F495604

General Info

Members Datasets Scaffolds Average Seq Length
1759 699 1545 400

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0044614|Ga0496112_0044614_1799_3163
Length 440
Sequence VSERVVLAYSGGLDTSVAIGWIAEETGAEVIAVAADVGQGGEDLDAIRERALACGAVESLVLDLKEEYAEEYCLPALKANALYLDRYPLVSALSRPVIVKHLVEAARYHGASTVAHGCTGKGNDQVRFEVGIGALAPDIRVLAPVRDSGMSRDKAIAFAEEKGLPIDVTKKSPYSIDQNLWGRAVETGFLEDIWNAPIEDVYDYTADPAVPRDADEVVITFDRGAPVAIDGRPVSVLQAVLELNKRAGAQGVGRLDLVEDRLVGIKSREVYEAPGAIALITAHQELENVTVERDLARFKRPVEQRWGELVYDGLWFSPLKRALDGFVEEANAHVSGDIRLTLHGGRAVVSGRRSQSALYEYEMATYDSGDAFDQSLAKGFVELWGLPSKMAARRDHRVATTQPRRPRMAGVWVLCEASVPGNVPTHLPYVVELNRRMIEA

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2506783011 Frankia datiscae Dg1 Isolate Nodule
3 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
4 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
5 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
6 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
7 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
8 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
9 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
10 2527291627 Frankia casuarinae Thr Isolate Nodule
11 2527291629 Frankia sp. BMG5.23 Isolate Nodule
12 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
13 2547132424 Nocardia nova SH22a Isolate Unclassified
14 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
15 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
16 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
17 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
18 2576861822 Frankia sp. CeD Isolate Nodule
19 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
20 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
21 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
22 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
23 2619618881 Frankia sp. ACN1ag Isolate Unclassified
24 2619619003 Frankia sp. CpI1-P Isolate Nodule
25 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
26 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
27 2626541554 Frankia sp. AvcI.1 Isolate Nodule
28 2643221578 Streptomyces sp. Root63 Isolate Unclassified
29 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
30 2643221616 Leifsonia sp. Root227 Isolate Unclassified
31 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
32 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
33 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
34 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
35 2643221692 Nocardia sp. Root136 Isolate Unclassified
36 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
37 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
38 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
39 2671180195 Frankia sp. CcI49 Isolate Nodule
40 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
41 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
42 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
43 2684623036 Frankia sp. CgIM4 Isolate Nodule
44 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
45 2710264753 Frankia sp. KB5 Isolate Nodule
46 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
47 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
48 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
49 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
50 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
51 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
52 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
53 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
54 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
55 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
56 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
57 2773857922 Frankia sp. CcI49 Isolate Nodule
58 2773857924 Frankia sp. CgIS1 Isolate Nodule
59 2773857933 Frankia sp. BMG5.30 Isolate Nodule
60 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
61 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
62 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
63 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
64 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
65 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
66 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
67 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
68 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
69 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
70 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
71 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
72 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
73 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
74 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
75 2855683550 Micromonospora sp. RP3T Isolate Unclassified
76 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
77 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
78 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
79 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
80 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
81 2858868258 Micromonospora sp. MH33 Isolate Unclassified
82 2858882152 Micromonospora noduli MED15 Isolate Nodule
83 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
84 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
85 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
86 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
87 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
88 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
89 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
90 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
91 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
92 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
93 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
94 2867369537 Streptomyces sp. Z26 Isolate Unclassified
95 2867475112 Streptomyces sp. TM32 Isolate Unclassified
96 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
97 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
98 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
99 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
100 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
101 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
102 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
103 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
104 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
105 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
106 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
107 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
108 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
109 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
110 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
111 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
112 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
113 2902582711 Micromonospora sp. AP08 Isolate Unclassified
114 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
115 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
116 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
117 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
118 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
119 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
120 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
121 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
122 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
123 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
124 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
125 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
126 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
127 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
128 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
129 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
130 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
131 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
132 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
133 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
134 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
135 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
136 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
137 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
138 2922554459 Rhodococcus sp. 66b Isolate Unclassified
139 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
140 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
141 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
142 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
143 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
144 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
145 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
146 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
147 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
148 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
149 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
150 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
151 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
152 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
153 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
154 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
155 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
156 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
157 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
158 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
159 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
160 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
161 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
162 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
163 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
164 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
165 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
166 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
167 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
168 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
169 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
170 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
171 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
172 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
173 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
174 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
175 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
176 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
177 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
178 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
179 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
180 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
181 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
182 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
183 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
184 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
185 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
186 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
187 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
188 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
189 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
190 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
191 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
192 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
193 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
194 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
195 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
196 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
197 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
198 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
199 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
200 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
201 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
202 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
203 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
204 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
205 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
206 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
207 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
208 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
209 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
210 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
211 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
212 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
213 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
214 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
215 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
216 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
217 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
218 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
219 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
220 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
221 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
222 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
223 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
224 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
225 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
226 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
227 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
228 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
229 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
230 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
231 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
232 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
233 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
234 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
235 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
236 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
237 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
238 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
239 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
240 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
241 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
242 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
243 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
244 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
245 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
246 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
247 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
248 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
249 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
250 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
251 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
252 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
253 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
254 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
255 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
256 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
257 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
258 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
259 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
260 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
261 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
262 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
263 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
264 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
265 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
266 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
267 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
268 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
269 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
270 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
271 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
272 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
273 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
274 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
275 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
276 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
277 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
278 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
279 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
280 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
281 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
282 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
