205 Ga0105247_10130989
2206 Ga0114129_10000009
2207 Ga0114129_10000337
2208 Ga0114129_10120173
2209 Ga0105243_10000915
2210 Ga0105243_10001591
2211 Ga0105243_10027411
2212 Ga0105243_10137416
2213 Ga0105243_10186934
2214 Ga0105241_10002214
2215 Ga0105241_10011671
2216 Ga0105242_10000945
2217 Ga0105242_10095819
2218 Ga0105248_10004085
2219 Ga0105248_10014014
2220 Ga0105248_10036026
2221 Ga0105237_10000806
2222 Ga0105237_10037340
2223 Ga0105237_10068354
2224 Ga0105237_10083206
2225 Ga0105237_10091804
2226 Ga0105237_10112524
2227 Ga0105237_10202255
2228 Ga0105238_10014862
2229 Ga0105238_10073324
2230 Ga0105238_10077770
2231 Ga0105249_10000975
2232 Ga0105249_10006665
2233 Ga0105249_10274324
2234 Ga0105249_10313131
2235 Ga0105249_10389405
2236 Ga0105239_10000292
2237 Ga0105239_10055870
2238 Ga0105239_10065549
2239 Ga0105239_10078771
2240 Ga0105239_10099166
2241 Ga0105239_10354637
2242 Ga0105239_10419615
2243 Ga0105246_10056261
2244 Ga0105246_10093617
2245 Ga0105246_10094888
2246 Ga0105246_10181185
2247 Ga0157373_10008298
2248 Ga0157373_10009650
2249 Ga0157373_10035104
2250 Ga0157371_10000769
2251 Ga0157370_10008286
2252 Ga0157370_10008739
2253 Ga0157370_10010979
2254 Ga0157370_10012141
2255 Ga0157370_10029684
2256 Ga0157370_10056276
2257 Ga0157370_10078446
2258 Ga0157370_10176423
2259 Ga0157369_10008103
2260 Ga0157369_10044792
2261 Ga0157369_10077758
2262 Ga0157369_10156297
2263 Ga0157369_10298009
2264 Ga0157374_10001486
2265 Ga0157374_10006780
2266 Ga0157374_10046727
2267 Ga0157374_10080670
2268 Ga0157374_10356313
2269 Ga0157378_10000844
2270 Ga0157378_10079380
2271 Ga0157378_10092014
2272 Ga0157378_10192977
2273 Ga0157378_10197493
2274 Ga0163162_10005722
2275 Ga0163162_10018632
2276 Ga0163162_10074028
2277 Ga0163162_10079077
2278 Ga0163162_10140144
2279 Ga0163162_10177704
2280 Ga0163162_10251441
2281 Ga0157372_10004681
2282 Ga0157372_10006187
2283 Ga0157372_10007871
2284 Ga0157372_10024035
2285 Ga0157372_10229700
2286 Ga0157372_10360707
2287 Ga0157375_10002482
2288 Ga0157375_10021511
2289 Ga0157375_10030198
2290 Ga0157375_10031394
2291 Ga0157375_10055972
2292 Ga0157375_10073768
2293 Ga0157375_10096977
2294 Ga0157375_10373761
2295 Ga0163163_10003555
2296 Ga0163163_10007010
2297 Ga0163163_10016615
2298 Ga0163163_10028233
2299 Ga0163163_10056064
2300 Ga0163163_10103916
2301 Ga0163163_10200477
2302 Ga0157380_10002048
2303 Ga0157380_10032105
2304 Ga0157380_10032106
2305 Ga0157380_10075159
2306 Ga0157380_10093331
2307 Ga0157380_10113689
2308 Ga0182008_10021837
2309 Ga0182008_10032465
2310 Ga0182008_10049084
2311 Ga0157377_10057796
2312 Ga0157379_10000542
2313 Ga0157379_10003892
2314 Ga0157379_10045142
2315 Ga0157379_10131429
2316 Ga0157379_10151476
2317 Ga0157379_10306548
2318 Ga0157376_10010104
2319 Ga0157376_10060761
2320 Ga0157376_10065423
2321 Ga0182006_1003114
2322 Ga0183362_10004
2323 Ga0163161_10000198
2324 Ga0163161_10004824
2325 Ga0163161_10054872
2326 Ga0163161_10087527
2327 Ga0163161_10103861
2328 Ga0163161_10124173
2329 Ga0163161_10131830
2330 Ga0197907_11408047
2331 Ga0213874_10027747
2332 Ga0213876_10067981
2333 Ga0213871_10004080
2334 Ga0224712_10020465
2335 Ga0209435_100007
2336 Ga0209436_105003
2337 Ga0209147_100017
2338 Ga0209563_101866
2339 Ga0209437_100272
2340 Ga0209258_100297
2341 Ga0207425_1000697
2342 Ga0209646_1000061
2343 Ga0209646_1000096
2344 Ga0209026_1000052
2345 Ga0209026_1002209
2346 Ga0209677_102108
2347 Ga0209677_105443
2348 Ga0209148_1000500
2349 Ga0209759_1000174
2350 Ga0209759_1000537
2351 Ga0209129_1000168
2352 Ga0209129_1001716
2353 Ga0209233_1001496
2354 Ga0209233_1012236
2355 Ga0209565_1000078
2356 Ga0209565_1000350
2357 Ga0209565_1000992
2358 Ga0209455_1006056
2359 Ga0209455_1009658
2360 Ga0209673_1000516
2361 Ga0209673_1000627
2362 Ga0209673_1010584
2363 Ga0209130_1000440
2364 Ga0209130_1000798
2365 Ga0209130_1001805
2366 Ga0209130_1008121
2367 Ga0209675_1000355
2368 Ga0209675_1000916
2369 Ga0209675_1000925
2370 Ga0209675_1002231
2371 Ga0209675_1005267
2372 Ga0209676_1000312
2373 Ga0209676_1000403
2374 Ga0209676_1003118
2375 Ga0209676_1041466
2376 Ga0209025_1000242
2377 Ga0209025_1000378
2378 Ga0209025_1001004
2379 Ga0209025_1065104
2380 Ga0209564_1000157
2381 Ga0209564_1006742
2382 Ga0209758_1000042
2383 Ga0209758_1002409
2384 Ga0209758_1012843
2385 Ga0209050_1001555
2386 Ga0209050_1002543
2387 Ga0209256_1000724
2388 Ga0209256_1035123
2389 Ga0207426_1000055
2390 Ga0207426_1000238
2391 Ga0207426_1000428
2392 Ga0207426_1002351
2393 Ga0207426_1030684
2394 Ga0207426_1037474
2395 Ga0209051_1000286
2396 Ga0209051_1000376
2397 Ga0209051_1000655
2398 Ga0209051_1005994
2399 Ga0209051_1007305
2400 Ga0209257_1000215
2401 Ga0209257_1002370
2402 Ga0209257_1011096
2403 Ga0209257_1012170
2404 Ga0209257_1022478
2405 Ga0209257_1023675
2406 Ga0207697_10014602
2407 Ga0207697_10029265
2408 Ga0207656_10016183
2409 Ga0207655_1003433
2410 Ga0207713_1016034
2411 Ga0207682_10012567
2412 Ga0207692_10000845
2413 Ga0207692_10004717
2414 Ga0207642_10008441
2415 Ga0207642_10105054
2416 Ga0207688_10072893
2417 Ga0207680_10048692
2418 Ga0207680_10050541
2419 Ga0207647_10006516
2420 Ga0207647_10045018
2421 Ga0207685_10004501
2422 Ga0207699_10004348
2423 Ga0207699_10008314
2424 Ga0207645_10000187
2425 Ga0207645_10000236
2426 Ga0207645_10037265
2427 Ga0207645_10088550
2428 Ga0207645_10109515
2429 Ga0207643_10022515
2430 Ga0207643_10068297
2431 Ga0207654_10007014
2432 Ga0207654_10014569
2433 Ga0207654_10122401
2434 Ga0207707_10007114
2435 Ga0207707_10007388
2436 Ga0207707_10017925
2437 Ga0207707_10068237
2438 Ga0207695_10000008
2439 Ga0207695_10000615
2440 Ga0207695_10025000
2441 Ga0207695_10049084
2442 Ga0207695_10099403
2443 Ga0207695_10159680
2444 Ga0207695_10167863
2445 Ga0207695_10216393
2446 Ga0207695_10241549
2447 Ga0207671_10011165
2448 Ga0207671_10030267
2449 Ga0207671_10048900
2450 Ga0207671_10056947
2451 Ga0207693_10001388
2452 Ga0207693_10002380
2453 Ga0207693_10019236
2454 Ga0207693_10236822
2455 Ga0207663_10000515
2456 Ga0207663_10043229
2457 Ga0207663_10124966
2458 Ga0207660_10012876
2459 Ga0207660_10035751
2460 Ga0207660_10042551
2461 Ga0207660_10047995
2462 Ga0207660_10090458
2463 Ga0207662_10000233
2464 Ga0207657_10000102
2465 Ga0207657_10000250
2466 Ga0207657_10004866
2467 Ga0207657_10007662
2468 Ga0207657_10020898
2469 Ga0207657_10036021
2470 Ga0207657_10062444
2471 Ga0207657_10066317
2472 Ga0207649_10030080
2473 Ga0207652_10003521
2474 Ga0207652_10007056
2475 Ga0207652_10196633
2476 Ga0207646_10068594
2477 Ga0207646_10153213
2478 Ga0207646_10185421
2479 Ga0207646_10321466
2480 Ga0207681_10001251
2481 Ga0207681_10005840
2482 Ga0207681_10028920
2483 Ga0207681_10046404
2484 Ga0207681_10074720
2485 Ga0207681_10265589
2486 Ga0207694_10055785
2487 Ga0207694_10066581
2488 Ga0207694_10332411
2489 Ga0207650_10005839
2490 Ga0207650_10015099
2491 Ga0207650_10018209
2492 Ga0207650_10036293
2493 Ga0207659_10005194
2494 Ga0207659_10017441
2495 Ga0207659_10017845
2496 Ga0207659_10030124
2497 Ga0207659_10074910
2498 Ga0207687_10000552
2499 Ga0207687_10002722
2500 Ga0207687_10019251
2501 Ga0207687_10030964
2502 Ga0207687_10033203
2503 Ga0207687_10174019
2504 Ga0207700_10000062
2505 Ga0207700_10027270
2506 Ga0207700_10036858
2507 Ga0207700_10173653
2508 Ga0207664_10001592
2509 Ga0207664_10008636
2510 Ga0207664_10023886
2511 Ga0207664_10081537
2512 Ga0207644_10008758
2513 Ga0207644_10009820
2514 Ga0207644_10026050
2515 Ga0207644_10034755
2516 Ga0207644_10089922
2517 Ga0207644_10124426
2518 Ga0207690_10001799
2519 Ga0207690_10182296
2520 Ga0207690_10237399
2521 Ga0207706_10000095
2522 Ga0207706_10015953
2523 Ga0207706_10027452
2524 Ga0207706_10030841
2525 Ga0207706_10118637
2526 Ga0207706_10165670
2527 Ga0207686_10000989
2528 Ga0207709_10000092
2529 Ga0207709_10001455
2530 Ga0207709_10006663
2531 Ga0207709_10060202
2532 Ga0207670_10003492
2533 Ga0207669_10003427
2534 Ga0207669_10006265
2535 Ga0207704_10000547
2536 Ga0207704_10002119
2537 Ga0207704_10042711
2538 Ga0207665_10011003
2539 Ga0207665_10015264
2540 Ga0207665_10044837
2541 Ga0207665_10160962
2542 Ga0207691_10000305
2543 Ga0207691_10001872
2544 Ga0207691_10006614
2545 Ga0207691_10007383
2546 Ga0207691_10008924
2547 Ga0207691_10022644
2548 Ga0207691_10030534
2549 Ga0207691_10030672
2550 Ga0207691_10046211
2551 Ga0207691_10056047
2552 Ga0207691_10087765
2553 Ga0207691_10159818
2554 Ga0207691_10198110
2555 Ga0207711_10001126
2556 Ga0207711_10020916
2557 Ga0207711_10050804
2558 Ga0207689_10002282
2559 Ga0207689_10002780
2560 Ga0207689_10004782