283 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
284 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
285 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
286 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
287 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
288 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
289 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
290 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
291 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
292 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
293 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
294 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
295 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
296 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
297 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
298 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
299 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
300 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
301 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
302 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
303 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
304 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
305 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
306 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
307 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
308 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
309 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
310 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
311 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
312 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
313 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
314 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
315 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
316 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
317 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
318 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
319 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
320 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
321 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
322 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
323 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
324 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
325 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
327 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
328 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
329 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
330 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
397 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
401 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
402 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
403 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
404 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
405 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
406 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
407 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
408 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
409 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
410 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
411 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
412 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
413 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
414 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
415 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
416 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
417 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
418 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
419 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
420 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
421 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
422 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
423 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
424 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
425 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
426 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
427 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
428 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
429 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
430 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
431 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
432 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
433 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
434 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
435 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
436 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
437 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
438 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
439 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
440 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
441 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
442 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
443 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
444 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
445 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
446 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
447 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
448 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
449 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
450 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
451 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
452 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
453 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
454 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
455 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
456 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
457 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
458 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
459 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
460 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
461 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
462 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
463 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
464 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
465 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
466 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
467 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
468 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
469 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
470 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
471 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
472 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
473 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
474 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
475 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
476 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
477 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
478 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
479 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
480 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
481 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
482 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
483 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
484 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
485 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
486 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
487 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
488 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
489 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
490 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
491 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
492 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
493 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
494 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
495 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
496 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
497 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
498 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
499 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
500 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
501 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
502 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
503 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
504 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
505 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
506 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
507 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
508 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
509 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
510 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
511 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
512 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
513 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
514 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
515 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
516 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
517 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
518 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
519 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
520 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
521 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
522 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
523 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
524 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
525 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
526 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
527 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
528 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
529 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
530 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
531 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
532 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
533 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
534 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
535 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
536 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
537 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
538 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
539 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
540 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
541 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
542 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
543 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
544 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
545 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
546 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
547 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
548 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
549 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
550 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
551 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
552 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
553 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
554 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
555 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
556 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
557 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
558 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
559 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
560 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
561 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
562 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
563 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
564 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
565 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
566 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
567 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
568 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
569 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
570 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
571 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
572 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
573 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
574 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
575 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
576 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
577 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
578 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
579 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
580 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
581 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
582 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
583 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
584 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
585 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
586 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
587 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
588 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
589 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
590 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
591 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
592 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
593 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
594 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
595 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
596 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
597 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
598 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
599 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
600 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
601 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
602 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
603 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
604 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
605 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
606 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
607 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
608 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
609 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
610 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
611 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
612 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
613 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
614 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
615 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
616 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
617 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
618 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
619 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
620 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
621 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
622 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
623 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
624 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
625 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
626 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
627 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
628 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
629 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
630 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
631 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
632 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
633 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
634 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
635 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
636 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
637 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
638 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
639 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
640 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
641 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
642 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