2561 Ga0207689_10020951
2562 Ga0207689_10025866
2563 Ga0207689_10069380
2564 Ga0207689_10121118
2565 Ga0207679_10016304
2566 Ga0207679_10107154
2567 Ga0207679_10152752
2568 Ga0207679_10260121
2569 Ga0207667_10004358
2570 Ga0207667_10009599
2571 Ga0207667_10017754
2572 Ga0207667_10073105
2573 Ga0207667_10089507
2574 Ga0207667_10101035
2575 Ga0207667_10152756
2576 Ga0207667_10174570
2577 Ga0207651_10002756
2578 Ga0207651_10018649
2579 Ga0207651_10032573
2580 Ga0207651_10033399
2581 Ga0207651_10037613
2582 Ga0207651_10113146
2583 Ga0207651_10172911
2584 Ga0207651_10240589
2585 Ga0207712_10002814
2586 Ga0207712_10151136
2587 Ga0207668_10005820
2588 Ga0207668_10007591
2589 Ga0207668_10011214
2590 Ga0207668_10019431
2591 Ga0207668_10050285
2592 Ga0207668_10082183
2593 Ga0207668_10102095
2594 Ga0207668_10121507
2595 Ga0207640_10035942
2596 Ga0207640_10054084
2597 Ga0207640_10059190
2598 Ga0207640_10083649
2599 Ga0207658_10004062
2600 Ga0207658_10013833
2601 Ga0207658_10146753
2602 Ga0207677_10000926
2603 Ga0207677_10005445
2604 Ga0207677_10006472
2605 Ga0207677_10010738
2606 Ga0207677_10031143
2607 Ga0207703_10000552
2608 Ga0207703_10001501
2609 Ga0207703_10016718
2610 Ga0207703_10077643
2611 Ga0207639_10044654
2612 Ga0207639_10045118
2613 Ga0207639_10048208
2614 Ga0207639_10074437
2615 Ga0207639_10139600
2616 Ga0207639_10228656
2617 Ga0207678_10020643
2618 Ga0207678_10036306
2619 Ga0207678_10094994
2620 Ga0207678_10099182
2621 Ga0207708_10002518
2622 Ga0207708_10004176
2623 Ga0207708_10082165
2624 Ga0207702_10001309
2625 Ga0207702_10021617
2626 Ga0207702_10025993
2627 Ga0207702_10062465
2628 Ga0207702_10089750
2629 Ga0207702_10169036
2630 Ga0207641_10010854
2631 Ga0207641_10040599
2632 Ga0207641_10050538
2633 Ga0207641_10050730
2634 Ga0207641_10065372
2635 Ga0207641_10074094
2636 Ga0207641_10132086
2637 Ga0207641_10264493
2638 Ga0207648_10002355
2639 Ga0207648_10004793
2640 Ga0207648_10008777
2641 Ga0207648_10012840
2642 Ga0207648_10013617
2643 Ga0207648_10014379
2644 Ga0207648_10023176
2645 Ga0207648_10033406
2646 Ga0207648_10074787
2647 Ga0207648_10147770
2648 Ga0207648_10334233
2649 Ga0207676_10001004
2650 Ga0207676_10006584
2651 Ga0207676_10029335
2652 Ga0207676_10032673
2653 Ga0207676_10039828
2654 Ga0207676_10061120
2655 Ga0207676_10149817
2656 Ga0207676_10181790
2657 Ga0207674_10000131
2658 Ga0207674_10000326
2659 Ga0207674_10007985
2660 Ga0207674_10017015
2661 Ga0207674_10018761
2662 Ga0207674_10101788
2663 Ga0207674_10108501
2664 Ga0207675_100001604
2665 Ga0207675_100003012
2666 Ga0207675_100003839
2667 Ga0207675_100005164
2668 Ga0207675_100063462
2669 Ga0207675_100144245
2670 Ga0207675_100265152
2671 Ga0207683_10000012
2672 Ga0207683_10001281
2673 Ga0207683_10001607
2674 Ga0207683_10003558
2675 Ga0207683_10024843
2676 Ga0207683_10025806
2677 Ga0207683_10070414
2678 Ga0207683_10083926
2679 Ga0207683_10182154
2680 Ga0207698_10010991
2681 Ga0207698_10023151
2682 Ga0207698_10024354
2683 Ga0207698_10035244
2684 Ga0207698_10075023
2685 Ga0209389_1000107
2686 Ga0209389_1002563
2687 Ga0209589_1000011
2688 Ga0209589_1000036
2689 Ga0209969_1005608
2690 Ga0209489_100006
2691 Ga0209489_100012
2692 Ga0209489_115889
2693 Ga0209489_115890
2694 Ga0209700_100005
2695 Ga0209700_100019
2696 Ga0209967_1000511
2697 Ga0209981_1001823
2698 Ga0210000_1002564
2699 Ga0209995_1001143
2700 Ga0209968_1003859
2701 Ga0209999_1001594
2702 Ga0209999_1012519
2703 Ga0209282_1021775
2704 Ga0209971_1003964
2705 Ga0209813_10010027
2706 Ga0209974_10000445
2707 Ga0207428_10000610
2708 Ga0207428_10006909
2709 Ga0268266_10002874
2710 Ga0268266_10006338
2711 Ga0268266_10012839
2712 Ga0268266_10015598
2713 Ga0268266_10034249
2714 Ga0268266_10042648
2715 Ga0268266_10200834
2716 Ga0268266_10206171
2717 Ga0268266_10247698
2718 Ga0268265_10001521
2719 Ga0268265_10003158
2720 Ga0268265_10014343
2721 Ga0268265_10021079
2722 Ga0268265_10053207
2723 Ga0268264_10000940
2724 Ga0268264_10002908
2725 Ga0268264_10023563
2726 Ga0268264_10026248
2727 Ga0268264_10075073
2728 Ga0268264_10080564
2729 Ga0268264_10092250
2730 Ga0268264_10242934
2731 Ga0268264_10326908
2732 Ga0265334_10006395
2733 Ga0307517_10002655
2734 Ga0307517_10096177
2735 Ga0307517_10146755
2736 Ga0307515_10000043
2737 Ga0307515_10000997
2738 Ga0307515_10005007
2739 Ga0307515_10034195
2740 Ga0307515_10104042
2741 Ga0316177_1144764
2742 Ga0314311_1228247
2743 Ga0316178_1010387
2744 Ga0316183_1086850
2745 Ga0316181_1069579
2746 Ga0265332_10004724
2747 Ga0265329_10002279
2748 Ga0265339_10054753
2749 Ga0265331_10000350
2750 Ga0265327_10008774
2751 Ga0307513_10000034
2752 Ga0307513_10002789
2753 Ga0307513_10009006
2754 Ga0307513_10029154
2755 Ga0307509_10004612
2756 Ga0307509_10005248
2757 Ga0307509_10012825
2758 Ga0307509_10122339
2759 Ga0307408_100000548
2760 Ga0307408_100026129
2761 Ga0307408_100028905
2762 Ga0307408_100160228
2763 Ga0307408_100335977
2764 Ga0307508_10000450
2765 Ga0265314_10000412
2766 Ga0307516_10000851
2767 Ga0307516_10003913
2768 Ga0307516_10004352
2769 Ga0307516_10016764
2770 Ga0307516_10021101
2771 Ga0307405_10003700
2772 Ga0307405_10062009
2773 Ga0307405_10075847
2774 Ga0307413_10014837
2775 Ga0307413_10034139
2776 Ga0307410_10004349
2777 Ga0307406_10000252
2778 Ga0307406_10003266
2779 Ga0307407_10003718
2780 Ga0307407_10037735
2781 Ga0307412_10002295
2782 Ga0307412_10021748
2783 Ga0307412_10041107
2784 Ga0307412_10047853
2785 Ga0307412_10245617
2786 Ga0307412_10247899
2787 Ga0307409_100002844
2788 Ga0307409_100146642
2789 Ga0307409_100180960
2790 Ga0307409_100184763
2791 Ga0307409_100240104
2792 Ga0307416_100184015
2793 Ga0307416_100226173
2794 Ga0307416_100240084
2795 Ga0307414_10110857
2796 Ga0307414_10125952
2797 Ga0307411_10007755
2798 Ga0307411_10140477
2799 Ga0307415_100011785
2800 Ga0307415_100173912
2801 Ga0316583_10012723
2802 Ga0307507_10047573
2803 Ga0307510_10000109
2804 Ga0307510_10014792
2805 Ga0315911_1000003
2806 Ga0373926_0020461
2807 Ga0373926_0053100
2808 Ga0373934_0000122
2809 Ga0373934_0003712
2810 Ga0373940_0014767
2811 Ga0373944_0002441
2812 Ga0373944_0017518
2813 Ga0373944_0025274
2814 Ga0373951_0019282
2815 Ga0373923_0001868
2816 Ga0373923_0057258
2817 Ga0373932_0007459
2818 Ga0373936_0014020
2819 Ga0373939_0017052
2820 Ga0373945_0002362
2821 Ga0373945_0010415
2822 Ga0373953_0003552
2823 Ga0373954_0000174
2824 Ga0373954_0000449
2825 Ga0373954_0002684
2826 Ga0373954_0007283
2827 Ga0373954_0008944
2828 Ga0373954_0055388
2829 Ga0373956_0000054
2830 Ga0373956_0014793
2831 Ga0373957_0001739
2832 Ga0373957_0003860
2833 Ga0373957_0004716
2834 Ga0373943_0004691
2835 Ga0373955_0002291
2836 Ga0373955_0031289
2837 Ga0373955_0079730
2838 Ga0373942_0017293
2839 Ga0373962_0005867
2840 Ga0373924_0003449
2841 Ga0373924_0006114
2842 Ga0373924_0019126
2843 Ga0373924_0073167
2844 Ga0373931_0006471
2845 Ga0373935_0007402
2846 Ga0373935_0007934
2847 Ga0373935_0011968
2848 Ga0373935_0065650
2849 Ga0373935_0065896
2850 Ga0373927_0005049
2851 Ga0373927_0008390
2852 Ga0373927_0010118
2853 Ga0373927_0029106
2854 Ga0373927_0034249
2855 Ga0373927_0049493
2856 Ga0373927_0091638
2857 Ga0373933_0000782
2858 Ga0373933_0008072
2859 Ga0373933_0012960
2860 Ga0373933_0088040
2861 Ga0373933_0178186
2862 Ga0373947_0015681
2863 Ga0373947_0098568
2864 Ga0373937_0000590
2865 Ga0373937_0001198
2866 Ga0373937_0022602
2867 Ga0373937_0035822
2868 Ga0373937_0286396
2869 Ga0316582_0005485
2870 Ga0373925_0009683
2871 Ga0373925_0016652
2872 Ga0373925_0105673
2873 Ga0373925_0128155
2874 Ga0373925_0172471
2875 Ga0395899_0187655
2876 Ga0395900_0001586
2877 Ga0395900_0054523
2878 Ga0395900_0070956
2879 Ga0395898_0018855
2880 Ga0395898_0031129
2881 Ga0395898_0035905
2882 Ga0395898_0067374
2883 Ga0395898_0098090
2884 Ga0395898_0123792
2885 Ga0395898_0205184
2886 Ga0395905_0055068
2887 Ga0395905_0203655
2888 Ga0395905_0285136
2889 Ga0316581_0006616
2890 Ga0436364_0175508
2891 Ga0436364_1468890
2892 Ga0395901_0001544
2893 Ga0395901_0009907
2894 Ga0395901_0014285
2895 Ga0395901_0034663
2896 Ga0395901_0077928
2897 Ga0395901_0244032
2898 Ga0395901_0338812
2899 Ga0395901_0378743
2900 Ga0395901_0425223
2901 Ga0436365_1860619
2902 Ga0436360_0269953
2903 Ga0436360_0914350
2904 Ga0439436_0005119
2905 Ga0439466_0004842
2906 Ga0451800_1323902
2907 Ga0439441_001747
2908 Ga0439441_004454
2909 Ga0439442_007829
2910 Ga0439432_006320
2911 Ga0439449_0009382
2912 Ga0450911_001006
2913 Ga0439446_0000182
2914 Ga0439446_0004139
2915 Ga0439434_0000753
2916 Ga0439434_0026983
2917 Ga0439435_0010096
2918 Ga0439444_0010178