643 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
644 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
645 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
646 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
647 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
648 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
649 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
650 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
651 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
652 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
653 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
654 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
655 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
656 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
657 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
658 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
659 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
660 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
661 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
662 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
663 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
664 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
665 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
666 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
667 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
668 637000116 Frankia casuarinae CcI3 Isolate Nodule
669 649633069 Micromonospora sp. L5 Isolate Unclassified
670 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
671 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
672 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
673 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
674 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
675 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
676 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
677 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
678 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
679 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
680 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
681 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
682 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
683 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
684 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
685 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
686 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
687 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
688 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
689 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
690 8054920844 Frankia tisae Agncl-8 Isolate Nodule
691 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
692 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
693 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
694 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
695 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
696 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
697 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
698 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
699 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.72
Metatranscriptomes 0.11
Isolates 12.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 5.69
Nodule 1.31
Rhizoplane 6.31
Rhizosphere 75.72
Stem 0
Stem Tuber 0.11
Unclassified 10.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000536 3300001977 Bacteria 5692
2 JGI24737J22298_10021667 3300001990 Bacteria 2047
3 JGI24745J21846_1000370 3300002073 Bacteria 3926
4 JGI24749J21850_1007903 3300002076 Bacteria 1480
5 JGI24744J21845_10000965 3300002077 Bacteria 5488
6 JGI24034J26672_10008906 3300002239 Bacteria 1474
7 JGI24742J22300_10001394 3300002244 Bacteria 3810
8 JGI25164J39214_1000515 3300002772 Bacteria 18519
9 JGI25152J39213_1000980 3300002773 Bacteria 13874
10 JGI25151J46595_10031792 3300003187 Bacteria 2056
11 JGI25165J46597_1000044 3300003214 Bacteria 263289
12 Ga0055540_1000211 3300003792 Bacteria 55318
13 Ga0055540_1004259 3300003792 Bacteria 6554
14 Ga0055540_1006714 3300003792 Bacteria 4508
15 Ga0065714_10010605 3300005288 Bacteria 2082
16 Ga0065712_10022902 3300005290 Bacteria 1739
17 Ga0070658_10000155 3300005327 Bacteria 60553
18 Ga0070658_10002940 3300005327 Bacteria 14124
19 Ga0070658_10078060 3300005327 Bacteria 2717
20 Ga0070658_10112230 3300005327 Bacteria 2259
21 Ga0070658_10241926 3300005327 Bacteria 1530
22 Ga0070676_10113118 3300005328 Bacteria 1693
23 Ga0070683_100002759 3300005329 Bacteria 14036
24 Ga0070683_100008046 3300005329 Bacteria 8952
25 Ga0070683_100133817 3300005329 Bacteria 2347
26 Ga0070683_100140430 3300005329 Bacteria 2289
27 Ga0070690_100027643 3300005330 Bacteria 3507
28 Ga0070690_100074970 3300005330 Bacteria 2205
29 Ga0070670_100052841 3300005331 Bacteria 3489
30 Ga0068869_100011022 3300005334 Bacteria 5921
31 Ga0068869_100018593 3300005334 Bacteria 4732
32 Ga0068869_100030573 3300005334 Bacteria 3781
33 Ga0070666_10012208 3300005335 Bacteria 5413
34 Ga0070666_10073071 3300005335 Bacteria 2336
35 Ga0070680_100001962 3300005336 Bacteria 15137
36 Ga0070680_100021263 3300005336 Bacteria 5155
37 Ga0070680_100045036 3300005336 Bacteria 3586
38 Ga0070682_100003447 3300005337 Bacteria 8762
39 Ga0070682_100054024 3300005337 Bacteria 2519
40 Ga0070682_100165205 3300005337 Bacteria 1533
41 Ga0068868_100000794 3300005338 Bacteria 21371
42 Ga0068868_100013822 3300005338 Bacteria 5933
43 Ga0068868_100014864 3300005338 Bacteria 5745
44 Ga0068868_100178949 3300005338 Bacteria 1758
45 Ga0068868_100254829 3300005338 Bacteria 1478
46 Ga0070660_100011330 3300005339 Bacteria 6329
47 Ga0070660_100103520 3300005339 Bacteria 2258
48 Ga0070689_100053548 3300005340 Bacteria 3123
49 Ga0070691_10002291 3300005341 Bacteria 8472
50 Ga0070691_10006343 3300005341 Bacteria 5405
51 Ga0070661_100047797 3300005344 Bacteria 3131
52 Ga0070692_10003769 3300005345 Bacteria 6232
53 Ga0070692_10007565 3300005345 Bacteria 4791
54 Ga0070668_100000964 3300005347 Bacteria 20121
55 Ga0070668_100001978 3300005347 Bacteria 14972
56 Ga0070668_100014132 3300005347 Bacteria 5967
57 Ga0070668_100016742 3300005347 Bacteria 5481
58 Ga0070668_100017923 3300005347 Bacteria 5311
59 Ga0070668_100068032 3300005347 Bacteria 2768
60 Ga0070669_100027727 3300005353 Bacteria 4077
61 Ga0070669_100057955 3300005353 Bacteria 2843
62 Ga0070675_100000432 3300005354 Bacteria 28465
63 Ga0070675_100018048 3300005354 Bacteria 5616
64 Ga0070675_100024819 3300005354 Bacteria 4802
65 Ga0070675_100245660 3300005354 Bacteria 1565
66 Ga0070671_100000370 3300005355 Bacteria 31140
67 Ga0070671_100041360 3300005355 Bacteria 3831
68 Ga0070671_100087577 3300005355 Bacteria 2606
69 Ga0070674_100042205 3300005356 Bacteria 3097
70 Ga0070674_100090614 3300005356 Bacteria 2206
71 Ga0070674_100185527 3300005356 Bacteria 1596
72 Ga0070673_100031422 3300005364 Bacteria 3984
73 Ga0070688_100010888 3300005365 Bacteria 5034
74 Ga0070659_100006799 3300005366 Bacteria 8278
75 Ga0070659_100105731 3300005366 Bacteria 2268
76 Ga0070667_100000562 3300005367 Bacteria 36767
77 Ga0070667_100001312 3300005367 Bacteria 22360
78 Ga0070667_100006829 3300005367 Bacteria 9479
79 Ga0070667_100014813 3300005367 Bacteria 6442
80 Ga0070667_100092326 3300005367 Bacteria 2604
81 Ga0070709_10006919 3300005434 Bacteria 6192
82 Ga0070714_100000045 3300005435 Bacteria 113749
83 Ga0070714_100048774 3300005435 Bacteria 3602
84 Ga0070714_100064441 3300005435 Bacteria 3154
85 Ga0070714_100068199 3300005435 Bacteria 3068
86 Ga0070714_100120606 3300005435 Bacteria 2332
87 Ga0070714_100123813 3300005435 Bacteria 2302
88 Ga0070714_100289252 3300005435 Bacteria 1525
89 Ga0070713_100001944 3300005436 Bacteria 13338
90 Ga0070713_100007682 3300005436 Bacteria 7590
91 Ga0070713_100093894 3300005436 Bacteria 2585
92 Ga0070713_100105853 3300005436 Bacteria 2444
93 Ga0070713_100172511 3300005436 Bacteria 1938
94 Ga0070710_10001141 3300005437 Bacteria 12594
95 Ga0070710_10004138 3300005437 Bacteria 6884
96 Ga0070710_10010958 3300005437 Bacteria 4467
97 Ga0070710_10018959 3300005437 Bacteria 3548
98 Ga0070710_10115985 3300005437 Bacteria 1615
99 Ga0070701_10058009 3300005438 Bacteria 2031
100 Ga0070711_100001916 3300005439 Bacteria 11636
101 Ga0070711_100004625 3300005439 Bacteria 8147
102 Ga0070711_100081123 3300005439 Bacteria 2311
103 Ga0070705_100017002 3300005440 Bacteria 3790
104 Ga0070700_100000094 3300005441 Bacteria 60178
105 Ga0070700_100007945 3300005441 Bacteria 5757
106 Ga0070700_100008853 3300005441 Bacteria 5501
107 Ga0070700_100025985 3300005441 Bacteria 3453
108 Ga0070700_100035573 3300005441 Bacteria 3015
109 Ga0070708_100022408 3300005445 Bacteria 5358
110 Ga0070663_100009639 3300005455 Bacteria 5989
111 Ga0070663_100014886 3300005455 Bacteria 5002
112 Ga0070663_100035622 3300005455 Bacteria 3453
113 Ga0070663_100067628 3300005455 Bacteria 2592
114 Ga0070663_100201281 3300005455 Bacteria 1554
115 Ga0070678_100003103 3300005456 Bacteria 9209
116 Ga0070678_100011769 3300005456 Bacteria 5410
117 Ga0070678_100027420 3300005456 Bacteria 3867
118 Ga0070678_100050196 3300005456 Bacteria 3016
119 Ga0070678_100135038 3300005456 Bacteria 1966
120 Ga0070678_100144904 3300005456 Bacteria 1905
121 Ga0070678_100146363 3300005456 Bacteria 1897
122 Ga0070662_100002734 3300005457 Bacteria 10898
123 Ga0070662_100070790 3300005457 Bacteria 2570
124 Ga0070662_100092533 3300005457 Bacteria 2273
125 Ga0070681_10000504 3300005458 Bacteria 31959
126 Ga0070681_10009194 3300005458 Bacteria 9713
127 Ga0070681_10033991 3300005458 Bacteria 5120
128 Ga0070681_10100015 3300005458 Bacteria 2846
129 Ga0068867_100002956 3300005459 Bacteria 11971
130 Ga0070685_10006635 3300005466 Bacteria 5906
131 Ga0070685_10019605 3300005466 Bacteria 3652
132 Ga0070685_10022713 3300005466 Bacteria 3424
133 Ga0070706_100027267 3300005467 Bacteria 5256
134 Ga0070706_100032645 3300005467 Bacteria 4803
135 Ga0070707_100003790 3300005468 Bacteria 14265
136 Ga0070707_100039640 3300005468 Bacteria 4503
137 Ga0070707_100366908 3300005468 Bacteria 1399
138 Ga0070698_100006733 3300005471 Bacteria 12461
139 Ga0070698_100075451 3300005471 Bacteria 3376
140 Ga0070679_100000687 3300005530 Bacteria 29007
141 Ga0070679_100001838 3300005530 Bacteria 19103
142 Ga0070679_100005358 3300005530 Bacteria 11869
143 Ga0070679_100063294 3300005530 Bacteria 3687
144 Ga0070679_100088386 3300005530 Bacteria 3086
145 Ga0068853_100008631 3300005539 Bacteria 8194
146 Ga0068853_100026901 3300005539 Bacteria 4833
147 Ga0068853_100028554 3300005539 Bacteria 4693
148 Ga0068853_100047185 3300005539 Bacteria 3696
149 Ga0068853_100127831 3300005539 Bacteria 2272
150 Ga0068853_100233417 3300005539 Bacteria 1683
151 Ga0070672_100104720 3300005543 Bacteria 2299
152 Ga0070695_100023511 3300005545 Bacteria 3788
153 Ga0070696_100006572 3300005546 Bacteria 7761
154 Ga0070696_100088676 3300005546 Bacteria 2199
155 Ga0070693_100004975 3300005547 Bacteria 6346
156 Ga0070693_100005567 3300005547 Bacteria 6063
157 Ga0070693_100052400 3300005547 Bacteria 2339
158 Ga0070665_100001805 3300005548 Bacteria 24264
159 Ga0070665_100019654 3300005548 Bacteria 6780
160 Ga0070665_100054549 3300005548 Bacteria 4009
161 Ga0070665_100061354 3300005548 Bacteria 3769
162 Ga0070665_100063798 3300005548 Bacteria 3694
163 Ga0070665_100067128 3300005548 Bacteria 3597
164 Ga0070704_100005363 3300005549 Bacteria 7466
165 Ga0070704_100029852 3300005549 Bacteria 3645
166 Ga0070704_100076065 3300005549 Bacteria 2454
167 Ga0068855_100012387 3300005563 Bacteria 10301
168 Ga0068855_100027492 3300005563 Bacteria 6802
169 Ga0068855_100034580 3300005563 Bacteria 6024
170 Ga0068855_100039520 3300005563 Bacteria 5602
171 Ga0068855_100164286 3300005563 Bacteria 2518
172 Ga0070664_100001189 3300005564 Bacteria 20725
173 Ga0070664_100366178 3300005564 Bacteria 1313
174 Ga0068857_100012484 3300005577 Bacteria 7399
175 Ga0068857_100054554 3300005577 Bacteria 3547
176 Ga0068857_100186618 3300005577 Bacteria 1888
177 Ga0068854_100002196 3300005578 Bacteria 11999
178 Ga0068856_100031138 3300005614 Bacteria 5218
179 Ga0068856_100032411 3300005614 Bacteria 5115
180 Ga0068856_100050005 3300005614 Bacteria 4120
181 Ga0068856_100177027 3300005614 Bacteria 2146
182 Ga0068856_100188635 3300005614 Bacteria 2075
183 Ga0068856_100227229 3300005614 Bacteria 1882
184 Ga0070702_100000252 3300005615 Bacteria 18230
185 Ga0070702_100019881 3300005615 Bacteria 3510
186 Ga0070702_100038061 3300005615 Bacteria 2675
187 Ga0070702_100156110 3300005615 Bacteria 1470
188 Ga0068852_100018879 3300005616 Bacteria 5444
189 Ga0068852_100047617 3300005616 Bacteria 3658
190 Ga0068852_100191948 3300005616 Bacteria 1928
191 Ga0068859_100001857 3300005617 Bacteria 21468
192 Ga0068859_100019700 3300005617 Bacteria 6776
193 Ga0068859_100030262 3300005617 Bacteria 5432
194 Ga0068859_100038886 3300005617 Bacteria 4772
195 Ga0068859_100063907 3300005617 Bacteria 3712
196 Ga0068864_100055401 3300005618 Bacteria 3423
197 Ga0068864_100184358 3300005618 Bacteria 1910
198 Ga0068866_10002581 3300005718 Bacteria 7476
199 Ga0068866_10010288 3300005718 Bacteria 4005
200 Ga0068861_100009286 3300005719 Bacteria 6787
201 Ga0068861_100053137 3300005719 Bacteria 3081
202 Ga0068861_100082531 3300005719 Bacteria 2519
203 Ga0068861_100088673 3300005719 Bacteria 2436
204 Ga0068861_100106931 3300005719 Bacteria 2236
205 Ga0068851_10000124 3300005834 Bacteria 41585
206 Ga0068870_10001152 3300005840 Bacteria 10575
207 Ga0068863_100015607 3300005841 Bacteria 7297
208 Ga0068863_100034697 3300005841 Bacteria 4804
209 Ga0068863_100040994 3300005841 Bacteria 4402
210 Ga0068863_100048819 3300005841 Bacteria 4012
211 Ga0068863_100055479 3300005841 Bacteria 3752
212 Ga0068863_100077002 3300005841 Bacteria 3156
213 Ga0068863_100156177 3300005841 Bacteria 2184
214 Ga0068863_100390572 3300005841 Bacteria 1360
215 Ga0068858_100000032 3300005842 Bacteria 142794
216 Ga0068858_100000175 3300005842 Bacteria 68239
217 Ga0068858_100121712 3300005842 Bacteria 2441
218 Ga0068858_100121732 3300005842 Bacteria 2440
219 Ga0068860_100000085 3300005843 Bacteria 166269
220 Ga0068860_100000112 3300005843 Bacteria 130953
221 Ga0068860_100023080 3300005843 Bacteria 6017
222 Ga0068860_100056291 3300005843 Bacteria 3739
223 Ga0068862_100001577 3300005844 Bacteria 20769
224 Ga0068862_100102490 3300005844 Bacteria 2505
225 Ga0068862_100130004 3300005844 Bacteria 2226
226 Ga0068862_100283589 3300005844 Bacteria 1519
227 Ga0081455_10001891 3300005937 Bacteria 25187
228 Ga0081455_10005347 3300005937 Bacteria 14103
229 Ga0081455_10007359 3300005937 Bacteria 11605
230 Ga0081455_10090029 3300005937 Bacteria 2489
231 Ga0081455_10142666 3300005937 Bacteria 1858
232 Ga0081538_10001227 3300005981 Bacteria 26904
233 Ga0081538_10038909 3300005981 Bacteria 3058
234 Ga0081540_1003275 3300005983 Bacteria 12878
235 Ga0081540_1005254 3300005983 Bacteria 9691
236 Ga0081540_1010341 3300005983 Bacteria 6328
237 Ga0081539_10001305 3300005985 Bacteria 43590
238 Ga0081539_10001973 3300005985 Bacteria 31246
239 Ga0081539_10020787 3300005985 Bacteria 4416
240 Ga0070717_10055531 3300006028 Bacteria 3268
241 Ga0070717_10096763 3300006028 Bacteria 2500
242 Ga0070717_10274918 3300006028 Bacteria 1492
243 Ga0070717_10338763 3300006028 Bacteria 1343
244 Ga0075365_10002419 3300006038 Bacteria 9147
245 Ga0075365_10018831 3300006038 Bacteria 4252
246 Ga0075365_10035009 3300006038 Bacteria 3246
247 Ga0075365_10038497 3300006038 Bacteria 3109
248 Ga0075365_10043570 3300006038 Bacteria 2938
249 Ga0075365_10213262 3300006038 Bacteria 1354
250 Ga0075368_10054756 3300006042 Bacteria 1590
251 Ga0075363_100000882 3300006048 Bacteria 10552
252 Ga0075363_100002130 3300006048 Bacteria 7956
253 Ga0075363_100009173 3300006048 Bacteria 4645
254 Ga0075363_100014328 3300006048 Bacteria 3870
255 Ga0075363_100017745 3300006048 Bacteria 3534
256 Ga0075364_10003955 3300006051 Bacteria 8503
257 Ga0075364_10004377 3300006051 Bacteria 8113
258 Ga0075364_10007221 3300006051 Bacteria 6583
259 Ga0075364_10019257 3300006051 Bacteria 4282
260 Ga0075364_10020109 3300006051 Bacteria 4198
261 Ga0075364_10030027 3300006051 Bacteria 3487
262 Ga0075364_10091633 3300006051 Bacteria 2017
263 Ga0075432_10031113 3300006058 Bacteria 1847
264 Ga0070715_10001858 3300006163 Bacteria 6315
265 Ga0070715_10010123 3300006163 Bacteria 3350
266 Ga0070715_10037487 3300006163 Bacteria 2006
267 Ga0070716_100001032 3300006173 Bacteria 12191
268 Ga0070716_100007759 3300006173 Bacteria 5297
269 Ga0070716_100023759 3300006173 Bacteria 3255
270 Ga0070712_100021261 3300006175 Bacteria 4259
271 Ga0070712_100024582 3300006175 Bacteria 3994
272 Ga0070712_100132874 3300006175 Bacteria 1888
273 Ga0075367_10002786 3300006178 Bacteria 8101