2919 Ga0439460_0011018
2920 Ga0466972_0000122
2921 Ga0466965_0014791
2922 Ga0466966_0008365
2923 Ga0466966_0020376
2924 Ga0466961_0000038
2925 Ga0466971_0088447
2926 Ga0466957_0069481
2927 Ga0466957_0229669
2928 Ga0466959_0009876
2929 Ga0466959_0071972
2930 Ga0451576_0001864
2931 Ga0451576_0004679
2932 Ga0451576_0015696
2933 Ga0466967_0152177
2934 Ga0495592_0000160
2935 Ga0495592_0000163
2936 Ga0495592_0001343
2937 Ga0495592_0009664
2938 Ga0495592_0031488
2939 Ga0495603_0041723
2940 Ga0495629_0171883
2941 Ga0495641_0012566
2942 Ga0495651_0000881
2943 Ga0495651_0013912
2944 Ga0495651_0068424
2945 Ga0495653_0045866
2946 Ga0495653_0120810
2947 Ga0495580_0019423
2948 Ga0495580_0060427
2949 Ga0495582_0001076
2950 Ga0495582_0008434
2951 Ga0495639_0001255
2952 Ga0495639_0004716
2953 Ga0495639_0005054
2954 Ga0495639_0010412
2955 Ga0495639_0014938
2956 Ga0495662_0002396
2957 Ga0495662_0091002
2958 Ga0495664_0024586
2959 Ga0495594_0015836
2960 Ga0495594_0052150
2961 Ga0495607_0001888
2962 Ga0495608_0000112
2963 Ga0495608_0078079
2964 Ga0495610_0013320
2965 Ga0495610_0042766
2966 Ga0495616_0018427
2967 Ga0495618_0031487
2968 Ga0495620_0051678
2969 Ga0495628_0000931
2970 Ga0495628_0005171
2971 Ga0495628_0056050
2972 Ga0495628_0098401
2973 Ga0495628_0138512
2974 Ga0495630_0002409
2975 Ga0495631_0000660
2976 Ga0495632_0008995
2977 Ga0495643_0017469
2978 Ga0495666_0010469
2979 Ga0495666_0081289
2980 Ga0495642_0021710
2981 Ga0495652_0010373
2982 Ga0495652_0041978
2983 Ga0495652_0055601
2984 Ga0495652_0084990
2985 Ga0495665_0001558
2986 Ga0495665_0002382
2987 Ga0495665_0005107
2988 Ga0495665_0059015
2989 Ga0495640_0008789
2990 Ga0495640_0036716
2991 Ga0495640_0038067
2992 Ga0495586_0004819
2993 Ga0495586_0005688
2994 Ga0495586_0049507
2995 Ga0495586_0102747
2996 Ga0495587_0039563
2997 Ga0495598_0009416
2998 Ga0495597_0000271
2999 Ga0495597_0016916
3000 Ga0495645_0000592
3001 Ga0495645_0021371
3002 Ga0495645_0031168
3003 Ga0495645_0163303
3004 Ga0495668_0006479
3005 Ga0495634_0047458
3006 Ga0495625_0000146
3007 Ga0495625_0000337
3008 Ga0495625_0015391
3009 Ga0495625_0016801
3010 Ga0495625_0023947
3011 Ga0495635_0008975
3012 Ga0495635_0029727
3013 Ga0495661_0004974
3014 Ga0495588_0005084
3015 Ga0495588_0053535
3016 Ga0495657_0029626
3017 Ga0495599_0020376
3018 Ga0495599_0025468
3019 Ga0495623_0012442
3020 Ga0495647_0003916
3021 Ga0495647_0004228
3022 Ga0495647_0006474
3023 Ga0495647_0006981
3024 Ga0495658_0006398
3025 Ga0495658_0014450
3026 Ga0495658_0018307
3027 Ga0495658_0047719
3028 Ga0495669_0002266
3029 Ga0495613_0017768
3030 Ga0495613_0019748
3031 Ga0495613_0027380
3032 Ga0495624_0007501
3033 Ga0495624_0027634
3034 Ga0495624_0040501
3035 Ga0495649_0011645
3036 Ga0495600_0000413
3037 Ga0495581_0003251
3038 Ga0495604_0051220
3039 Ga0495674_0009334
3040 Ga0495672_0011717
3041 Ga0495676_0004847
3042 Ga0495676_0027757
3043 Ga0495676_0033347
3044 Ga0495680_0003144
3045 Ga0495680_0030418
3046 Ga0495680_0066319
3047 Ga0495680_0071548
3048 Ga0495687_004820
3049 Ga0495687_017610
3050 Ga0495687_022383
3051 Ga0495675_0018241
3052 Ga0495675_0075459
3053 Ga0495685_027576
3054 Ga0495673_0072245
3055 Ga0495681_0062573
3056 Ga0495684_0042716
3057 Ga0496100_0030763
3058 Ga0496100_0184125
3059 Ga0496100_0202541
3060 Ga0496101_0000648
3061 Ga0496101_0008563
3062 Ga0496101_0015153
3063 Ga0496101_0022950
3064 Ga0496102_0006708
3065 Ga0496102_0009709
3066 Ga0496102_0021133
3067 Ga0496102_0025539
3068 Ga0496102_0045525
3069 Ga0496102_0048945
3070 Ga0496103_0010060
3071 Ga0496103_0020553
3072 Ga0496103_0066360
3073 Ga0496103_0086628
3074 Ga0496104_0009873
3075 Ga0496104_0010866
3076 Ga0496104_0013631
3077 Ga0496104_0017610
3078 Ga0496104_0023744
3079 Ga0496104_0324337
3080 Ga0496105_0004124
3081 Ga0496105_0020682
3082 Ga0496105_0026867
3083 Ga0496105_0062665
3084 Ga0496106_0013736
3085 Ga0496106_0071440
3086 Ga0496106_0131483
3087 Ga0496106_0147962
3088 Ga0496107_0010282
3089 Ga0496107_0014148
3090 Ga0496107_0111178
3091 Ga0496107_0114631
3092 Ga0496108_0004526
3093 Ga0496108_0034837
3094 Ga0496108_0090160
3095 Ga0496109_0009137
3096 Ga0496109_0124537
3097 Ga0496109_0136115
3098 Ga0496109_0141421
3099 Ga0496109_0300190
3100 Ga0496109_0324861
3101 Ga0496109_0332129
3102 Ga0496110_0007558
3103 Ga0496110_0058595
3104 Ga0496110_0162407
3105 Ga0496110_0253393
3106 Ga0496111_0080941
3107 Ga0496112_0002865
3108 Ga0496112_0008850
3109 Ga0496112_0027916
3110 Ga0496112_0028785
3111 Ga0496112_0248046
3112 Ga0496112_0270924
3113 Ga0496113_0010063
3114 Ga0496113_0168466
3115 Ga0496113_0219647
3116 Ga0496114_0008449
3117 Ga0496114_0020456
3118 Ga0496114_0038579
3119 Ga0496114_0134807
3120 Ga0496115_0013729
3121 Ga0496116_0009705
3122 Ga0496116_0026735
3123 Ga0496117_0037255
3124 Ga0496118_0009367
3125 Ga0496118_0015550
3126 Ga0496121_0017571
3127 Ga0496121_0067230
3128 Ga0496121_0077877
3129 Ga0496121_0141252
3130 Ga0496121_0170361
3131 Ga0496121_0227373
3132 Ga0496122_0000408
3133 Ga0496123_0000124
3134 Ga0496123_0000188
3135 Ga0496123_0119361
3136 Ga0496125_0000060
3137 Ga0496125_0000939
3138 Ga0496125_0003316
3139 Ga0496125_0012543
3140 Ga0496125_0038850
3141 Ga0496126_0061276
3142 Ga0496126_0066290
3143 Ga0495678_058853
3144 Ga0501033_0221879
3145 Ga0501034_0002706
3146 Ga0501034_0049783
3147 Ga0501034_0049918
3148 Ga0501034_0077092
3149 Ga0501034_0101177
3150 Ga0501036_0036902
3151 Ga0501036_0115181
3152 Ga0501037_0093781
3153 Ga0501038_0023765
3154 Ga0501038_0079258
3155 Ga0501039_0001773
3156 Ga0501039_0010820
3157 Ga0501039_0032989
3158 Ga0501039_0051640
3159 Ga0501039_0056245
3160 Ga0501039_0187571
3161 Ga0501040_0005843
3162 Ga0501040_0007299
3163 Ga0501040_0016338
3164 Ga0501040_0022260
3165 Ga0501041_0001572
3166 Ga0501041_0005336
3167 Ga0501041_0034766
3168 Ga0501042_0003040
3169 Ga0501042_0011136
3170 Ga0501042_0063919
3171 Ga0501043_0149735
3172 Ga0501046_0010010
3173 Ga0501047_0075613
3174 Ga0501047_0240411
3175 Ga0501048_0016231
3176 Ga0501067_0056290
3177 Ga0501067_0082717
3178 Ga0501068_0014530
3179 Ga0501070_0054730
3180 Ga0501070_0070807
3181 Ga0501070_0316420
3182 Ga0501071_0000373
3183 Ga0501071_0016292
3184 Ga0501071_0019722
3185 Ga0501071_0021607
3186 Ga0501072_0001156
3187 Ga0501072_0002674
3188 Ga0501072_0010678
3189 Ga0501072_0018804
3190 Ga0501072_0069898
3191 Ga0501073_0005691
3192 Ga0501073_0162819
3193 Ga0501074_0066911
3194 Ga0501074_0124449
3195 Ga0501074_0131313
3196 Ga0501075_0000936
3197 Ga0501075_0028293
3198 Ga0501075_0093655
3199 Ga0501075_0112563
3200 Ga0501076_0000368
3201 Ga0501076_0000723
3202 Ga0501076_0008694
3203 Ga0501076_0067779
3204 Ga0501076_0107612
3205 Ga0501076_0149854
3206 Ga0501077_0007614
3207 Ga0501077_0010717
3208 Ga0501077_0084935
3209 Ga0501079_0004391
3210 Ga0501079_0006780
3211 Ga0501079_0019212
3212 Ga0501079_0242440
3213 Ga0501080_0000884
3214 Ga0501080_0014279
3215 Ga0501080_0018314
3216 Ga0501080_0059029
3217 Ga0501081_0008922
3218 Ga0501081_0012105
3219 Ga0501081_0162389
3220 Ga0501081_0174342
3221 Ga0501083_0099888
3222 Ga0501262_000676
3223 Ga0501035_0160942
3224 Ga0501035_0185716
3225 Ga0501044_0014975
3226 Ga0501044_0040015
3227 Ga0501044_0042184
3228 Ga0501044_0206525
3229 Ga0501045_0000263
3230 Ga0501045_0007193
3231 Ga0501045_0009377
3232 Ga0501045_0203571
3233 nmdc:mga03683_67597_c1
3234 nmdc:mga03n38_28823_c1
3235 nmdc:mga00v17_33302_c1
3236 nmdc:mga00v17_62148_c1
3237 nmdc:mga0yw44_14606_c1
3238 nmdc:mga0yw44_28991_c1
3239 nmdc:mga0yw44_86618_c1
3240 nmdc:mga0k408_130547_c1
3241 nmdc:mga0k408_38350_c1
3242 nmdc:mga0k408_5966_c1
3243 nmdc:mga0k408_6258_c1
3244 nmdc:mga0k408_91149_c1
3245 nmdc:mga0k408_9812_c1
3246 nmdc:mga06z11_5930_c1
3247 nmdc:mga06z11_71560_c1
3248 nmdc:mga06z11_79424_c1
3249 nmdc:mga04h51_30499_c1
3250 nmdc:mga07m45_114474_c1
3251 nmdc:mga07m45_1563_c1
3252 nmdc:mga07m45_20110_c1
3253 nmdc:mga07m45_2696_c2
3254 nmdc:mga07m45_3774_c1
3255 nmdc:mga07m45_577_c1
3256 nmdc:mga05p37_758_c1
3257 nmdc:mga05p37_8_c1
3258 nmdc:mga09592_101343_c1
3259 nmdc:mga09592_12310_c1
3260 nmdc:mga09592_130039_c1
3261 nmdc:mga09592_5994_c1
3262 nmdc:mga0qj67_727_c1
3263 nmdc:mga06r32_131218_c1
3264 nmdc:mga06r32_2_c2
3265 nmdc:mga06r32_40790_c1
3266 nmdc:mga06r32_5553_c1
3267 nmdc:mga08y16_10189_c1
3268 nmdc:mga08y16_141939_c1
3269 nmdc:mga08y16_40523_c1
3270 nmdc:mga08y16_7868_c1
3271 nmdc:mga0n895_103893_c1
3272 nmdc:mga0n895_10501_c1
3273 nmdc:mga0n895_126353_c1
3274 nmdc:mga0n895_13715_c1
3275 nmdc:mga0n895_1569_c1
3276 nmdc:mga0n895_2878_c1
3277 nmdc:mga0n895_29379_c1