274 Ga0075367_10040651 3300006178 Bacteria 2716
275 Ga0075367_10096811 3300006178 Bacteria 1800
276 Ga0075369_10001816 3300006186 Bacteria 7442
277 Ga0075369_10004962 3300006186 Bacteria 4953
278 Ga0075369_10032463 3300006186 Bacteria 2209
279 Ga0075369_10070535 3300006186 Bacteria 1537
280 Ga0075370_10018399 3300006353 Bacteria 3791
281 Ga0075370_10058776 3300006353 Bacteria 2187
282 Ga0068871_100292839 3300006358 Bacteria 1427
283 Ga0075428_100000416 3300006844 Bacteria 42412
284 Ga0075428_100000630 3300006844 Bacteria 36085
285 Ga0075428_100008931 3300006844 Bacteria 11121
286 Ga0075428_100016382 3300006844 Bacteria 8190
287 Ga0075428_100307936 3300006844 Bacteria 1703
288 Ga0075430_100000876 3300006846 Bacteria 23636
289 Ga0075430_100001812 3300006846 Bacteria 17488
290 Ga0075430_100004627 3300006846 Bacteria 11575
291 Ga0075430_100053863 3300006846 Bacteria 3387
292 Ga0075431_100001436 3300006847 Bacteria 21935
293 Ga0075431_100002862 3300006847 Bacteria 16694
294 Ga0075431_100143546 3300006847 Bacteria 2460
295 Ga0075433_10003068 3300006852 Bacteria 12833
296 Ga0075433_10046700 3300006852 Bacteria 3767
297 Ga0075433_10073782 3300006852 Bacteria 3002
298 Ga0075433_10189043 3300006852 Archaea 1832
299 Ga0075434_100003178 3300006871 Bacteria 14645
300 Ga0075434_100311857 3300006871 Bacteria 1593
301 Ga0075429_100000244 3300006880 Bacteria 37496
302 Ga0075429_100006508 3300006880 Bacteria 10119
303 Ga0075429_100020851 3300006880 Bacteria 5688
304 Ga0068865_100000680 3300006881 Bacteria 19178
305 Ga0068865_100019322 3300006881 Bacteria 4408
306 Ga0075436_100010015 3300006914 Bacteria 6484
307 Ga0075436_100085986 3300006914 Bacteria 2184
308 Ga0075436_100095390 3300006914 Bacteria 2069
309 Ga0097620_100001857 3300006931 Bacteria 21468
310 Ga0097620_100019700 3300006931 Bacteria 6776
311 Ga0097620_100030263 3300006931 Bacteria 5432
312 Ga0097620_100038886 3300006931 Bacteria 4772
313 Ga0097620_100063914 3300006931 Bacteria 3712
314 Ga0075435_100004538 3300007076 Bacteria 9545
315 Ga0075435_100189592 3300007076 Unclassified 1740
316 Ga0105251_10015488 3300009011 Bacteria 4165
317 Ga0105251_10057996 3300009011 Bacteria 1829
318 Ga0105244_10004000 3300009036 Bacteria 10314
319 Ga0105240_10023577 3300009093 Bacteria 8133
320 Ga0105240_10033631 3300009093 Bacteria 6620
321 Ga0111539_10053176 3300009094 Bacteria 4820
322 Ga0111539_10452066 3300009094 Bacteria 1496
323 Ga0105245_10001865 3300009098 Bacteria 19158
324 Ga0105245_10030109 3300009098 Bacteria 4799
325 Ga0105245_10040683 3300009098 Bacteria 4142
326 Ga0105245_10042678 3300009098 Bacteria 4046
327 Ga0105245_10083844 3300009098 Bacteria 2918
328 Ga0105245_10225790 3300009098 Bacteria 1809
329 Ga0105245_10296646 3300009098 Bacteria 1584
330 Ga0105247_10000007 3300009101 Bacteria 409490
331 Ga0105247_10000164 3300009101 Bacteria 64953
332 Ga0105247_10001456 3300009101 Bacteria 17102
333 Ga0105247_10004913 3300009101 Bacteria 8501
334 Ga0105247_10013514 3300009101 Bacteria 4896
335 Ga0105247_10038821 3300009101 Bacteria 2908
336 Ga0114129_10000723 3300009147 Bacteria 41902
337 Ga0114129_10006158 3300009147 Bacteria 17018
338 Ga0114129_10009646 3300009147 Bacteria 13775
339 Ga0114129_10012498 3300009147 Bacteria 12087
340 Ga0114129_10018283 3300009147 Bacteria 9983
341 Ga0114129_10032957 3300009147 Bacteria 7321
342 Ga0114129_10074178 3300009147 Bacteria 4739
343 Ga0114129_10178042 3300009147 Bacteria 2895
344 Ga0105243_10002145 3300009148 Bacteria 16675
345 Ga0105243_10003603 3300009148 Bacteria 12482
346 Ga0105243_10019596 3300009148 Bacteria 5128
347 Ga0105243_10053995 3300009148 Bacteria 3188
348 Ga0105243_10083040 3300009148 Bacteria 2620
349 Ga0105241_10000211 3300009174 Bacteria 43844
350 Ga0105241_10004546 3300009174 Bacteria 10265
351 Ga0105241_10107752 3300009174 Bacteria 2226
352 Ga0105241_10117969 3300009174 Bacteria 2133
353 Ga0105242_10013158 3300009176 Bacteria 6385
354 Ga0105242_10057362 3300009176 Bacteria 3189
355 Ga0105248_10002480 3300009177 Bacteria 20511
356 Ga0105248_10003147 3300009177 Bacteria 18262
357 Ga0105248_10007605 3300009177 Bacteria 11903
358 Ga0105248_10013762 3300009177 Bacteria 8906
359 Ga0105248_10018635 3300009177 Bacteria 7675
360 Ga0105248_10025426 3300009177 Bacteria 6583
361 Ga0105248_10059757 3300009177 Bacteria 4282
362 Ga0105248_10070636 3300009177 Bacteria 3921
363 Ga0105248_10092277 3300009177 Bacteria 3410
364 Ga0105237_10002337 3300009545 Bacteria 23560
365 Ga0105237_10048489 3300009545 Bacteria 4270
366 Ga0105237_10175054 3300009545 Bacteria 2146
367 Ga0105237_10247190 3300009545 Bacteria 1786
368 Ga0105238_10029500 3300009551 Bacteria 5588
369 Ga0105238_10199854 3300009551 Bacteria 1974
370 Ga0105238_10318583 3300009551 Bacteria 1541
371 Ga0105249_10000001 3300009553 Bacteria 504948
372 Ga0105249_10001870 3300009553 Bacteria 18265
373 Ga0105249_10016303 3300009553 Bacteria 6590
374 Ga0105249_10028646 3300009553 Bacteria 5027
375 Ga0105249_10122582 3300009553 Bacteria 2472
376 Ga0105239_10037404 3300010375 Bacteria 5321
377 Ga0105239_10037820 3300010375 Bacteria 5288
378 Ga0105239_10213248 3300010375 Bacteria 2165
379 Ga0105239_10221394 3300010375 Bacteria 2122
380 Ga0105246_10016299 3300011119 Bacteria 4704
381 Ga0105246_10020035 3300011119 Bacteria 4287
382 Ga0157371_10063256 3300013102 Bacteria 2623
383 Ga0157370_10010594 3300013104 Bacteria 9706
384 Ga0157370_10024520 3300013104 Bacteria 5973
385 Ga0157370_10069579 3300013104 Bacteria 3323
386 Ga0157370_10297806 3300013104 Bacteria 1489
387 Ga0157369_10003546 3300013105 Bacteria 18533
388 Ga0157369_10003610 3300013105 Bacteria 18383
389 Ga0157369_10013234 3300013105 Bacteria 9333
390 Ga0157369_10015580 3300013105 Bacteria 8566
391 Ga0157369_10095834 3300013105 Bacteria 3166
392 Ga0157369_10101407 3300013105 Bacteria 3067
393 Ga0157369_10156750 3300013105 Bacteria 2405
394 Ga0157369_10179918 3300013105 Bacteria 2225
395 Ga0157369_10228215 3300013105 Bacteria 1947
396 Ga0157374_10022265 3300013296 Bacteria 5651
397 Ga0157374_10105285 3300013296 Bacteria 2709
398 Ga0157374_10161367 3300013296 Bacteria 2183
399 Ga0157374_10186409 3300013296 Bacteria 2028
400 Ga0157374_10191161 3300013296 Bacteria 2002
401 Ga0157378_10009029 3300013297 Bacteria 8678
402 Ga0157378_10035250 3300013297 Bacteria 4425
403 Ga0163162_10016133 3300013306 Bacteria 7302
404 Ga0163162_10020493 3300013306 Bacteria 6498
405 Ga0163162_10145440 3300013306 Bacteria 2486
406 Ga0157372_10002203 3300013307 Bacteria 21158
407 Ga0157372_10003317 3300013307 Bacteria 17389
408 Ga0157372_10305276 3300013307 Bacteria 1852
409 Ga0157372_10465758 3300013307 Bacteria 1473
410 Ga0157375_10011217 3300013308 Bacteria 7907
411 Ga0157375_10049534 3300013308 Bacteria 4117
412 Ga0157375_10109831 3300013308 Bacteria 2854
413 Ga0157375_10153028 3300013308 Bacteria 2443
414 Ga0163163_10009670 3300014325 Bacteria 8626
415 Ga0163163_10016347 3300014325 Bacteria 6890
416 Ga0163163_10109690 3300014325 Bacteria 2787
417 Ga0163163_10126143 3300014325 Bacteria 2597
418 Ga0163163_10137611 3300014325 Bacteria 2483
419 Ga0163163_10366663 3300014325 Bacteria 1497
420 Ga0157380_10030521 3300014326 Bacteria 4129
421 Ga0157380_10049854 3300014326 Bacteria 3304
422 Ga0157377_10026431 3300014745 Bacteria 3106
423 Ga0157377_10031449 3300014745 Bacteria 2884
424 Ga0157379_10000802 3300014968 Bacteria 25461
425 Ga0157379_10012652 3300014968 Bacteria 7375
426 Ga0157379_10021056 3300014968 Bacteria 5771
427 Ga0157379_10075892 3300014968 Bacteria 3010
428 Ga0157379_10199641 3300014968 Bacteria 1809
429 Ga0157379_10202568 3300014968 Bacteria 1795
430 Ga0157376_10056950 3300014969 Bacteria 3268
431 Ga0157376_10101412 3300014969 Bacteria 2516
432 Ga0157376_10179127 3300014969 Bacteria 1936
433 Ga0163161_10007436 3300017792 Bacteria 7568
434 Ga0163161_10010399 3300017792 Bacteria 6443
435 Ga0163161_10038113 3300017792 Bacteria 3447
436 Ga0206353_11145561 3300020082 Bacteria 2999
437 Ga0213873_10000096 3300021358 Bacteria 17586
438 Ga0213876_10008265 3300021384 Bacteria 5631
439 Ga0213876_10020805 3300021384 Bacteria 3469
440 Ga0213875_10000455 3300021388 Bacteria 35424
441 Ga0213875_10011610 3300021388 Bacteria 4377
442 Ga0213875_10035249 3300021388 Bacteria 2361
443 Ga0207427_100126 3300025231 Bacteria 95170
444 Ga0209437_100585 3300025233 Bacteria 23238
445 Ga0209148_1004143 3300025254 Bacteria 3651
446 Ga0209129_1000079 3300025258 Bacteria 187308
447 Ga0209233_1000014 3300025261 Bacteria 996641
448 Ga0209673_1006798 3300025273 Bacteria 5432
449 Ga0209025_1001940 3300025294 Bacteria 23871
450 Ga0209051_1000011 3300025303 Bacteria 610828
451 Ga0209051_1000795 3300025303 Bacteria 33193
452 Ga0209051_1002312 3300025303 Bacteria 13876
453 Ga0209051_1017900 3300025303 Bacteria 3153
454 Ga0207656_10000001 3300025321 Bacteria 1323684
455 Ga0207656_10000003 3300025321 Bacteria 771644
456 Ga0207655_1005143 3300025728 Bacteria 9004
457 Ga0207655_1049401 3300025728 Bacteria 1718
458 Ga0207713_1012442 3300025735 Bacteria 4547
459 Ga0207682_10007444 3300025893 Bacteria 4364
460 Ga0207692_10001723 3300025898 Bacteria 8283
461 Ga0207692_10003209 3300025898 Bacteria 6361
462 Ga0207692_10007932 3300025898 Bacteria 4375
463 Ga0207642_10002272 3300025899 Bacteria 5982
464 Ga0207710_10000013 3300025900 Bacteria 409402
465 Ga0207710_10000082 3300025900 Bacteria 138091
466 Ga0207710_10000178 3300025900 Bacteria 64962
467 Ga0207710_10001332 3300025900 Bacteria 12412
468 Ga0207710_10018838 3300025900 Bacteria 2939
469 Ga0207710_10051974 3300025900 Bacteria 1842
470 Ga0207688_10001000 3300025901 Bacteria 14400
471 Ga0207688_10002930 3300025901 Bacteria 9278
472 Ga0207688_10003558 3300025901 Bacteria 8503
473 Ga0207680_10055045 3300025903 Bacteria 2396
474 Ga0207680_10065139 3300025903 Bacteria 2236
475 Ga0207647_10031084 3300025904 Bacteria 3439
476 Ga0207647_10067875 3300025904 Bacteria 2159
477 Ga0207685_10006158 3300025905 Bacteria 3241
478 Ga0207699_10003242 3300025906 Bacteria 7750
479 Ga0207699_10008552 3300025906 Bacteria 5059
480 Ga0207699_10044092 3300025906 Bacteria 2595
481 Ga0207645_10011165 3300025907 Bacteria 6144
482 Ga0207645_10067665 3300025907 Bacteria 2283
483 Ga0207643_10000642 3300025908 Bacteria 21849
484 Ga0207643_10053204 3300025908 Bacteria 2300
485 Ga0207705_10000595 3300025909 Bacteria 30272
486 Ga0207705_10015540 3300025909 Bacteria 5462
487 Ga0207705_10015936 3300025909 Bacteria 5396
488 Ga0207705_10036392 3300025909 Bacteria 3523
489 Ga0207705_10050987 3300025909 Bacteria 2979
490 Ga0207705_10242994 3300025909 Bacteria 1372
491 Ga0207684_10011027 3300025910 Bacteria 7921
492 Ga0207684_10085908 3300025910 Bacteria 2680
493 Ga0207684_10110326 3300025910 Bacteria 2355
494 Ga0207684_10299946 3300025910 Bacteria 1385
495 Ga0207654_10000003 3300025911 Bacteria 1030378
496 Ga0207654_10021949 3300025911 Bacteria 3400
497 Ga0207654_10081089 3300025911 Bacteria 1953
498 Ga0207654_10107808 3300025911 Bacteria 1727
499 Ga0207707_10016166 3300025912 Bacteria 6510
500 Ga0207707_10021899 3300025912 Bacteria 5586
501 Ga0207707_10022717 3300025912 Bacteria 5485
502 Ga0207707_10026215 3300025912 Bacteria 5095
503 Ga0207695_10005261 3300025913 Bacteria 17262
504 Ga0207695_10009600 3300025913 Bacteria 11949
505 Ga0207695_10035988 3300025913 Bacteria 5358
506 Ga0207695_10113003 3300025913 Bacteria 2693
507 Ga0207671_10000001 3300025914 Bacteria 1318881
508 Ga0207671_10047284 3300025914 Bacteria 3184
509 Ga0207693_10000420 3300025915 Bacteria 38541
510 Ga0207693_10002493 3300025915 Bacteria 16014
511 Ga0207693_10006587 3300025915 Bacteria 9613
512 Ga0207693_10011553 3300025915 Bacteria 7141
513 Ga0207693_10031552 3300025915 Bacteria 4187
514 Ga0207663_10005192 3300025916 Bacteria 6552
515 Ga0207663_10005313 3300025916 Bacteria 6484
516 Ga0207663_10013983 3300025916 Bacteria 4380
517 Ga0207663_10071693 3300025916 Bacteria 2236
518 Ga0207660_10009254 3300025917 Bacteria 6377
519 Ga0207660_10147980 3300025917 Bacteria 1802
520 Ga0207657_10018543 3300025919 Bacteria 6636
521 Ga0207657_10021331 3300025919 Bacteria 6100
522 Ga0207657_10038028 3300025919 Bacteria 4289
523 Ga0207649_10003700 3300025920 Bacteria 8343
524 Ga0207649_10030705 3300025920 Bacteria 3185
525 Ga0207649_10110283 3300025920 Bacteria 1837
526 Ga0207652_10001493 3300025921 Bacteria 20662
527 Ga0207652_10010256 3300025921 Bacteria 7540
528 Ga0207652_10011363 3300025921 Bacteria 7175
529 Ga0207652_10047865 3300025921 Bacteria 3653
530 Ga0207652_10126575 3300025921 Bacteria 2276
531 Ga0207652_10190258 3300025921 Bacteria 1846
532 Ga0207652_10203646 3300025921 Bacteria 1781
533 Ga0207646_10004909 3300025922 Bacteria 14315
534 Ga0207646_10224067 3300025922 Bacteria 1699
535 Ga0207681_10001110 3300025923 Bacteria 17448
536 Ga0207681_10032269 3300025923 Bacteria 3428
537 Ga0207694_10005422 3300025924 Bacteria 9817
538 Ga0207694_10055020 3300025924 Bacteria 3089
539 Ga0207694_10257031 3300025924 Bacteria 1430
540 Ga0207650_10032659 3300025925 Bacteria 3765
541 Ga0207659_10027257 3300025926 Bacteria 3866
542 Ga0207687_10001526 3300025927 Bacteria 15874
543 Ga0207687_10004349 3300025927 Bacteria 9453
544 Ga0207687_10011308 3300025927 Bacteria 5833
545 Ga0207687_10015347 3300025927 Bacteria 5021
546 Ga0207687_10024987 3300025927 Bacteria 3996
547 Ga0207687_10040902 3300025927 Bacteria 3180
548 Ga0207687_10070166 3300025927 Bacteria 2501
549 Ga0207687_10238274 3300025927 Bacteria 1440
550 Ga0207700_10004533 3300025928 Bacteria 8207
551 Ga0207700_10005586 3300025928 Bacteria 7547
552 Ga0207700_10056479 3300025928 Bacteria 2955
553 Ga0207700_10070499 3300025928 Bacteria 2687
554 Ga0207700_10209218 3300025928 Bacteria 1648
555 Ga0207700_10248327 3300025928 Bacteria 1519
556 Ga0207664_10000063 3300025929 Bacteria 113763
557 Ga0207664_10003992 3300025929 Bacteria 9941
558 Ga0207664_10006346 3300025929 Bacteria 8125
559 Ga0207664_10018596 3300025929 Bacteria 5119
560 Ga0207664_10054555 3300025929 Bacteria 3167
561 Ga0207644_10033273 3300025931 Bacteria 3601
562 Ga0207690_10018486 3300025932 Bacteria 4275
563 Ga0207690_10045554 3300025932 Bacteria 2898
564 Ga0207706_10002446 3300025933 Bacteria 18131
565 Ga0207706_10015108 3300025933 Bacteria 6988
566 Ga0207706_10051457 3300025933 Bacteria 3637
567 Ga0207706_10129662 3300025933 Bacteria 2218
568 Ga0207709_10010193 3300025935 Bacteria 5176
569 Ga0207709_10012673 3300025935 Bacteria 4648
570 Ga0207709_10032863 3300025935 Bacteria 3042
571 Ga0207709_10114899 3300025935 Bacteria 1807
572 Ga0207670_10034938 3300025936 Bacteria 3255
573 Ga0207670_10074152 3300025936 Bacteria 2361
574 Ga0207669_10000932 3300025937 Bacteria 12361
575 Ga0207669_10042240 3300025937 Bacteria 2660
576 Ga0207669_10242228 3300025937 Bacteria 1337
577 Ga0207704_10067588 3300025938 Bacteria 2249
578 Ga0207665_10001654 3300025939 Bacteria 14998
579 Ga0207665_10003273 3300025939 Bacteria 10848
580 Ga0207665_10004483 3300025939 Bacteria 9267
581 Ga0207665_10009362 3300025939 Bacteria 6430
582 Ga0207665_10013756 3300025939 Bacteria 5322
583 Ga0207691_10001332 3300025940 Bacteria 24657
584 Ga0207691_10227457 3300025940 Bacteria 1616
585 Ga0207711_10001465 3300025941 Bacteria 22000
586 Ga0207711_10001834 3300025941 Bacteria 19368
587 Ga0207711_10005962 3300025941 Bacteria 10300
588 Ga0207711_10129430 3300025941 Bacteria 2262
589 Ga0207711_10203309 3300025941 Bacteria 1808
590 Ga0207711_10253167 3300025941 Bacteria 1617
591 Ga0207689_10000187 3300025942 Bacteria 53919
592 Ga0207689_10002944 3300025942 Bacteria 15736
593 Ga0207689_10006655 3300025942 Bacteria 10192
594 Ga0207689_10015723 3300025942 Bacteria 6407
595 Ga0207689_10023181 3300025942 Bacteria 5211
596 Ga0207661_10001731 3300025944 Bacteria 14929
597 Ga0207661_10005113 3300025944 Bacteria 9208
598 Ga0207661_10056083 3300025944 Bacteria 3162
599 Ga0207661_10107587 3300025944 Bacteria 2353
600 Ga0207661_10123319 3300025944 Bacteria 2209
601 Ga0207679_10007877 3300025945 Bacteria 6767
602 Ga0207667_10005915 3300025949 Bacteria 14898
603 Ga0207667_10012713 3300025949 Bacteria 9671
604 Ga0207667_10027190 3300025949 Bacteria 6234
605 Ga0207667_10027909 3300025949 Bacteria 6136
606 Ga0207667_10038335 3300025949 Bacteria 5120
607 Ga0207667_10137161 3300025949 Bacteria 2519
608 Ga0207712_10000006 3300025961 Bacteria 573204
609 Ga0207712_10011671 3300025961 Bacteria 5600
610 Ga0207712_10233252 3300025961 Bacteria 1478
611 Ga0207668_10001742 3300025972 Bacteria 12748
612 Ga0207640_10004946 3300025981 Bacteria 7242
613 Ga0207640_10016616 3300025981 Bacteria 4286
614 Ga0207640_10042940 3300025981 Bacteria 2886
615 Ga0207658_10000970 3300025986 Bacteria 23684
616 Ga0207658_10009505 3300025986 Bacteria 6600
617 Ga0207658_10057863 3300025986 Bacteria 2882
618 Ga0207658_10176404 3300025986 Bacteria 1765
619 Ga0207677_10042913 3300026023 Bacteria 3003
620 Ga0207677_10048470 3300026023 Bacteria 2861
621 Ga0207677_10052078 3300026023 Bacteria 2779