3278 nmdc:mga0rr50_261772_c1
3279 nmdc:mga0rr50_47223_c1
3280 nmdc:mga08x19_103071_c1
3281 nmdc:mga08x19_10771_c1
3282 nmdc:mga0a205_146335_c1
3283 nmdc:mga0a205_226174_c1
3284 nmdc:mga0sz30_183_c2
3285 Ga0495601_0062656
3286 Ga0495612_0056450
3287 Ga0495595_0015766
3288 Ga0495619_0009928
3289 Ga0500578_0148542
3290 Ga0500651_0000306
3291 Ga0500566_0000003
3292 Ga0500571_000025
3293 Ga0500572_002602
3294 Ga0500595_002313
3295 Ga0500607_053840
3296 Ga0500608_003401
3297 Ga0500608_077346
3298 Ga0500618_004010
3299 Ga0500658_0039107
3300 Ga0500559_0001626
3301 Ga0500559_0002366
3302 Ga0500574_003346
3303 Ga0500603_000184
3304 Ga0500616_0000725
3305 Ga0500630_001089
3306 Ga0500634_0037391
3307 Ga0500639_000033
3308 Ga0500639_086147
3309 Ga0500636_0000042
3310 Ga0500637_0094416
3311 Ga0500596_001686
3312 Ga0500596_004563
3313 Ga0500601_000553
3314 Ga0501084_0047911
3315 Ga0501084_0177745
3316 Ga0501084_0190447
3317 Ga0500661_004312
3318 Ga0501082_0001125
3319 Ga0501082_0011010
3320 Ga0501082_0236387
3321 Ga0530510_0000286
3322 Ga0530510_0000862
3323 Ga0530510_0067151
3324 2509148370
3325 2511248212
3326 2511252324
3327 2513228504
3328 2513622353
3329 2513640530
3330 2513645448
3331 2513657153
3332 2513693739
3333 2513701716
3334 2513863161
3335 2513873134
3336 2513892626
3337 2513919161
3338 2514016521
3339 2517102627
3340 2517891146
3341 2524465597
3342 2524533670
3343 2528848702
3344 2550697506
3345 2553003411
3346 2587755956
3347 2617346997
3348 2643864154
3349 2643981047
3350 2643992454
3351 2644029503
3352 2644163353
3353 2644292143
3354 2644303104
3355 2644305856
3356 2644326638
3357 2644396988
3358 2644469340
3359 2671123252
3360 2723843482
3361 2738724072
3362 2738883437
3363 2739247507
3364 2739284757
3365 2739610807
3366 2793066489
3367 2805914967
3368 2809034915
3369 2809131656
3370 2809151278
3371 2818239675
3372 2819594133
3373 2821450574
3374 2824602357
3375 2824610549
3376 2824618109
3377 2824626777
3378 2824636588
3379 2824645122
3380 2824654326
3381 2824661589
3382 2824672038
3383 2824679862
3384 2824688637
3385 2824697127
3386 2824705091
3387 2824715717
3388 2824725200
3389 2824754372
3390 2824767871
3391 2824775253
3392 2834645881
3393 2838123351
3394 2841946645
3395 2841954122
3396 2841960975
3397 2841969500
3398 2841974616
3399 2841983825
3400 2842679386
3401 2842738338
3402 2842750554
3403 2844319405
3404 2847936581
3405 2847946925
3406 2849078964
3407 2852622440
3408 2857578439
3409 2874611603
3410 2874632268
3411 2879088075
3412 2879108342
3413 2879117467
3414 2881672533
3415 2881929559
3416 2884816086
3417 2884839435
3418 2884856755
3419 2885193315
3420 2885413317
3421 2888384474
3422 2888393436
3423 2888424924
3424 2894023396
3425 2896158101
3426 2903734347
3427 2903752233
3428 2904435008
3429 2904451537
3430 2904458394
3431 2904543190
3432 2904698954
3433 2904701025
3434 2904715095
3435 2906605591
3436 2906616326
3437 2906627163
3438 2906641531
3439 2906646195
3440 2906662891
3441 2908741466
3442 2908758751
3443 2919466499
3444 2922361738
3445 2922374886
3446 2922387012
3447 2922400429
3448 2922431676
3449 2923511539
3450 2928090405
3451 2929160424
3452 2929524029
3453 2929621930
3454 2929629763
3455 2932422932
3456 2932788797
3457 2932812771
3458 2932819137
3459 2932830463
3460 2933583794
3461 2935616757
3462 2935635776
3463 2935641913
3464 2935673044
3465 2935675849
3466 2935685846
3467 2935697908
3468 2935705686
3469 2935714398
3470 2935725017
3471 2935732624
3472 2935742003
3473 2935751811
3474 2935765068
3475 2935802664
3476 2935813506
3477 2935830080
3478 2935837998
3479 2935855381
3480 2935867375
3481 2935875806
3482 2935996470
3483 2936003750
3484 2936042455
3485 2939633593
3486 2940557386
3487 2941512387
3488 2941520108
3489 2941528257
3490 2941539336
3491 2945915454
3492 2945950552
3493 2945974815
3494 2945989144
3495 2954770014
3496 2990714767
3497 3005481475
3498 3005484657
3499 3005510669
3500 3005587692
3501 3005599606
3502 3005722643
3503 8003405145
3504 8006939242
3505 8006966853
3506 8006978900
3507 8006994635
3508 8016521830
3509 8017063824
3510 8019565101
3511 8019575205
3512 8019583172
3513 8019618174
3514 8019658927
3515 8048749031
3516 8055226651
3517 8055745904
3518 8056680897
3519 8056690606
3520 8056968394