622 Ga0207677_10067825 3300026023 Bacteria 2500
623 Ga0207677_10143290 3300026023 Bacteria 1833
624 Ga0207677_10225495 3300026023 Bacteria 1506
625 Ga0207703_10000015 3300026035 Bacteria 287079
626 Ga0207703_10000131 3300026035 Bacteria 90186
627 Ga0207703_10013056 3300026035 Bacteria 6473
628 Ga0207703_10021554 3300026035 Bacteria 5045
629 Ga0207703_10218624 3300026035 Bacteria 1702
630 Ga0207639_10005218 3300026041 Bacteria 8764
631 Ga0207639_10019729 3300026041 Bacteria 4813
632 Ga0207639_10130697 3300026041 Bacteria 2078
633 Ga0207678_10002354 3300026067 Bacteria 17155
634 Ga0207678_10011889 3300026067 Bacteria 7643
635 Ga0207678_10019054 3300026067 Bacteria 6027
636 Ga0207678_10032883 3300026067 Bacteria 4520
637 Ga0207678_10037802 3300026067 Bacteria 4198
638 Ga0207678_10075426 3300026067 Bacteria 2889
639 Ga0207708_10000123 3300026075 Bacteria 60071
640 Ga0207708_10008837 3300026075 Bacteria 7456
641 Ga0207708_10019476 3300026075 Bacteria 5116
642 Ga0207708_10084696 3300026075 Bacteria 2438
643 Ga0207702_10004958 3300026078 Bacteria 11692
644 Ga0207702_10019652 3300026078 Bacteria 5592
645 Ga0207702_10044872 3300026078 Bacteria 3716
646 Ga0207702_10118513 3300026078 Bacteria 2365
647 Ga0207702_10171037 3300026078 Bacteria 1992
648 Ga0207702_10174634 3300026078 Bacteria 1973
649 Ga0207641_10022729 3300026088 Bacteria 5163
650 Ga0207641_10031413 3300026088 Bacteria 4404
651 Ga0207641_10041605 3300026088 Bacteria 3851
652 Ga0207641_10126696 3300026088 Bacteria 2287
653 Ga0207648_10009571 3300026089 Bacteria 9270
654 Ga0207648_10023728 3300026089 Bacteria 5489
655 Ga0207648_10058974 3300026089 Bacteria 3347
656 Ga0207676_10001957 3300026095 Bacteria 15009
657 Ga0207674_10009940 3300026116 Bacteria 10823
658 Ga0207674_10020299 3300026116 Bacteria 7181
659 Ga0207674_10049467 3300026116 Bacteria 4299
660 Ga0207675_100004425 3300026118 Bacteria 13581
661 Ga0207675_100036517 3300026118 Bacteria 4583
662 Ga0207675_100086914 3300026118 Bacteria 2936
663 Ga0207675_100146475 3300026118 Bacteria 2245
664 Ga0207675_100192367 3300026118 Bacteria 1957
665 Ga0207675_100219272 3300026118 Bacteria 1832
666 Ga0207683_10003430 3300026121 Bacteria 13814
667 Ga0207683_10010756 3300026121 Bacteria 7801
668 Ga0207683_10024562 3300026121 Bacteria 5192
669 Ga0207683_10115208 3300026121 Bacteria 2409
670 Ga0207683_10125260 3300026121 Bacteria 2308
671 Ga0207683_10178115 3300026121 Bacteria 1927
672 Ga0207683_10305466 3300026121 Bacteria 1456
673 Ga0207698_10003180 3300026142 Bacteria 9852
674 Ga0207698_10023505 3300026142 Bacteria 4307
675 Ga0207698_10079070 3300026142 Bacteria 2644
676 Ga0207698_10080506 3300026142 Bacteria 2624
677 Ga0207698_10154594 3300026142 Bacteria 1996
678 Ga0207428_10068649 3300027907 Bacteria 2788
679 Ga0207428_10079774 3300027907 Bacteria 2558
680 Ga0207428_10099720 3300027907 Bacteria 2245
681 Ga0268266_10007851 3300028379 Bacteria 9561
682 Ga0268266_10024077 3300028379 Bacteria 5181
683 Ga0268266_10031295 3300028379 Bacteria 4518
684 Ga0268266_10064306 3300028379 Bacteria 3169
685 Ga0268266_10068211 3300028379 Bacteria 3079
686 Ga0268265_10000016 3300028380 Bacteria 299380
687 Ga0268265_10084439 3300028380 Bacteria 2517
688 Ga0268265_10273693 3300028380 Bacteria 1507
689 Ga0268264_10000026 3300028381 Bacteria 459088
690 Ga0268264_10000031 3300028381 Bacteria 409525
691 Ga0268264_10012141 3300028381 Bacteria 7092
692 Ga0268264_10052844 3300028381 Bacteria 3388
693 Ga0268264_10145580 3300028381 Bacteria 2118
694 Ga0265334_10000839 3300028573 Bacteria 15353
695 Ga0307515_10014277 3300028794 Bacteria 14747
696 Ga0307515_10021795 3300028794 Bacteria 11336
697 Ga0307515_10022335 3300028794 Bacteria 11156
698 Ga0307511_10106788 3300030521 Bacteria 1805
699 Ga0307512_10005170 3300030522 Bacteria 13762
700 Ga0307512_10009276 3300030522 Bacteria 9496
701 Ga0307512_10020281 3300030522 Bacteria 6024
702 Ga0307512_10047890 3300030522 Bacteria 3468
703 Ga0265340_10035175 3300031247 Bacteria 2488
704 Ga0265340_10040806 3300031247 Bacteria 2284
705 Ga0265327_10000041 3300031251 Bacteria 288506
706 Ga0265327_10001529 3300031251 Bacteria 28541
707 Ga0265327_10008570 3300031251 Bacteria 7589
708 Ga0265327_10029384 3300031251 Bacteria 3128
709 Ga0307513_10000001 3300031456 Bacteria 1660464
710 Ga0307513_10015478 3300031456 Bacteria 9246
711 Ga0307513_10022497 3300031456 Bacteria 7404
712 Ga0307408_100019307 3300031548 Bacteria 4588
713 Ga0307408_100022759 3300031548 Bacteria 4262
714 Ga0307408_100035646 3300031548 Bacteria 3492
715 Ga0307408_100064742 3300031548 Bacteria 2679
716 Ga0307408_100325912 3300031548 Bacteria 1295
717 Ga0265313_10035630 3300031595 Bacteria 2504
718 Ga0265313_10040218 3300031595 Bacteria 2313
719 Ga0307508_10001163 3300031616 Bacteria 30276
720 Ga0307508_10007864 3300031616 Bacteria 9897
721 Ga0307508_10024539 3300031616 Bacteria 5472
722 Ga0307508_10074409 3300031616 Bacteria 2972
723 Ga0307514_10040454 3300031649 Bacteria 3675
724 Ga0307514_10082332 3300031649 Bacteria 2375
725 Ga0316575_10063963 3300031665 Bacteria 1472
726 Ga0265314_10057721 3300031711 Bacteria 2663
727 Ga0265342_10041432 3300031712 Bacteria 2789
728 Ga0265342_10118549 3300031712 Bacteria 1492
729 Ga0316576_10000511 3300031727 Bacteria 18233
730 Ga0316576_10017182 3300031727 Bacteria 4908
731 Ga0316576_10017551 3300031727 Bacteria 4866
732 Ga0316576_10048395 3300031727 Bacteria 3084
733 Ga0316576_10140041 3300031727 Bacteria 1821
734 Ga0316578_10036615 3300031728 Bacteria 2824
735 Ga0316578_10081290 3300031728 Bacteria 1928
736 Ga0316578_10105522 3300031728 Bacteria 1690
737 Ga0307516_10003100 3300031730 Bacteria 21615
738 Ga0316577_10056287 3300031733 Bacteria 2194
739 Ga0307413_10042245 3300031824 Bacteria 2677
740 Ga0307518_10048571 3300031838 Bacteria 3085
741 Ga0307410_10024068 3300031852 Bacteria 3798
742 Ga0307410_10024166 3300031852 Bacteria 3792
743 Ga0307410_10057129 3300031852 Bacteria 2656
744 Ga0307410_10068104 3300031852 Bacteria 2457
745 Ga0307410_10109058 3300031852 Bacteria 2000
746 Ga0307410_10155605 3300031852 Bacteria 1707
747 Ga0307406_10068534 3300031901 Bacteria 2316
748 Ga0307406_10083514 3300031901 Bacteria 2130
749 Ga0307406_10093638 3300031901 Bacteria 2029
750 Ga0307406_10093771 3300031901 Bacteria 2028
751 Ga0307407_10080026 3300031903 Bacteria 1973
752 Ga0307407_10173283 3300031903 Bacteria 1423
753 Ga0307412_10029765 3300031911 Bacteria 3429
754 Ga0307409_100008616 3300031995 Bacteria 6202
755 Ga0307409_100021231 3300031995 Bacteria 4448
756 Ga0307409_100058000 3300031995 Bacteria 3004
757 Ga0307409_100107967 3300031995 Bacteria 2326
758 Ga0307409_100276950 3300031995 Bacteria 1548
759 Ga0307409_100385132 3300031995 Bacteria 1334
760 Ga0307416_100015187 3300032002 Bacteria 5307
761 Ga0307416_100039444 3300032002 Bacteria 3657
762 Ga0307416_100133681 3300032002 Bacteria 2239
763 Ga0307416_100232592 3300032002 Bacteria 1778
764 Ga0307416_100240066 3300032002 Bacteria 1755
765 Ga0307416_100270491 3300032002 Archaea 1668
766 Ga0307416_100424511 3300032002 Bacteria 1375
767 Ga0307414_10107423 3300032004 Bacteria 2115
768 Ga0307414_10268980 3300032004 Bacteria 1426
769 Ga0307411_10001113 3300032005 Bacteria 10472
770 Ga0307411_10248123 3300032005 Bacteria 1398
771 Ga0307415_100005815 3300032126 Bacteria 6592
772 Ga0307415_100023748 3300032126 Bacteria 3814
773 Ga0307415_100032681 3300032126 Bacteria 3368
774 Ga0307415_100037663 3300032126 Bacteria 3180
775 Ga0307415_100052500 3300032126 Bacteria 2773
776 Ga0307415_100114408 3300032126 Bacteria 2008
777 Ga0307415_100315876 3300032126 Bacteria 1300
778 Ga0316583_10010209 3300032133 Bacteria 3383
779 Ga0316580_10016328 3300032139 Bacteria 2278
780 Ga0307510_10008263 3300033180 Bacteria 12404
781 Ga0373930_0002591 3300034816 Bacteria 2807
782 Ga0373948_0001069 3300034817 Bacteria 3702
783 Ga0373934_0000014 3300035086 Bacteria 59312
784 Ga0373934_0019070 3300035086 Bacteria 2630
785 Ga0373949_0013828 3300035090 Bacteria 1793
786 Ga0373951_0000127 3300035091 Bacteria 28693
787 Ga0373951_0004369 3300035091 Bacteria 3362
788 Ga0373951_0019293 3300035091 Bacteria 1554
789 Ga0373932_0003524 3300035112 Bacteria 3752
790 Ga0373953_0001755 3300035117 Bacteria 6402
791 Ga0373953_0046502 3300035117 Bacteria 1742
792 Ga0373954_0001669 3300035118 Bacteria 9091
793 Ga0373954_0034701 3300035118 Bacteria 2337
794 Ga0373956_0001414 3300035119 Bacteria 9923
795 Ga0373956_0007651 3300035119 Bacteria 4354
796 Ga0373957_0000846 3300035120 Bacteria 8012
797 Ga0373957_0001048 3300035120 Bacteria 7302
798 Ga0373943_0015990 3300035170 Bacteria 3416
799 Ga0373946_0040136 3300035171 Bacteria 1913
800 Ga0373955_0000040 3300035172 Bacteria 51762
801 Ga0373955_0003554 3300035172 Bacteria 6861
802 Ga0373961_0019195 3300035241 Bacteria 1793
803 Ga0316574_0006815 3300035398 Bacteria 6208
804 Ga0316574_0031353 3300035398 Bacteria 3224
805 Ga0316574_0040647 3300035398 Bacteria 2864
806 Ga0316574_0140967 3300035398 Bacteria 1553
807 Ga0373924_0001593 3300035410 Bacteria 7428
808 Ga0373924_0038344 3300035410 Bacteria 1954
809 Ga0373931_0019275 3300035691 Bacteria 3404
810 Ga0373935_0013523 3300035692 Bacteria 4925
811 Ga0373933_0000085 3300035724 Bacteria 59115
812 Ga0373937_0000197 3300036401 Bacteria 59124
813 Ga0373937_0121631 3300036401 Bacteria 2432
814 Ga0373937_0123043 3300036401 Bacteria 2419
815 Ga0316584_0011739 3300036712 Bacteria 6165
816 Ga0316584_0033039 3300036712 Bacteria 3830
817 Ga0316584_0052838 3300036712 Bacteria 3039
818 Ga0316584_0075219 3300036712 Bacteria 2531
819 Ga0316584_0090142 3300036712 Bacteria 2295
820 Ga0395899_0002958 3300037312 Bacteria 13596
821 Ga0395899_0004671 3300037312 Bacteria 10692
822 Ga0395899_0035839 3300037312 Bacteria 3723
823 Ga0395899_0046758 3300037312 Bacteria 3223
824 Ga0395899_0049908 3300037312 Bacteria 3109
825 Ga0395899_0114071 3300037312 Bacteria 1940
826 Ga0395900_0005127 3300037418 Bacteria 13760
827 Ga0395900_0006397 3300037418 Bacteria 12279
828 Ga0395900_0010840 3300037418 Bacteria 9325
829 Ga0395900_0019678 3300037418 Bacteria 6882
830 Ga0395900_0025509 3300037418 Bacteria 6052
831 Ga0395900_0079080 3300037418 Bacteria 3379
832 Ga0395900_0102449 3300037418 Bacteria 2941
833 Ga0395900_0197109 3300037418 Bacteria 2039
834 Ga0395898_0006003 3300037466 Bacteria 13040
835 Ga0395898_0006892 3300037466 Bacteria 12089
836 Ga0395898_0013311 3300037466 Bacteria 8471
837 Ga0395898_0017536 3300037466 Bacteria 7309
838 Ga0395898_0029723 3300037466 Bacteria 5470
839 Ga0395898_0057223 3300037466 Bacteria 3800
840 Ga0395898_0077820 3300037466 Bacteria 3201
841 Ga0395898_0083918 3300037466 Bacteria 3070
842 Ga0395898_0112966 3300037466 Bacteria 2603
843 Ga0395898_0115035 3300037466 Bacteria 2577
844 Ga0395898_0324087 3300037466 Bacteria 1469
845 Ga0395898_0348124 3300037466 Bacteria 1413
846 Ga0395905_0001026 3300037471 Bacteria 35609
847 Ga0395905_0009643 3300037471 Bacteria 9423
848 Ga0395905_0303095 3300037471 Bacteria 1485
849 Ga0395905_0405009 3300037471 Bacteria 1259
850 Ga0436364_0113323 3300037853 Bacteria 5330
851 Ga0436364_0238472 3300037853 Bacteria 35445
852 Ga0436364_0418931 3300037853 Bacteria 2257
853 Ga0436364_0453470 3300037853 Bacteria 6660
854 Ga0436364_0647082 3300037853 Bacteria 2287
855 Ga0436364_1255815 3300037853 Bacteria 13267
856 Ga0436364_1390545 3300037853 Bacteria 3659
857 Ga0395901_0003412 3300038443 Bacteria 16006
858 Ga0395901_0021006 3300038443 Bacteria 6687
859 Ga0395901_0032994 3300038443 Bacteria 5342
860 Ga0395901_0054233 3300038443 Bacteria 4166
861 Ga0395901_0113011 3300038443 Bacteria 2852
862 Ga0395901_0161745 3300038443 Bacteria 2351
863 Ga0395901_0209072 3300038443 Bacteria 2043
864 Ga0436365_0613236 3300039437 Bacteria 5826
865 Ga0436365_0885952 3300039437 Bacteria 25510
866 Ga0436365_1214067 3300039437 Bacteria 31173
867 Ga0436363_0076260 3300039450 Bacteria 2214
868 Ga0436363_0265210 3300039450 Bacteria 3170
869 Ga0436363_0330623 3300039450 Bacteria 4938
870 Ga0436362_0604249 3300039453 Bacteria 12950
871 Ga0439439_0003804 3300041406 Bacteria 3352
872 Ga0439447_010755 3300041407 Bacteria 2702
873 Ga0439466_0020498 3300041411 Bacteria 2355
874 Ga0439466_0030633 3300041411 Bacteria 1843
875 Ga0439465_0008353 3300041413 Bacteria 3268
876 Ga0439465_0010651 3300041413 Bacteria 2885
877 Ga0439465_0011796 3300041413 Bacteria 2737
878 Ga0439465_0031545 3300041413 Bacteria 1688
879 Ga0451802_0335608 3300041460 Bacteria 1320
880 Ga0451802_1677789 3300041460 Bacteria 1996
881 Ga0451853_0988203 3300041512 Bacteria 1841
882 Ga0451853_2451760 3300041512 Bacteria 3750
883 Ga0439431_0000706 3300041997 Bacteria 7181
884 Ga0439433_0000016 3300041999 Bacteria 22353
885 Ga0439433_0005084 3300041999 Bacteria 2824
886 Ga0439442_000124 3300042002 Bacteria 19456
887 Ga0439442_000483 3300042002 Bacteria 9062
888 Ga0439442_006494 3300042002 Bacteria 2348
889 Ga0439442_007840 3300042002 Bacteria 2155
890 Ga0439442_012154 3300042002 Bacteria 1758
891 Ga0439432_027337 3300042006 Bacteria 1863
892 Ga0439449_0000123 3300042007 Bacteria 25838
893 Ga0439449_0044932 3300042007 Bacteria 1637
894 Ga0439452_008147 3300042010 Bacteria 3170
895 Ga0439452_027059 3300042010 Bacteria 1443
896 Ga0439463_026533 3300042016 Bacteria 1455
897 Ga0450920_001002 3300042122 Bacteria 4624
898 Ga0450920_008485 3300042122 Bacteria 1878
899 Ga0450907_000606 3300042146 Bacteria 9518
900 Ga0439434_0000220 3300042435 Bacteria 15927
901 Ga0439434_0018559 3300042435 Bacteria 2083
902 Ga0466969_0031467 3300044656 Bacteria 2701
903 Ga0466972_0017406 3300044658 Bacteria 3597
904 Ga0466972_0102840 3300044658 Bacteria 1351
905 Ga0466965_0008270 3300044683 Bacteria 4808
906 Ga0466965_0010455 3300044683 Bacteria 4329
907 Ga0466965_0014794 3300044683 Bacteria 3696
908 Ga0466965_0027934 3300044683 Bacteria 2739
909 Ga0466966_0003105 3300044684 Bacteria 10934
910 Ga0466966_0006470 3300044684 Bacteria 7752
911 Ga0466966_0012176 3300044684 Bacteria 5698
912 Ga0466966_0030188 3300044684 Bacteria 3521
913 Ga0466966_0074689 3300044684 Bacteria 2118
914 Ga0466966_0076601 3300044684 Bacteria 2088
915 Ga0466966_0078802 3300044684 Bacteria 2054
916 Ga0466966_0143115 3300044684 Bacteria 1460
917 Ga0466961_0000223 3300044693 Bacteria 38608
918 Ga0466961_0005237 3300044693 Bacteria 8166
919 Ga0466961_0014413 3300044693 Bacteria 5074
920 Ga0466961_0016492 3300044693 Bacteria 4746
921 Ga0466961_0019719 3300044693 Bacteria 4339
922 Ga0466961_0035925 3300044693 Bacteria 3181
923 Ga0466961_0049608 3300044693 Bacteria 2682
924 Ga0466961_0050180 3300044693 Bacteria 2665
925 Ga0466961_0052631 3300044693 Bacteria 2598
926 Ga0466961_0103753 3300044693 Bacteria 1790
927 Ga0466961_0107930 3300044693 Bacteria 1752
928 Ga0466961_0162785 3300044693 Bacteria 1390
929 Ga0466963_0000604 3300044694 Bacteria 17169
930 Ga0466963_0002782 3300044694 Bacteria 9861
931 Ga0466963_0104315 3300044694 Bacteria 1942
932 Ga0466964_0068658 3300044706 Bacteria 1493
933 Ga0466971_0000354 3300044719 Bacteria 17531
934 Ga0466971_0019022 3300044719 Bacteria 3048
935 Ga0466971_0023917 3300044719 Bacteria 2724
936 Ga0466971_0083518 3300044719 Bacteria 1458
937 Ga0466968_0001034 3300044735 Bacteria 9823
938 Ga0466968_0014236 3300044735 Bacteria 3141
939 Ga0466968_0046781 3300044735 Bacteria 1838
940 Ga0466970_0001205 3300044765 Bacteria 12557
941 Ga0466970_0007113 3300044765 Bacteria 5600
942 Ga0466970_0007660 3300044765 Bacteria 5414
943 Ga0466970_0026731 3300044765 Bacteria 3025
944 Ga0466970_0034538 3300044765 Bacteria 2677
945 Ga0466970_0050609 3300044765 Bacteria 2216
946 Ga0466957_0000283 3300044842 Bacteria 24756
947 Ga0466957_0004553 3300044842 Bacteria 7742
948 Ga0466957_0010194 3300044842 Bacteria 5382
949 Ga0466957_0012679 3300044842 Bacteria 4883
950 Ga0466957_0024790 3300044842 Bacteria 3552
951 Ga0466957_0043592 3300044842 Bacteria 2717
952 Ga0466957_0066258 3300044842 Bacteria 2226
953 Ga0466960_0002656 3300044901 Bacteria 6742
954 Ga0466960_0004820 3300044901 Bacteria 5301
955 Ga0466960_0005643 3300044901 Bacteria 4966
956 Ga0466960_0019496 3300044901 Bacteria 2991
957 Ga0466960_0025646 3300044901 Bacteria 2669
958 Ga0466960_0150487 3300044901 Bacteria 1243
959 Ga0466959_0009115 3300045049 Bacteria 7046
960 Ga0466959_0013261 3300045049 Bacteria 5969
961 Ga0466959_0014077 3300045049 Bacteria 5807
962 Ga0466959_0017810 3300045049 Bacteria 5210
963 Ga0466959_0022208 3300045049 Bacteria 4688
964 Ga0466959_0032930 3300045049 Bacteria 3836
965 Ga0466959_0040799 3300045049 Bacteria 3428
966 Ga0466959_0045121 3300045049 Bacteria 3246
967 Ga0466958_0000114 3300045836 Bacteria 25940
968 Ga0466958_0000748 3300045836 Bacteria 14254
969 Ga0466958_0005582 3300045836 Bacteria 6784
970 Ga0466958_0007421 3300045836 Bacteria 6031
971 Ga0466958_0020417 3300045836 Bacteria 3862
972 Ga0466958_0032227 3300045836 Bacteria 3117
973 Ga0466958_0035027 3300045836 Bacteria 2998
974 Ga0466958_0075985 3300045836 Bacteria 2061
975 Ga0466958_0098160 3300045836 Bacteria 1818
976 Ga0466967_0001120 3300045976 Bacteria 14881
977 Ga0466967_0006791 3300045976 Bacteria 8156
978 Ga0466967_0019688 3300045976 Bacteria 5434
979 Ga0466967_0024332 3300045976 Bacteria 4977
980 Ga0466967_0025471 3300045976 Bacteria 4879
981 Ga0466967_0027636 3300045976 Bacteria 4722
982 Ga0466967_0031995 3300045976 Bacteria 4437
983 Ga0466967_0075584 3300045976 Bacteria 3028
984 Ga0466967_0119314 3300045976 Bacteria 2434
985 Ga0466967_0364757 3300045976 Bacteria 1400
986 Ga0495627_039472 3300046453 Bacteria 1456
987 Ga0495627_046758 3300046453 Bacteria 1314
988 Ga0495592_0000157 3300046454 Bacteria 59697
989 Ga0495592_0064496 3300046454 Bacteria 2685
990 Ga0495603_0000552 3300046455 Bacteria 20921
991 Ga0495603_0013090 3300046455 Bacteria 5014
992 Ga0495603_0054857 3300046455 Bacteria 2361
993 Ga0495590_0000484 3300046457 Bacteria 19640
994 Ga0495629_0001111 3300046459 Bacteria 21303
995 Ga0495629_0001228 3300046459 Bacteria 20123
996 Ga0495629_0006771 3300046459 Bacteria 8470
997 Ga0495629_0014332 3300046459 Bacteria 5704
998 Ga0495638_0001596 3300046460 Bacteria 20236
999 Ga0495638_0040952 3300046460 Bacteria 2933
1000 Ga0495638_0059658 3300046460 Bacteria 2362
1001 Ga0495641_0008500 3300046461 Bacteria 6245
1002 Ga0495641_0051617 3300046461 Bacteria 1876
1003 Ga0495651_0000115 3300046462 Bacteria 59129
1004 Ga0495651_0006516 3300046462 Bacteria 8919
1005 Ga0495651_0035816 3300046462 Bacteria 3863
1006 Ga0495653_0011549 3300046463 Bacteria 7210
1007 Ga0495653_0068042 3300046463 Bacteria 2672
1008 Ga0495580_0003950 3300046472 Bacteria 12508
1009 Ga0495582_0005171 3300046473 Bacteria 7297
1010 Ga0495605_0004092 3300046474 Bacteria 8603
1011 Ga0495639_0002427 3300046475 Bacteria 8141
1012 Ga0495639_0016313 3300046475 Bacteria 3224
1013 Ga0495639_0029477 3300046475 Bacteria 2436
1014 Ga0495664_0001861 3300046477 Bacteria 11208
1015 Ga0495664_0030935 3300046477 Bacteria 3136
1016 Ga0495585_0024459 3300046492 Bacteria 3463
1017 Ga0495594_0000581 3300046499 Bacteria 18807
1018 Ga0495607_0035772 3300046501 Bacteria 3000
1019 Ga0495583_0039585 3300046506 Bacteria 2219
1020 Ga0495608_0003716 3300046511 Bacteria 10963
1021 Ga0495616_0007512 3300046513 Bacteria 6525
1022 Ga0495618_0076007 3300046514 Bacteria 2139
1023 Ga0495628_0000492 3300046516 Bacteria 36145
1024 Ga0495628_0030926 3300046516 Bacteria 4331
1025 Ga0495630_0219288 3300046517 Bacteria 1452
1026 Ga0495631_0028018 3300046518 Bacteria 2572
1027 Ga0495632_0023354 3300046519 Bacteria 3303
1028 Ga0495632_0105050 3300046519 Bacteria 1329
1029 Ga0495637_0034811 3300046520 Bacteria 2203
1030 Ga0495643_0003144 3300046522 Bacteria 12292
1031 Ga0495643_0060299 3300046522 Bacteria 2014
1032 Ga0495648_0018440 3300046524 Bacteria 4939
1033 Ga0495648_0057527 3300046524 Bacteria 2331
1034 Ga0495666_0019999 3300046526 Bacteria 3320
1035 Ga0495666_0043441 3300046526 Bacteria 2171
1036 Ga0495652_0007274 3300046529 Bacteria 10216
1037 Ga0495652_0022385 3300046529 Bacteria 5606
1038 Ga0495652_0060817 3300046529 Bacteria 3190
1039 Ga0495652_0073275 3300046529 Bacteria 2852
1040 Ga0495665_0030387 3300046531 Bacteria 2890
1041 Ga0495640_0026843 3300046533 Bacteria 4156
1042 Ga0495586_0002370 3300046535 Bacteria 10227
1043 Ga0495586_0015897 3300046535 Bacteria 4003
1044 Ga0495586_0092857 3300046535 Bacteria 1668
1045 Ga0495587_0000123 3300046536 Bacteria 59101
1046 Ga0495587_0002547 3300046536 Bacteria 12188
1047 Ga0495609_0011345 3300046538 Bacteria 4245
1048 Ga0495645_0001555 3300046543 Bacteria 15530
1049 Ga0495645_0019225 3300046543 Bacteria 4918
1050 Ga0495645_0027772 3300046543 Bacteria 4112
1051 Ga0495645_0034357 3300046543 Bacteria 3699
1052 Ga0495645_0155719 3300046543 Bacteria 1583
1053 Ga0495622_0008572 3300046557 Bacteria 4739
1054 Ga0495622_0019863 3300046557 Bacteria 3127
1055 Ga0495622_0058800 3300046557 Bacteria 1780
1056 Ga0495633_0006910 3300046558 Bacteria 6641
1057 Ga0495667_0000107 3300046559 Bacteria 60366
1058 Ga0495667_0001041 3300046559 Bacteria 18008
1059 Ga0495667_0007253 3300046559 Bacteria 7522
1060 Ga0495668_0002662 3300046616 Bacteria 14339
1061 Ga0495634_0020569 3300046642 Bacteria 4678
1062 Ga0495611_0016203 3300046648 Bacteria 3186
1063 Ga0495635_0028622 3300046663 Bacteria 3872
1064 Ga0495588_0040447 3300046674 Bacteria 2378
1065 Ga0495657_0000169 3300046675 Bacteria 59112
1066 Ga0495657_0011577 3300046675 Bacteria 6591
1067 Ga0495657_0029164 3300046675 Bacteria 3872
1068 Ga0495657_0036625 3300046675 Bacteria 3389
1069 Ga0495599_0002521 3300046678 Bacteria 10653
1070 Ga0495599_0037427 3300046678 Bacteria 3048
1071 Ga0495599_0042368 3300046678 Bacteria 2856
1072 Ga0495623_0000166 3300046679 Bacteria 41152
1073 Ga0495623_0033496 3300046679 Bacteria 3296
1074 Ga0495623_0050024 3300046679 Bacteria 2648
1075 Ga0495646_0059942 3300046680 Bacteria 2271
1076 Ga0495646_0111000 3300046680 Bacteria 1561
1077 Ga0495658_0116082 3300046683 Bacteria 1614
1078 Ga0495658_0154287 3300046683 Bacteria 1412
1079 Ga0495613_0009856 3300046689 Bacteria 7106
1080 Ga0495613_0015671 3300046689 Bacteria 5641
1081 Ga0495613_0027353 3300046689 Bacteria 4244
1082 Ga0495613_0032534 3300046689 Bacteria 3874
1083 Ga0495624_0058068 3300046690 Bacteria 2431
1084 Ga0495624_0169833 3300046690 Bacteria 1330
1085 Ga0495589_0032868 3300046794 Bacteria 2607
1086 Ga0495600_0005572 3300046809 Bacteria 7601
1087 Ga0495600_0009464 3300046809 Bacteria 6020
1088 Ga0495600_0017124 3300046809 Bacteria 4607
1089 Ga0495581_0009107 3300047315 Bacteria 5742
1090 Ga0495581_0027592 3300047315 Bacteria 3292
1091 Ga0495581_0043604 3300047315 Bacteria 2594
1092 Ga0495604_0000161 3300047317 Bacteria 59093
1093 Ga0495604_0003057 3300047317 Bacteria 13372
1094 Ga0495604_0027138 3300047317 Bacteria 4556
1095 Ga0495604_0038371 3300047317 Bacteria 3768
1096 Ga0495604_0052981 3300047317 Bacteria 3139
1097 Ga0495636_0026434 3300047318 Bacteria 2361
1098 Ga0495674_0012623 3300047319 Bacteria 7960
1099 Ga0495674_0018404 3300047319 Bacteria 6504
1100 Ga0495674_0101431 3300047319 Bacteria 2448
1101 Ga0495672_0003416 3300047320 Bacteria 13614
1102 Ga0495672_0041435 3300047320 Bacteria 2785
1103 Ga0495672_0041850 3300047320 Bacteria 2767
1104 Ga0495676_0000233 3300047321 Bacteria 44485
1105 Ga0495676_0005210 3300047321 Bacteria 11893
1106 Ga0495676_0017972 3300047321 Bacteria 6239
1107 Ga0495676_0200323 3300047321 Bacteria 1387
1108 Ga0495680_0007013 3300047322 Bacteria 10389
1109 Ga0495680_0023511 3300047322 Bacteria 5122
1110 Ga0495680_0030600 3300047322 Bacteria 4394
1111 Ga0495683_0002632 3300047323 Bacteria 10723
1112 Ga0495683_0041213 3300047323 Bacteria 2330
1113 Ga0495687_000581 3300047443 Bacteria 42904
1114 Ga0495687_030957 3300047443 Bacteria 2460
1115 Ga0495675_0002978 3300047444 Bacteria 10167
1116 Ga0495675_0011761 3300047444 Bacteria 5499
1117 Ga0495675_0015106 3300047444 Bacteria 4882
1118 Ga0495675_0022673 3300047444 Bacteria 4003
1119 Ga0495677_0036674 3300047445 Bacteria 1791
1120 Ga0495685_012532 3300047447 Bacteria 2872
1121 Ga0495684_0050867 3300047471 Bacteria 3162
1122 Ga0495684_0122680 3300047471 Bacteria 1956
1123 Ga0495686_0092934 3300047472 Bacteria 1829
1124 Ga0495593_0017119 3300047673 Bacteria 4079
1125 Ga0495593_0047132 3300047673 Bacteria 2293
1126 Ga0495602_0000182 3300048088 Bacteria 59124
1127 Ga0495602_0075152 3300048088 Bacteria 2868
1128 Ga0495614_0006858 3300048089 Bacteria 5094
1129 Ga0496100_0000335 3300048903 Bacteria 22955
1130 Ga0496100_0003473 3300048903 Bacteria 8222
1131 Ga0496100_0018499 3300048903 Bacteria 4134
1132 Ga0496100_0067268 3300048903 Bacteria 2379
1133 Ga0496100_0125109 3300048903 Bacteria 1803
1134 Ga0496101_0000193 3300048904 Bacteria 47493
1135 Ga0496101_0001504 3300048904 Bacteria 13952
1136 Ga0496101_0001767 3300048904 Bacteria 12973
1137 Ga0496101_0015785 3300048904 Bacteria 5097
1138 Ga0496101_0031811 3300048904 Bacteria 3711
1139 Ga0496101_0038237 3300048904 Bacteria 3408
1140 Ga0496101_0056663 3300048904 Bacteria 2833
1141 Ga0496101_0215633 3300048904 Bacteria 1488
1142 Ga0496102_0000403 3300048905 Bacteria 50292
1143 Ga0496102_0000750 3300048905 Bacteria 31716
1144 Ga0496102_0021913 3300048905 Bacteria 5657
1145 Ga0496102_0031975 3300048905 Bacteria 4724
1146 Ga0496102_0032948 3300048905 Bacteria 4656
1147 Ga0496102_0139973 3300048905 Bacteria 2269
1148 Ga0496102_0147261 3300048905 Bacteria 2210
1149 Ga0496102_0198432 3300048905 Bacteria 1891
1150 Ga0496102_0202009 3300048905 Bacteria 1874
1151 Ga0496102_0284190 3300048905 Bacteria 1559
1152 Ga0496103_0000284 3300048906 Bacteria 47531
1153 Ga0496103_0001055 3300048906 Bacteria 19218
1154 Ga0496103_0002082 3300048906 Bacteria 12781
1155 Ga0496103_0042265 3300048906 Bacteria 2804
1156 Ga0496104_0012811 3300048907 Bacteria 7552
1157 Ga0496104_0025727 3300048907 Bacteria 5427
1158 Ga0496104_0039321 3300048907 Bacteria 4429
1159 Ga0496104_0059938 3300048907 Bacteria 3604
1160 Ga0496104_0093139 3300048907 Bacteria 2881
1161 Ga0496105_0002855 3300048908 Bacteria 12645
1162 Ga0496105_0021733 3300048908 Bacteria 5193
1163 Ga0496105_0036004 3300048908 Bacteria 4076
1164 Ga0496105_0050189 3300048908 Bacteria 3446
1165 Ga0496105_0062054 3300048908 Bacteria 3085
1166 Ga0496105_0069758 3300048908 Bacteria 2904
1167 Ga0496105_0187822 3300048908 Bacteria 1691
1168 Ga0496106_0000199 3300048909 Bacteria 42320
1169 Ga0496106_0005688 3300048909 Bacteria 9219
1170 Ga0496106_0008646 3300048909 Bacteria 7536
1171 Ga0496106_0014818 3300048909 Bacteria 5764
1172 Ga0496106_0017751 3300048909 Bacteria 5263
1173 Ga0496106_0058154 3300048909 Bacteria 2926
1174 Ga0496106_0163455 3300048909 Bacteria 1761
1175 Ga0496107_0001353 3300048910 Bacteria 15069
1176 Ga0496107_0003743 3300048910 Bacteria 10216
1177 Ga0496107_0013481 3300048910 Bacteria 5715
1178 Ga0496107_0014415 3300048910 Bacteria 5535
1179 Ga0496107_0067460 3300048910 Bacteria 2596
1180 Ga0496107_0202652 3300048910 Bacteria 1475
1181 Ga0496108_0000966 3300048911 Bacteria 22375
1182 Ga0496108_0006263 3300048911 Bacteria 9640
1183 Ga0496108_0012159 3300048911 Bacteria 6999
1184 Ga0496108_0022651 3300048911 Bacteria 5166
1185 Ga0496108_0045925 3300048911 Bacteria 3648
1186 Ga0496108_0051511 3300048911 Bacteria 3449
1187 Ga0496108_0060482 3300048911 Bacteria 3187
1188 Ga0496108_0125407 3300048911 Bacteria 2204
1189 Ga0496109_0001398 3300048912 Bacteria 19996
1190 Ga0496109_0008976 3300048912 Bacteria 8514
1191 Ga0496109_0013820 3300048912 Bacteria 7014
1192 Ga0496109_0038853 3300048912 Bacteria 4305
1193 Ga0496109_0053536 3300048912 Bacteria 3681
1194 Ga0496109_0066894 3300048912 Bacteria 3291
1195 Ga0496109_0078672 3300048912 Bacteria 3036
1196 Ga0496109_0114351 3300048912 Bacteria 2511
1197 Ga0496109_0171944 3300048912 Bacteria 2033
1198 Ga0496109_0257216 3300048912 Bacteria 1644
1199 Ga0496110_0003627 3300048913 Bacteria 11876
1200 Ga0496110_0010603 3300048913 Bacteria 7502
1201 Ga0496110_0020318 3300048913 Bacteria 5607
1202 Ga0496110_0028522 3300048913 Bacteria 4795
1203 Ga0496110_0032924 3300048913 Bacteria 4480
1204 Ga0496110_0056148 3300048913 Bacteria 3465
1205 Ga0496110_0071762 3300048913 Bacteria 3071
1206 Ga0496110_0080305 3300048913 Bacteria 2906
1207 Ga0496111_0045908 3300048914 Bacteria 3144
1208 Ga0496111_0057655 3300048914 Bacteria 2812
1209 Ga0496111_0095915 3300048914 Bacteria 2176
1210 Ga0496111_0218902 3300048914 Bacteria 1414
1211 Ga0496111_0256606 3300048914 Bacteria 1297
1212 Ga0496112_0002892 3300048915 Bacteria 13979
1213 Ga0496112_0017061 3300048915 Bacteria 6816
1214 Ga0496112_0018635 3300048915 Bacteria 6540
1215 Ga0496112_0044614 3300048915 Bacteria 4345
1216 Ga0496112_0066522 3300048915 Bacteria 3556
1217 Ga0496112_0181212 3300048915 Bacteria 2070
1218 Ga0496112_0197097 3300048915 Bacteria 1974
1219 Ga0496113_0006724 3300048916 Bacteria 7325
1220 Ga0496113_0007107 3300048916 Bacteria 7166
1221 Ga0496113_0122804 3300048916 Bacteria 2032
1222 Ga0496113_0297112 3300048916 Bacteria 1293
1223 Ga0496114_0000559 3300048917 Bacteria 27624
1224 Ga0496114_0001803 3300048917 Bacteria 16262
1225 Ga0496114_0008348 3300048917 Bacteria 8205
1226 Ga0496114_0015343 3300048917 Bacteria 6159
1227 Ga0496114_0017869 3300048917 Bacteria 5732
1228 Ga0496115_0003426 3300048918 Bacteria 11391
1229 Ga0496115_0010823 3300048918 Bacteria 6822
1230 Ga0496115_0019920 3300048918 Bacteria 5169
1231 Ga0496115_0020283 3300048918 Bacteria 5126
1232 Ga0496115_0059407 3300048918 Bacteria 3079
1233 Ga0496115_0101116 3300048918 Bacteria 2363
1234 Ga0496115_0124763 3300048918 Bacteria 2120
1235 Ga0496115_0151615 3300048918 Bacteria 1915
1236 Ga0496116_0000059 3300048919 Bacteria 274491
1237 Ga0496116_0031324 3300048919 Bacteria 3809
1238 Ga0496117_0000055 3300048920 Bacteria 274518
1239 Ga0496117_0002301 3300048920 Bacteria 24585
1240 Ga0496117_0003028 3300048920 Bacteria 20155
1241 Ga0496117_0029473 3300048920 Bacteria 4230
1242 Ga0496117_0034361 3300048920 Bacteria 3820
1243 Ga0496117_0057954 3300048920 Bacteria 2686
1244 Ga0496118_0000398 3300048921 Bacteria 73344
1245 Ga0496118_0000879 3300048921 Bacteria 47364
1246 Ga0496118_0002102 3300048921 Bacteria 27974
1247 Ga0496118_0009080 3300048921 Bacteria 10128
1248 Ga0496118_0045956 3300048921 Bacteria 3401
1249 Ga0496118_0072819 3300048921 Bacteria 2465
1250 Ga0496118_0099499 3300048921 Bacteria 1970
1251 Ga0496119_0000375 3300048922 Bacteria 61774
1252 Ga0496119_0010507 3300048922 Bacteria 7781
1253 Ga0496119_0016974 3300048922 Bacteria 5505
1254 Ga0496119_0018886 3300048922 Bacteria 5106
1255 Ga0496120_0000453 3300048923 Bacteria 64868
1256 Ga0496120_0004273 3300048923 Bacteria 12140
1257 Ga0496120_0011458 3300048923 Bacteria 6095
1258 Ga0496120_0016566 3300048923 Bacteria 4813
1259 Ga0496120_0016881 3300048923 Bacteria 4753
1260 Ga0496120_0089304 3300048923 Bacteria 1650
1261 Ga0496121_0000433 3300048924 Bacteria 82438
1262 Ga0496121_0001114 3300048924 Bacteria 47347
1263 Ga0496121_0011354 3300048924 Bacteria 9901
1264 Ga0496121_0043764 3300048924 Bacteria 3872
1265 Ga0496122_0001536 3300048925 Bacteria 36713
1266 Ga0496122_0008484 3300048925 Bacteria 11066
1267 Ga0496122_0009000 3300048925 Bacteria 10611
1268 Ga0496122_0099743 3300048925 Bacteria 1946
1269 Ga0496123_0001055 3300048926 Bacteria 41698
1270 Ga0496123_0054573 3300048926 Bacteria 2629
1271 Ga0496123_0088077 3300048926 Bacteria 1855
1272 Ga0496124_0000015 3300048927 Bacteria 460700
1273 Ga0496124_0000198 3300048927 Bacteria 119277
1274 Ga0496124_0007726 3300048927 Bacteria 11368
1275 Ga0496124_0007779 3300048927 Bacteria 11324
1276 Ga0496125_0000021 3300048928 Bacteria 460688
1277 Ga0496125_0000172 3300048928 Bacteria 144915
1278 Ga0496125_0003069 3300048928 Bacteria 20857
1279 Ga0496125_0020233 3300048928 Bacteria 6250
1280 Ga0496125_0051644 3300048928 Bacteria 3389
1281 Ga0496125_0210415 3300048928 Bacteria 1263
1282 Ga0496126_0000015 3300048929 Bacteria 663212
1283 Ga0496126_0000676 3300048929 Bacteria 62750
1284 Ga0496126_0005915 3300048929 Bacteria 13791
1285 Ga0496126_0008414 3300048929 Bacteria 11132
1286 Ga0496126_0009487 3300048929 Bacteria 10325
1287 Ga0496126_0064670 3300048929 Bacteria 3276
1288 Ga0496126_0084982 3300048929 Bacteria 2790
1289 Ga0496126_0217689 3300048929 Bacteria 1606
1290 Ga0501306_006485 3300049127 Bacteria 1374
1291 Ga0501031_0005824 3300049568 Bacteria 8029
1292 Ga0501031_0089703 3300049568 Bacteria 2005
1293 Ga0501032_0001836 3300049569 Bacteria 16790
1294 Ga0501032_0005443 3300049569 Bacteria 9450
1295 Ga0501032_0008992 3300049569 Bacteria 7264
1296 Ga0501032_0013197 3300049569 Bacteria 5879
1297 Ga0501033_0027710 3300049570 Bacteria 4259
1298 Ga0501033_0034053 3300049570 Bacteria 3822
1299 Ga0501033_0110295 3300049570 Bacteria 2003
1300 Ga0501033_0130203 3300049570 Bacteria 1823
1301 Ga0501034_0000015 3300049571 Bacteria 296163
1302 Ga0501034_0000543 3300049571 Bacteria 60025
1303 Ga0501034_0005064 3300049571 Bacteria 14478
1304 Ga0501034_0018586 3300049571 Bacteria 7125
1305 Ga0501034_0022037 3300049571 Bacteria 6490
1306 Ga0501034_0065426 3300049571 Bacteria 3648
1307 Ga0501034_0071162 3300049571 Bacteria 3488
1308 Ga0501034_0080618 3300049571 Bacteria 3258
1309 Ga0501034_0098570 3300049571 Bacteria 2918
1310 Ga0501034_0123536 3300049571 Bacteria 2574
1311 Ga0501034_0123811 3300049571 Bacteria 2571
1312 Ga0501034_0124822 3300049571 Bacteria 2559
1313 Ga0501034_0171816 3300049571 Bacteria 2134
1314 Ga0501034_0303310 3300049571 Bacteria 1533
1315 Ga0501034_0417429 3300049571 Bacteria 1263
1316 Ga0501036_0002530 3300049572 Bacteria 14358
1317 Ga0501036_0003852 3300049572 Bacteria 12037
1318 Ga0501036_0015135 3300049572 Bacteria 6442
1319 Ga0501036_0024970 3300049572 Bacteria 5040
1320 Ga0501036_0149485 3300049572 Bacteria 1970
1321 Ga0501036_0165471 3300049572 Bacteria 1864
1322 Ga0501037_0001123 3300049573 Bacteria 19813