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

50

396

0.89

PF13433

Peripla_BP_5

Periplasmic binding protein domain

51

405

0.84

PF01094

ANF_receptor

Receptor family ligand binding region

70

395

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i45-assembly1.cif.gz_A crystal structure of putative twin-arginine translocation pathway signal protein from rhodospirillum rubrum atcc 11170 0.9927 36 409
3i45-assembly1.cif.gz_A crystal structure of putative twin-arginine translocation pathway signal protein from rhodospirillum rubrum atcc 11170 0.9797 36 409
4eyk-assembly1.cif.gz_A crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris bisb5 in complex with 3,4-dihydroxy benzoic acid 0.9058 36 392
3td9-assembly1.cif.gz_A-2 crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution 0.8901 37 388
4evr-assembly1.cif.gz_A crystal structure of abc transporter from r. palustris - solute binding protein (rpa0668) in complex with benzoate 0.8829 36 391
ID Description Score Start End Superfamily
3i45A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9884 36 367 3.40.50.2300
3i45A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.976 155 409 3.40.50.2300
3i45A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9706 155 409 3.40.50.2300
3i45A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9636 36 367 3.40.50.2300
af_Q9SHV1_60_153_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9289 75 140 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2E7F3V2-F1-model_v4 Leucine-binding protein domain-containing protein 0.9644 99 392 GO:0006865
AF-A0A3B8H8H4-F1-model_v4 Leucine-binding protein domain-containing protein 0.946 58 224
AF-W4MB19-F1-model_v4 Leucine-binding protein domain-containing protein 0.9418 99 406
AF-A0A2E7F3V2-F1-model_v4 Leucine-binding protein domain-containing protein 0.9335 99 392 GO:0006865
AF-A0A7C3RB38-F1-model_v4 Leucine-binding protein domain-containing protein 0.9257 36 409 GO:0006865

Map