1323 Ga0501037_0013330 3300049573 Bacteria 6058
1324 Ga0501037_0047486 3300049573 Bacteria 3146
1325 Ga0501037_0068478 3300049573 Bacteria 2584
1326 Ga0501037_0126288 3300049573 Bacteria 1836
1327 Ga0501038_0006115 3300049574 Bacteria 11140
1328 Ga0501038_0007725 3300049574 Bacteria 9916
1329 Ga0501038_0017810 3300049574 Bacteria 6418
1330 Ga0501038_0061692 3300049574 Bacteria 3205
1331 Ga0501038_0099827 3300049574 Bacteria 2419
1332 Ga0501038_0144817 3300049574 Bacteria 1941
1333 Ga0501038_0197175 3300049574 Bacteria 1618
1334 Ga0501039_0001048 3300049575 Bacteria 20241
1335 Ga0501039_0006498 3300049575 Bacteria 8890
1336 Ga0501039_0009678 3300049575 Bacteria 7346
1337 Ga0501040_0022837 3300049576 Bacteria 4191
1338 Ga0501040_0087038 3300049576 Bacteria 2169
1339 Ga0501041_0000703 3300049577 Bacteria 17796
1340 Ga0501041_0043969 3300049577 Bacteria 2715
1341 Ga0501041_0071309 3300049577 Bacteria 2133
1342 Ga0501042_0045990 3300049578 Bacteria 3111
1343 Ga0501042_0058123 3300049578 Bacteria 2760
1344 Ga0501042_0067621 3300049578 Bacteria 2554
1345 Ga0501042_0110801 3300049578 Bacteria 1976
1346 Ga0501043_0000606 3300049579 Bacteria 31710
1347 Ga0501043_0009509 3300049579 Bacteria 7621
1348 Ga0501043_0013569 3300049579 Bacteria 6374
1349 Ga0501043_0016803 3300049579 Bacteria 5735
1350 Ga0501043_0024460 3300049579 Bacteria 4740
1351 Ga0501043_0036812 3300049579 Bacteria 3850
1352 Ga0501043_0043569 3300049579 Bacteria 3527
1353 Ga0501043_0046336 3300049579 Bacteria 3419
1354 Ga0501043_0052392 3300049579 Bacteria 3205
1355 Ga0501043_0117528 3300049579 Bacteria 2086
1356 Ga0501043_0172766 3300049579 Bacteria 1686
1357 Ga0501046_0001735 3300049580 Bacteria 20794
1358 Ga0501046_0002135 3300049580 Bacteria 18685
1359 Ga0501046_0003857 3300049580 Bacteria 13713
1360 Ga0501046_0006220 3300049580 Bacteria 10599
1361 Ga0501047_0000107 3300049581 Bacteria 102041
1362 Ga0501047_0000268 3300049581 Bacteria 60315
1363 Ga0501047_0002183 3300049581 Bacteria 18725
1364 Ga0501047_0008765 3300049581 Bacteria 9545
1365 Ga0501047_0013070 3300049581 Bacteria 7863
1366 Ga0501047_0027020 3300049581 Bacteria 5528
1367 Ga0501047_0087040 3300049581 Bacteria 3002
1368 Ga0501048_0003331 3300049582 Bacteria 12228
1369 Ga0501048_0143518 3300049582 Bacteria 1688
1370 Ga0501048_0164294 3300049582 Bacteria 1572
1371 Ga0501048_0251248 3300049582 Bacteria 1255
1372 Ga0501067_0008668 3300049583 Bacteria 5637
1373 Ga0501067_0032390 3300049583 Bacteria 2901
1374 Ga0501068_0017903 3300049584 Bacteria 4102
1375 Ga0501068_0106361 3300049584 Bacteria 1742
1376 Ga0501069_0006022 3300049585 Bacteria 6328
1377 Ga0501069_0038097 3300049585 Bacteria 2654
1378 Ga0501069_0066513 3300049585 Bacteria 2015
1379 Ga0501070_0000925 3300049586 Bacteria 26486
1380 Ga0501070_0002491 3300049586 Bacteria 16128
1381 Ga0501070_0004541 3300049586 Bacteria 11911
1382 Ga0501070_0008759 3300049586 Bacteria 8555
1383 Ga0501070_0042137 3300049586 Bacteria 3802
1384 Ga0501070_0043498 3300049586 Bacteria 3737
1385 Ga0501070_0047700 3300049586 Bacteria 3559
1386 Ga0501070_0068120 3300049586 Bacteria 2946
1387 Ga0501070_0095453 3300049586 Bacteria 2460
1388 Ga0501071_0000938 3300049587 Bacteria 15841
1389 Ga0501071_0032295 3300049587 Bacteria 3717
1390 Ga0501072_0006940 3300049588 Bacteria 8598
1391 Ga0501072_0072579 3300049588 Bacteria 2720
1392 Ga0501072_0161295 3300049588 Bacteria 1789
1393 Ga0501072_0161952 3300049588 Bacteria 1785
1394 Ga0501072_0192834 3300049588 Bacteria 1625
1395 Ga0501073_0000024 3300049589 Bacteria 128851
1396 Ga0501073_0016913 3300049589 Bacteria 5282
1397 Ga0501073_0024223 3300049589 Bacteria 4358
1398 Ga0501073_0072087 3300049589 Bacteria 2406
1399 Ga0501073_0183129 3300049589 Bacteria 1450
1400 Ga0501074_0001157 3300049590 Bacteria 17270
1401 Ga0501074_0002652 3300049590 Bacteria 12537
1402 Ga0501074_0018015 3300049590 Bacteria 5130
1403 Ga0501074_0090092 3300049590 Bacteria 2197
1404 Ga0501076_0001496 3300049592 Bacteria 15672
1405 Ga0501076_0022476 3300049592 Bacteria 4846
1406 Ga0501076_0201480 3300049592 Bacteria 1625
1407 Ga0501077_0014871 3300049593 Bacteria 4891
1408 Ga0501079_0003055 3300049741 Bacteria 12245
1409 Ga0501079_0011446 3300049741 Bacteria 6772
1410 Ga0501080_0001035 3300049742 Bacteria 22914
1411 Ga0501080_0006153 3300049742 Bacteria 10769
1412 Ga0501080_0016596 3300049742 Bacteria 6802
1413 Ga0501080_0022823 3300049742 Bacteria 5799
1414 Ga0501080_0091423 3300049742 Bacteria 2827
1415 Ga0501080_0258973 3300049742 Bacteria 1585
1416 Ga0501081_0006271 3300049743 Bacteria 7710
1417 Ga0501081_0011062 3300049743 Bacteria 5901
1418 Ga0501083_0005406 3300049744 Bacteria 9042
1419 Ga0501083_0186096 3300049744 Bacteria 1356
1420 Ga0501035_0003186 3300049822 Bacteria 15726
1421 Ga0501035_0014479 3300049822 Bacteria 7279
1422 Ga0501035_0014942 3300049822 Bacteria 7164
1423 Ga0501035_0019336 3300049822 Bacteria 6266
1424 Ga0501035_0023019 3300049822 Bacteria 5718
1425 Ga0501035_0023206 3300049822 Bacteria 5691
1426 Ga0501044_0001612 3300049823 Bacteria 26422
1427 Ga0501044_0005882 3300049823 Bacteria 13589
1428 Ga0501044_0006459 3300049823 Bacteria 12950
1429 Ga0501044_0007748 3300049823 Bacteria 11806
1430 Ga0501044_0015647 3300049823 Bacteria 8170
1431 Ga0501044_0035143 3300049823 Bacteria 5250
1432 Ga0501044_0043045 3300049823 Bacteria 4692
1433 Ga0501044_0066591 3300049823 Bacteria 3672
1434 Ga0501044_0089672 3300049823 Bacteria 3103
1435 Ga0501045_0039028 3300049824 Bacteria 3455
1436 nmdc:mga03683_17583_c1 3300050489 Bacteria 2708
1437 nmdc:mga03n38_1081_c1 3300050490 Bacteria 7519
1438 nmdc:mga03n38_2844_c1 3300050490 Bacteria 5447
1439 nmdc:mga03n38_38141_c1 3300050490 Bacteria 2077
1440 nmdc:mga00v17_10006_c1 3300050491 Bacteria 5159
1441 nmdc:mga00v17_16972_c1 3300050491 Bacteria 4112
1442 nmdc:mga00v17_3299_c1 3300050491 Bacteria 8322
1443 nmdc:mga00v17_3766_c1 3300050491 Bacteria 7829
1444 nmdc:mga00v17_37721_c1 3300050491 Bacteria 2887
1445 nmdc:mga00v17_72057_c1 3300050491 Bacteria 2143
1446 nmdc:mga00v17_9193_c1 3300050491 Bacteria 5338
1447 nmdc:mga0yw44_2056_c1 3300050492 Bacteria 8398
1448 nmdc:mga0yw44_4555_c1 3300050492 Bacteria 6382
1449 nmdc:mga06z11_11779_c1 3300050494 Bacteria 3781
1450 nmdc:mga07m45_113737_c1 3300050496 Bacteria 1560
1451 nmdc:mga07m45_18278_c1 3300050496 Bacteria 3781
1452 nmdc:mga07m45_3115_c1 3300050496 Bacteria 7939
1453 nmdc:mga07m45_41926_c1 3300050496 Bacteria 2564
1454 nmdc:mga07m45_47346_c1 3300050496 Bacteria 2417
1455 nmdc:mga07m45_7793_c1 3300050496 Bacteria 5480
1456 nmdc:mga05p37_11899_c1 3300050507 Bacteria 10376
1457 nmdc:mga05p37_172547_c1 3300050507 Bacteria 2637
1458 nmdc:mga05p37_2128_c1 3300050507 Bacteria 23129
1459 nmdc:mga05p37_46755_c1 3300050507 Bacteria 5321
1460 nmdc:mga05p37_59920_c1 3300050507 Bacteria 4687
1461 nmdc:mga09592_1737_c1 3300050508 Bacteria 17543
1462 nmdc:mga09592_199312_c1 3300050508 Bacteria 1733
1463 nmdc:mga0qj67_193_c1 3300050509 Bacteria 41569
1464 nmdc:mga0qj67_3435_c1 3300050509 Bacteria 11415
1465 nmdc:mga0qj67_36297_c1 3300050509 Bacteria 3856
1466 nmdc:mga0qj67_695_c1 3300050509 Bacteria 22912
1467 nmdc:mga06r32_111190_c1 3300050510 Bacteria 2696
1468 nmdc:mga06r32_15489_c1 3300050510 Bacteria 6922
1469 nmdc:mga06r32_1594_c1 3300050510 Bacteria 20429
1470 nmdc:mga06r32_198_c1 3300050510 Bacteria 26154
1471 nmdc:mga06r32_261812_c1 3300050510 Bacteria 1717
1472 nmdc:mga06r32_275_c1 3300050510 Bacteria 42703
1473 nmdc:mga06r32_77316_c1 3300050510 Bacteria 3233
1474 nmdc:mga08y16_5920_c1 3300050511 Bacteria 12821
1475 nmdc:mga08y16_85139_c1 3300050511 Bacteria 3294
1476 nmdc:mga08y16_92314_c1 3300050511 Bacteria 3155
1477 nmdc:mga0n895_41320_c1 3300050512 Bacteria 4482
1478 nmdc:mga0n895_7027_c1 3300050512 Bacteria 9616
1479 nmdc:mga0n895_93647_c1 3300050512 Bacteria 3008
1480 nmdc:mga0n895_99740_c1 3300050512 Bacteria 2913
1481 nmdc:mga0rr50_41993_c1 3300050513 Bacteria 3337
1482 nmdc:mga0rr50_64626_c1 3300050513 Bacteria 2769
1483 nmdc:mga08x19_6450_c1 3300050514 Bacteria 6947
1484 nmdc:mga0a205_109248_c1 3300050515 Bacteria 2664
1485 nmdc:mga0a205_38254_c1 3300050515 Bacteria 4615
1486 nmdc:mga0a205_56142_c1 3300050515 Bacteria 3803
1487 nmdc:mga0a205_8625_c2 3300050515 Bacteria 7926
1488 nmdc:mga0sz30_4791_c1 3300050516 Bacteria 4922
1489 nmdc:mga0sz30_65576_c1 3300050516 Bacteria 1557
1490 nmdc:mga0sz30_656_c1 3300050516 Bacteria 12820
1491 nmdc:mga0sz30_8114_c1 3300050516 Bacteria 3956
1492 Ga0495601_0125810 3300053077 Bacteria 1667
1493 Ga0495612_0000472 3300053078 Bacteria 16204
1494 Ga0495612_0029687 3300053078 Bacteria 2203
1495 Ga0495612_0043180 3300053078 Bacteria 1841
1496 Ga0495595_0006267 3300053084 Bacteria 4845
1497 Ga0495595_0017594 3300053084 Bacteria 3077
1498 Ga0495619_0061541 3300053085 Bacteria 2498
1499 Ga0495619_0077770 3300053085 Bacteria 2229
1500 Ga0495619_0103658 3300053085 Bacteria 1938
1501 Ga0500643_000189 3300053087 Bacteria 58813
1502 Ga0500643_000352 3300053087 Bacteria 36502
1503 Ga0500646_0000612 3300053090 Bacteria 10209
1504 Ga0500651_0001689 3300053093 Bacteria 11274
1505 Ga0500651_0131400 3300053093 Bacteria 1514
1506 Ga0500641_0035450 3300053096 Bacteria 1991
1507 Ga0500554_006511 3300053102 Bacteria 2624
1508 Ga0500556_0000062 3300053104 Bacteria 110818
1509 Ga0500593_035358 3300053117 Bacteria 2236
1510 Ga0500594_0004228 3300053118 Bacteria 3167
1511 Ga0500652_058759 3300053131 Bacteria 1580
1512 Ga0500658_0039444 3300053134 Bacteria 1888
1513 Ga0500559_0000868 3300053136 Bacteria 19392
1514 Ga0500559_0002901 3300053136 Bacteria 8631
1515 Ga0500559_0020640 3300053136 Bacteria 2786
1516 Ga0500568_0000060 3300053139 Bacteria 107901
1517 Ga0500568_0000124 3300053139 Bacteria 68924
1518 Ga0500568_0002651 3300053139 Bacteria 10388
1519 Ga0500568_0019851 3300053139 Bacteria 2914
1520 Ga0500568_0033263 3300053139 Bacteria 2117
1521 Ga0500573_0000007 3300053140 Bacteria 272970
1522 Ga0500588_0003567 3300053146 Bacteria 3297
1523 Ga0500589_052185 3300053147 Bacteria 1895
1524 Ga0500590_001918 3300053148 Bacteria 8895
1525 Ga0500600_0068994 3300053149 Bacteria 1944
1526 Ga0500604_0013291 3300053151 Bacteria 2229
1527 Ga0500616_0002004 3300053153 Bacteria 18042
1528 Ga0500616_0064516 3300053153 Bacteria 1886
1529 Ga0500620_000387 3300053155 Bacteria 8152
1530 Ga0500645_000128 3300053730 Bacteria 59444
1531 Ga0501084_0002094 3300054114 Bacteria 15945
1532 Ga0501084_0028238 3300054114 Bacteria 4689
1533 Ga0501084_0052351 3300054114 Bacteria 3416
1534 Ga0501084_0053198 3300054114 Bacteria 3387
1535 Ga0501084_0063808 3300054114 Bacteria 3084
1536 Ga0501084_0126504 3300054114 Bacteria 2150
1537 Ga0501084_0237061 3300054114 Bacteria 1540
1538 Ga0590075_004557 3300059424 Bacteria 3284
1539 Ga0501082_0013306 3300060353 Bacteria 7074
1540 Ga0501082_0064397 3300060353 Bacteria 3157
1541 Ga0466962_0000302 3300061719 Bacteria 21145
1542 Ga0466962_0003093 3300061719 Bacteria 7915
1543 Ga0466962_0004408 3300061719 Bacteria 6749
1544 Ga0466962_0006025 3300061719 Bacteria 5830
1545 Ga0466962_0028426 3300061719 Bacteria 2679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0172766 Ga0501043_0172766_651_1673 340
2 3300048929 Ga0496126_0217689 Ga0496126_0217689_22_1086 353
3 3300049589 Ga0501073_0072087 Ga0501073_0072087_1327_2394 354
4 3300026088 Ga0207641_10041605 Ga0207641_100416052 355
5 3300044901 Ga0466960_0150487 Ga0466960_0150487_141_1223 356
6 3300026075 Ga0207708_10084696 Ga0207708_100846963 360
7 3300048914 Ga0496111_0256606 Ga0496111_0256606_11_1102 363
8 3300044693 Ga0466961_0103753 Ga0466961_0103753_677_1777 364
9 3300046477 Ga0495664_0030935 Ga0495664_0030935_13_1128 370
10 3300047321 Ga0495676_0200323 Ga0495676_0200323_20_1135 370
11 3300049588 Ga0501072_0161295 Ga0501072_0161295_611_1759 370
12 3300046517 Ga0495630_0219288 Ga0495630_0219288_41_1210 373
13 3300037312 Ga0395899_0035839 Ga0395899_0035839_1238_2443 379
14 3300037418 Ga0395900_0005127 Ga0395900_0005127_1895_3100 379
15 3300037466 Ga0395898_0029723 Ga0395898_0029723_3088_4293 379
16 3300037471 Ga0395905_0009643 Ga0395905_0009643_5282_6487 379
17 3300038443 Ga0395901_0032994 Ga0395901_0032994_2420_3625 379
18 3300049571 Ga0501034_0124822 Ga0501034_0124822_1388_2539 382
19 3300047319 Ga0495674_0018404 Ga0495674_0018404_3300_4514 385
20 3300047322 Ga0495680_0030600 Ga0495680_0030600_2097_3311 385
21 3300044693 Ga0466961_0052631 Ga0466961_0052631_881_2050 387
22 3300031995 Ga0307409_100008616 Ga0307409_1000086167 388
23 3300048913 Ga0496110_0071762 Ga0496110_0071762_18_1184 388
24 3300005468 Ga0070707_100039640 Ga0070707_1000396401 389
25 3300006028 Ga0070717_10055531 Ga0070717_100555312 389
26 3300009094 Ga0111539_10452066 Ga0111539_104520662 392
27 3300049574 Ga0501038_0144817 Ga0501038_0144817_605_1786 392
28 3300049580 Ga0501046_0006220 Ga0501046_0006220_6150_7331 392
29 3300049581 Ga0501047_0013070 Ga0501047_0013070_4038_5219 392
30 3300049823 Ga0501044_0015647 Ga0501044_0015647_4065_5246 392
31 iso_pu_bacteria 2857737099 2857740182 392
32 iso_pu_bacteria 2995463766 2995469292 392
33 3300006028 Ga0070717_10096763 Ga0070717_100967631 393
34 3300031251 Ga0265327_10029384 Ga0265327_100293842 393
35 3300035398 Ga0316574_0140967 Ga0316574_0140967_281_1465 393
36 3300053117 Ga0500593_035358 Ga0500593_035358_171_1376 393
37 3300053139 Ga0500568_0000124 Ga0500568_0000124_44897_46099 393
38 3300054114 Ga0501084_0063808 Ga0501084_0063808_42_1256 393
39 iso_pu_bacteria 2554235005 2554259472 393
40 iso_pu_bacteria 2582581312 2585302008 393
41 iso_pu_bacteria 2582581314 2585321075 393
42 iso_pu_bacteria 2616644814 2616695704 393
43 iso_pu_bacteria 2643221578 2643904555 393
44 iso_pu_bacteria 2643221601 2644019206 393
45 iso_pu_bacteria 2643221616 2644095148 393
46 iso_pu_bacteria 2643221631 2644174112 393
47 iso_pu_bacteria 2643221673 2644406179 393
48 iso_pu_bacteria 2751185734 2753076170 393
49 iso_pu_bacteria 2751185788 2753303407 393
50 iso_pu_bacteria 2775506925 2776370698 393
51 iso_pu_bacteria 2791355406 2793983469 393
52 iso_pu_bacteria 2808606982 2811847040 393
53 iso_pu_bacteria 2811994917 2812482300 393
54 iso_pu_bacteria 2818991472 2819739146 393
55 iso_pu_bacteria 2844852863 2844856559 393
56 iso_pu_bacteria 2862507626 2862510485 393
57 iso_pu_bacteria 2862705112 2862706808 393
58 iso_pu_bacteria 2863067949 2863072248 393
59 iso_pu_bacteria 2867346516 2867346895 393
60 iso_pu_bacteria 2867369537 2867369926 393
61 iso_pu_bacteria 2867475112 2867480854 393
62 iso_pu_bacteria 2870622029 2870622737 393
63 iso_pu_bacteria 2870721527 2870726152 393
64 iso_pu_bacteria 2875391855 2875392761 393
65 iso_pu_bacteria 2884763398 2884764545 393
66 iso_pu_bacteria 2891326441 2891327154 393
67 iso_pu_bacteria 2912715099 2912722325 393
68 iso_pu_bacteria 2912757875 2912758959 393
69 iso_pu_bacteria 2919042368 2919046180 393
70 iso_pu_bacteria 2928104781 2928106968 393
71 iso_pu_bacteria 2935390628 2935394777 393
72 iso_pu_bacteria 2939660829 2939663719 393
73 iso_pu_bacteria 2946045630 2946051954 393
74 iso_pu_bacteria 2947224130 2947231749 393
75 iso_pu_bacteria 2954002825 2954011001 393
76 iso_pu_bacteria 2966924647 2966927682 393
77 iso_pu_bacteria 2984551494 2984551711 393
78 iso_pu_bacteria 2990044586 2990050098 393
79 iso_pu_bacteria 2990059506 2990061429 393
80 iso_pu_bacteria 2990088156 2990092041 393
81 iso_pu_bacteria 2997451912 2997454832 393
82 iso_pu_bacteria 2997600082 2997605605 393
83 iso_pu_bacteria 3006321560 3006327930 393
84 iso_pu_bacteria 3006393351 3006399468 393
85 iso_pu_bacteria 3006425503 3006430613 393
86 iso_pu_bacteria 8008485437 8008486503 393
87 iso_pu_bacteria 8008574985 8008580681 393
88 iso_pu_bacteria 8025478263 8025481225 393
89 iso_pu_bacteria 8025524527 8025525572 393
90 iso_pu_bacteria 8025530807 8025531020 393
91 iso_pu_bacteria 8033684223 8033688272 393
92 iso_pu_bacteria 8047893842 8047894932 393
93 iso_pu_bacteria 8048127548 8048130482 393
94 iso_pu_bacteria 8048356638 8048364118 393
95 iso_pu_bacteria 8048369669 8048371950 393
96 iso_pu_bacteria 8048379754 8048380884 393
97 iso_pu_bacteria 8056447290 8056449305 393
98 iso_pu_bacteria 8056667051 8056670177 393
99 iso_pu_bacteria 8056829672 8056835631 393
100 3300006042 Ga0075368_10054756 Ga0075368_100547561 394
101 3300006051 Ga0075364_10004377 Ga0075364_100043773 394
102 3300006051 Ga0075364_10020109 Ga0075364_100201092 394
103 3300006178 Ga0075367_10040651 Ga0075367_100406512 394
104 3300031727 Ga0316576_10017551 Ga0316576_100175513 394
105 3300031728 Ga0316578_10036615 Ga0316578_100366152 394
106 3300031728 Ga0316578_10081290 Ga0316578_100812902 394
107 3300032126 Ga0307415_100052500 Ga0307415_1000525003 394
108 3300032139 Ga0316580_10016328 Ga0316580_100163282 394
109 3300035398 Ga0316574_0006815 Ga0316574_0006815_3138_4370 394
110 3300036712 Ga0316584_0033039 Ga0316584_0033039_2567_3799 394
111 3300048908 Ga0496105_0187822 Ga0496105_0187822_31_1242 394
112 3300049573 Ga0501037_0047486 Ga0501037_0047486_1903_3093 394
113 3300049574 Ga0501038_0061692 Ga0501038_0061692_558_1748 394
114 3300053151 Ga0500604_0013291 Ga0500604_0013291_568_1776 394
115 iso_pu_bacteria 2515154155 2515851904 394
116 iso_pu_bacteria 2523231044 2523383290 394
117 iso_pu_bacteria 2565956761 2566997442 394
118 iso_pu_bacteria 2675903058 2676476047 394
119 iso_pu_bacteria 2738541264 2738664986 394
120 iso_pu_bacteria 2738541308 2738886690 394
121 iso_pu_bacteria 2738541356 2739144120 394
122 iso_pu_bacteria 2738543005 2739203829 394
123 iso_pu_bacteria 2738543011 2739239384 394
124 iso_pu_bacteria 2827628540 2827630609 394
125 iso_pu_bacteria 2889300758 2889301981 394
126 iso_pu_bacteria 2895427314 2895429234 394
127 iso_pu_bacteria 2899370129 2899375434 394
128 iso_pu_bacteria 2904535858 2904540346 394
129 iso_pu_bacteria 2904765812 2904769221 394
130 iso_pu_bacteria 2904770941 2904776331 394
131 iso_pu_bacteria 2908811453 2908814417 394
132 iso_pu_bacteria 2919420072 2919422858 394
133 iso_pu_bacteria 2919432681 2919434889 394
134 iso_pu_bacteria 2922554459 2922556375 394
135 iso_pu_bacteria 2928142448 2928147267 394
136 iso_pu_bacteria 2932398195 2932398928 394
137 iso_pu_bacteria 2939743619 2939748198 394
138 iso_pu_bacteria 3002998708 3003002251 394
139 iso_pu_bacteria 8055066027 8055068480 394
140 iso_pu_bacteria 8055172936 8055181034 394
141 iso_pu_bacteria 8056060235 8056066074 394
142 iso_pu_bacteria 8057568493 8057568517 394
143 3300005719 Ga0068861_100106931 Ga0068861_1001069313 395
144 3300005981 Ga0081538_10038909 Ga0081538_100389092 395
145 3300025927 Ga0207687_10001526 Ga0207687_100015261 395
146 3300025928 Ga0207700_10209218 Ga0207700_102092182 395
147 3300045049 Ga0466959_0032930 Ga0466959_0032930_1019_2209 395
148 3300048920 Ga0496117_0057954 Ga0496117_0057954_1245_2441 395
149 3300049571 Ga0501034_0000543 Ga0501034_0000543_6742_7944 395
150 3300049571 Ga0501034_0065426 Ga0501034_0065426_316_1521 395
151 3300049572 Ga0501036_0149485 Ga0501036_0149485_580_1785 395
152 3300049577 Ga0501041_0043969 Ga0501041_0043969_390_1595 395
153 3300049582 Ga0501048_0143518 Ga0501048_0143518_106_1311 395
154 3300049582 Ga0501048_0251248 Ga0501048_0251248_20_1222 395
155 3300049586 Ga0501070_0047700 Ga0501070_0047700_2138_3343 395
156 3300049587 Ga0501071_0032295 Ga0501071_0032295_2503_3705 395
157 3300049592 Ga0501076_0001496 Ga0501076_0001496_7032_8237 395
158 3300049743 Ga0501081_0011062 Ga0501081_0011062_3141_4346 395
159 3300049744 Ga0501083_0186096 Ga0501083_0186096_60_1265 395
160 3300049824 Ga0501045_0039028 Ga0501045_0039028_660_1865 395
161 3300054114 Ga0501084_0126504 Ga0501084_0126504_800_2005 395
162 3300054114 Ga0501084_0237061 Ga0501084_0237061_84_1286 395
163 iso_pu_bacteria 2501939600 2501942824 395
164 iso_pu_bacteria 2506783011 2506867832 395
165 iso_pu_bacteria 2515154088 2515494912 395
166 iso_pu_bacteria 2515154129 2515718916 395
167 iso_pu_bacteria 2515154137 2515755575 395
168 iso_pu_bacteria 2515154202 2516083128 395
169 iso_pu_bacteria 2515154203 2516090214 395
170 iso_pu_bacteria 2527291627 2528205551 395
171 iso_pu_bacteria 2527291629 2528214972 395
172 iso_pu_bacteria 2546825537 2546950328 395
173 iso_pu_bacteria 2558860112 2558914157 395
174 iso_pu_bacteria 2576861822 2579750244 395
175 iso_pu_bacteria 2579778521 2579856475 395
176 iso_pu_bacteria 2619618881 2619858079 395
177 iso_pu_bacteria 2619619003 2620352616 395
178 iso_pu_bacteria 2622736605 2623501119 395
179 iso_pu_bacteria 2622736626 2623588025 395
180 iso_pu_bacteria 2626541554 2626639665 395
181 iso_pu_bacteria 2643221690 2644506432 395
182 iso_pu_bacteria 2643221694 2644526650 395
183 iso_pu_bacteria 2643221715 2644636685 395
184 iso_pu_bacteria 2643221722 2644671316 395
185 iso_pu_bacteria 2671180195 2671839072 395
186 iso_pu_bacteria 2675903059 2676487337 395
187 iso_pu_bacteria 2684623035 2686537797 395
188 iso_pu_bacteria 2684623036 2686543134 395
189 iso_pu_bacteria 2687453743 2689991648 395
190 iso_pu_bacteria 2710264753 2710603810 395
191 iso_pu_bacteria 2731639228 2731907033 395
192 iso_pu_bacteria 2744054611 2744954612 395
193 iso_pu_bacteria 2773857922 2774857228 395
194 iso_pu_bacteria 2773857924 2774866103 395
195 iso_pu_bacteria 2773857933 2774904260 395
196 iso_pu_bacteria 2808606370 2808890684 395
197 iso_pu_bacteria 2808606700 2810363513 395
198 iso_pu_bacteria 2811994880 2812365412 395
199 iso_pu_bacteria 2839986021 2839989531 395
200 iso_pu_bacteria 2844849076 2844852307 395
201 iso_pu_bacteria 2855676851 2855681951 395
202 iso_pu_bacteria 2855683550 2855686874 395
203 iso_pu_bacteria 2856858025 2856862049 395
204 iso_pu_bacteria 2857288857 2857289182 395
205 iso_pu_bacteria 2857740372 2857743804 395
206 iso_pu_bacteria 2858848962 2858850004 395
207 iso_pu_bacteria 2858868258 2858874904 395
208 iso_pu_bacteria 2858882152 2858883484 395
209 iso_pu_bacteria 2858888857 2858891979 395
210 iso_pu_bacteria 2858895516 2858899339 395
211 iso_pu_bacteria 2858902515 2858907845 395
212 iso_pu_bacteria 2861520306 2861527631 395
213 iso_pu_bacteria 2867302475 2867307773 395
214 iso_pu_bacteria 2867312974 2867319094 395
215 iso_pu_bacteria 2867319477 2867320099 395
216 iso_pu_bacteria 2869048445 2869051888 395
217 iso_pu_bacteria 2869061728 2869067946 395
218 iso_pu_bacteria 2869068681 2869073443 395
219 iso_pu_bacteria 2880489317 2880492030 395
220 iso_pu_bacteria 2880495981 2880500262 395
221 iso_pu_bacteria 2884994152 2884995185 395
222 iso_pu_bacteria 2895880812 2895888739 395
223 iso_pu_bacteria 2899359706 2899368037 395
224 iso_pu_bacteria 2902582711 2902586652 395
225 iso_pu_bacteria 2902810491 2902811851 395
226 iso_pu_bacteria 2904497146 2904499703 395
227 iso_pu_bacteria 2904776348 2904780360 395
228 iso_pu_bacteria 2905926851 2905927707 395
229 iso_pu_bacteria 2905926851 2905929264 395
230 iso_pu_bacteria 2905926851 2905930281 395
231 iso_pu_bacteria 2910809715 2910814860 395
232 iso_pu_bacteria 2912723979 2912726037 395
233 iso_pu_bacteria 2919034639 2919036156 395
234 iso_pu_bacteria 2919051321 2919053168 395
235 iso_pu_bacteria 2919059106 2919060871 395
236 iso_pu_bacteria 2919391150 2919392436 395
237 iso_pu_bacteria 2919538618 2919538626 395
238 iso_pu_bacteria 2929219909 2929222155 395
239 iso_pu_bacteria 2929226422 2929228820 395
240 iso_pu_bacteria 2932426870 2932431103 395
241 iso_pu_bacteria 2932431166 2932433655 395
242 iso_pu_bacteria 2933418574 2933419213 395
243 iso_pu_bacteria 2939647034 2939647868 395
244 iso_pu_bacteria 2939674588 2939679070 395
245 iso_pu_bacteria 2945920336 2945924525 395
246 iso_pu_bacteria 2945941187 2945943739 395
247 iso_pu_bacteria 2945956166 2945958072 395
248 iso_pu_bacteria 2946003308 2946004070 395
249 iso_pu_bacteria 2946037020 2946039708 395
250 iso_pu_bacteria 2953998280 2954000932 395
251 iso_pu_bacteria 2974302888 2974303208 395
252 iso_pu_bacteria 2996221748 2996227977 395
253 iso_pu_bacteria 3006486233 3006491715 395
254 iso_pu_bacteria 637000116 637880493 395
255 iso_pu_bacteria 649633069 649812648 395
256 iso_pu_bacteria 8003830390 8003835703 395
257 iso_pu_bacteria 8003856774 8003858503 395
258 iso_pu_bacteria 8004025490 8004026160 395
259 iso_pu_bacteria 8053945823 8053947878 395
260 iso_pu_bacteria 8054107350 8054110003 395
261 iso_pu_bacteria 8054704163 8054706813 395
262 iso_pu_bacteria 8054727385 8054730850 395
263 iso_pu_bacteria 8054734606 8054738895 395
264 iso_pu_bacteria 8054913762 8054914099 395
265 iso_pu_bacteria 8054920844 8054922895 395
266 iso_pu_bacteria 8055157932 8055162372 395
267 iso_pu_bacteria 8055412473 8055412800 395
268 3300005354 Ga0070675_100245660 Ga0070675_1002456601 396
269 3300005366 Ga0070659_100006799 Ga0070659_1000067997 396
270 3300005466 Ga0070685_10019605 Ga0070685_100196053 396
271 3300005539 Ga0068853_100008631 Ga0068853_1000086314 396
272 3300005539 Ga0068853_100127831 Ga0068853_1001278312 396
273 3300005543 Ga0070672_100104720 Ga0070672_1001047202 396
274 3300005563 Ga0068855_100012387 Ga0068855_1000123877 396
275 3300005563 Ga0068855_100039520 Ga0068855_1000395204 396
276 3300005617 Ga0068859_100038886 Ga0068859_1000388863 396
277 3300005842 Ga0068858_100000175 Ga0068858_10000017562 396
278 3300005937 Ga0081455_10005347 Ga0081455_100053472 396
279 3300006038 Ga0075365_10213262 Ga0075365_102132622 396
280 3300006852 Ga0075433_10189043 Ga0075433_101890432 396
281 3300006914 Ga0075436_100085986 Ga0075436_1000859862 396
282 3300006931 Ga0097620_100038886 Ga0097620_1000388863 396
283 3300007076 Ga0075435_100189592 Ga0075435_1001895921 396
284 3300009098 Ga0105245_10083844 Ga0105245_100838442 396
285 3300009101 Ga0105247_10038821 Ga0105247_100388212 396
286 3300009147 Ga0114129_10074178 Ga0114129_100741783 396
287 3300009177 Ga0105248_10003147 Ga0105248_100031478 396
288 3300013296 Ga0157374_10186409 Ga0157374_101864092 396
289 3300013296 Ga0157374_10191161 Ga0157374_101911612 396
290 3300013306 Ga0163162_10145440 Ga0163162_101454403 396
291 3300014968 Ga0157379_10202568 Ga0157379_102025682 396
292 3300021388 Ga0213875_10000455 Ga0213875_1000045531 396
293 3300025900 Ga0207710_10051974 Ga0207710_100519742 396
294 3300025912 Ga0207707_10016166 Ga0207707_100161664 396
295 3300025913 Ga0207695_10005261 Ga0207695_100052615 396
296 3300025927 Ga0207687_10070166 Ga0207687_100701662 396
297 3300025932 Ga0207690_10018486 Ga0207690_100184863 396
298 3300025935 Ga0207709_10032863 Ga0207709_100328632 396
299 3300025937 Ga0207669_10042240 Ga0207669_100422403 396
300 3300025940 Ga0207691_10227457 Ga0207691_102274572 396
301 3300025941 Ga0207711_10001834 Ga0207711_1000183410 396
302 3300025949 Ga0207667_10005915 Ga0207667_1000591510 396
303 3300025949 Ga0207667_10012713 Ga0207667_100127136 396
304 3300025949 Ga0207667_10027909 Ga0207667_100279092 396
305 3300025949 Ga0207667_10038335 Ga0207667_100383352 396
306 3300026035 Ga0207703_10000131 Ga0207703_100001319 396
307 3300026041 Ga0207639_10130697 Ga0207639_101306972 396
308 3300026078 Ga0207702_10044872 Ga0207702_100448722 396
309 3300026088 Ga0207641_10126696 Ga0207641_101266961 396
310 3300026089 Ga0207648_10058974 Ga0207648_100589743 396
311 3300031548 Ga0307408_100064742 Ga0307408_1000647422 396
312 3300032002 Ga0307416_100270491 Ga0307416_1002704912 396
313 3300037312 Ga0395899_0049908 Ga0395899_0049908_130_1335 396
314 3300037418 Ga0395900_0079080 Ga0395900_0079080_1107_2312 396
315 3300037853 Ga0436364_0238472 Ga0436364_0238472_30509_31723 396
316 3300038443 Ga0395901_0209072 Ga0395901_0209072_123_1328 396
317 3300041406 Ga0439439_0003804 Ga0439439_0003804_667_1872 396
318 3300041999 Ga0439433_0005084 Ga0439433_0005084_323_1528 396
319 3300042002 Ga0439442_006494 Ga0439442_006494_145_1350 396
320 3300042435 Ga0439434_0018559 Ga0439434_0018559_409_1614 396
321 3300044684 Ga0466966_0006470 Ga0466966_0006470_5107_6321 396
322 3300044694 Ga0466963_0002782 Ga0466963_0002782_4985_6199 396
323 3300044765 Ga0466970_0007660 Ga0466970_0007660_584_1798 396
324 3300045049 Ga0466959_0022208 Ga0466959_0022208_1908_3122 396
325 3300045836 Ga0466958_0000114 Ga0466958_0000114_21167_22381 396
326 3300045836 Ga0466958_0035027 Ga0466958_0035027_576_1808 396
327 3300046457 Ga0495590_0000484 Ga0495590_0000484_10554_11747 396
328 3300047320 Ga0495672_0041850 Ga0495672_0041850_1340_2533 396
329 3300048929 Ga0496126_0084982 Ga0496126_0084982_1581_2774 396
330 3300049571 Ga0501034_0018586 Ga0501034_0018586_4814_6007 396
331 3300049571 Ga0501034_0123536 Ga0501034_0123536_296_1489 396
332 3300049571 Ga0501034_0417429 Ga0501034_0417429_13_1206 396
333 3300049578 Ga0501042_0058123 Ga0501042_0058123_641_1864 396
334 3300049583 Ga0501067_0008668 Ga0501067_0008668_1587_2801 396
335 3300049583 Ga0501067_0032390 Ga0501067_0032390_746_1975 396
336 3300050511 nmdc:mga08y16_85139_c1 nmdc:mga08y16_85139_c1_845_2053 396
337 3300053093 Ga0500651_0001689 Ga0500651_0001689_3251_4444 396
338 3300053139 Ga0500568_0019851 Ga0500568_0019851_1106_2299 396
339 3300053139 Ga0500568_0033263 Ga0500568_0033263_30_1223 396
340 3300053147 Ga0500589_052185 Ga0500589_052185_358_1569 396
341 3300053148 Ga0500590_001918 Ga0500590_001918_4780_5973 396
342 3300053153 Ga0500616_0002004 Ga0500616_0002004_6939_8132 396
343 3300059424 Ga0590075_004557 Ga0590075_004557_528_1733 396
344 3300061719 Ga0466962_0003093 Ga0466962_0003093_3017_4231 396
345 iso_pu_bacteria 2547132424 2548694814 396
346 iso_pu_bacteria 2551306166 2552107491 396
347 iso_pu_bacteria 2643221687 2644488693 396
348 iso_pu_bacteria 2643221692 2644518138 396
349 iso_pu_bacteria 2738541274 2738708135 396
350 iso_pu_bacteria 2738543028 2739334712 396
351 iso_pu_bacteria 2842134933 2842137806 396
352 iso_pu_bacteria 2868088558 2868094364 396
353 iso_pu_bacteria 2902792274 2902795775 396
354 iso_pu_bacteria 2902799365 2902803821 396
355 iso_pu_bacteria 2902837492 2902838577 396
356 iso_pu_bacteria 2919713450 2919718922 396
357 iso_pu_bacteria 2929212328 2929215655 396
358 iso_pu_bacteria 2956939328 2956941213 396
359 iso_pu_bacteria 2984523437 2984526003 396
360 iso_pu_bacteria 3001119090 3001120351 396
361 3300002772 JGI25164J39214_1000515 JGI25164J39214_100051513 397
362 3300003214 JGI25165J46597_1000044 JGI25165J46597_100004453 397
363 3300005329 Ga0070683_100002759 Ga0070683_1000027592 397
364 3300005458 Ga0070681_10033991 Ga0070681_100339914 397
365 3300005539 Ga0068853_100047185 Ga0068853_1000471852 397
366 3300005548 Ga0070665_100054549 Ga0070665_1000545493 397
367 3300005549 Ga0070704_100076065 Ga0070704_1000760651 397
368 3300005563 Ga0068855_100034580 Ga0068855_1000345805 397
369 3300005563 Ga0068855_100164286 Ga0068855_1001642863 397
370 3300005577 Ga0068857_100012484 Ga0068857_1000124847 397
371 3300005614 Ga0068856_100188635 Ga0068856_1001886353 397
372 3300005616 Ga0068852_100018879 Ga0068852_1000188791 397
373 3300005834 Ga0068851_10000124 Ga0068851_100001242 397
374 3300006038 Ga0075365_10043570 Ga0075365_100435702 397
375 3300006844 Ga0075428_100000416 Ga0075428_1000004169 397
376 3300006846 Ga0075430_100000876 Ga0075430_10000087619 397
377 3300009011 Ga0105251_10015488 Ga0105251_100154882 397
378 3300009093 Ga0105240_10023577 Ga0105240_100235776 397
379 3300009093 Ga0105240_10033631 Ga0105240_100336313 397
380 3300009098 Ga0105245_10040683 Ga0105245_100406832 397
381 3300009174 Ga0105241_10000211 Ga0105241_100002114 397
382 3300009177 Ga0105248_10025426 Ga0105248_100254267 397
383 3300009545 Ga0105237_10048489 Ga0105237_100484895 397
384 3300009545 Ga0105237_10247190 Ga0105237_102471902 397
385 3300009551 Ga0105238_10199854 Ga0105238_101998541 397
386 3300010375 Ga0105239_10213248 Ga0105239_102132481 397
387 3300013104 Ga0157370_10024520 Ga0157370_100245202 397
388 3300013105 Ga0157369_10003610 Ga0157369_1000361012 397
389 3300013105 Ga0157369_10015580 Ga0157369_100155805 397
390 3300013105 Ga0157369_10095834 Ga0157369_100958343 397
391 3300013105 Ga0157369_10156750 Ga0157369_101567502 397
392 3300013307 Ga0157372_10465758 Ga0157372_104657582 397
393 3300014325 Ga0163163_10009670 Ga0163163_100096706 397
394 3300021388 Ga0213875_10011610 Ga0213875_100116102 397
395 3300025231 Ga0207427_100126 Ga0207427_10012646 397
396 3300025233 Ga0209437_100585 Ga0209437_10058522 397
397 3300025254 Ga0209148_1004143 Ga0209148_10041432 397
398 3300025261 Ga0209233_1000014 Ga0209233_100001452 397
399 3300025321 Ga0207656_10000001 Ga0207656_1000000112 397
400 3300025321 Ga0207656_10000003 Ga0207656_10000003118 397
401 3300025909 Ga0207705_10050987 Ga0207705_100509873 397
402 3300025910 Ga0207684_10085908 Ga0207684_100859083 397
403 3300025911 Ga0207654_10000003 Ga0207654_10000003317 397
404 3300025912 Ga0207707_10022717 Ga0207707_100227172 397
405 3300025913 Ga0207695_10009600 Ga0207695_100096009 397
406 3300025913 Ga0207695_10035988 Ga0207695_100359884 397
407 3300025914 Ga0207671_10000001 Ga0207671_1000000110 397
408 3300025914 Ga0207671_10047284 Ga0207671_100472841 397
409 3300025924 Ga0207694_10005422 Ga0207694_100054223 397
410 3300025927 Ga0207687_10024987 Ga0207687_100249873 397
411 3300025941 Ga0207711_10129430 Ga0207711_101294301 397
412 3300025944 Ga0207661_10001731 Ga0207661_100017312 397
413 3300025949 Ga0207667_10027190 Ga0207667_100271905 397
414 3300025949 Ga0207667_10137161 Ga0207667_101371612 397
415 3300026041 Ga0207639_10019729 Ga0207639_100197293 397
416 3300026078 Ga0207702_10118513 Ga0207702_101185132 397
417 3300026116 Ga0207674_10009940 Ga0207674_100099405 397
418 3300026142 Ga0207698_10003180 Ga0207698_100031807 397
419 3300026142 Ga0207698_10079070 Ga0207698_100790701 397
420 3300028379 Ga0268266_10031295 Ga0268266_100312953 397
421 3300028380 Ga0268265_10084439 Ga0268265_100844392 397
422 3300030521 Ga0307511_10106788 Ga0307511_101067881 397
423 3300030522 Ga0307512_10005170 Ga0307512_1000517013 397
424 3300030522 Ga0307512_10020281 Ga0307512_100202816 397
425 3300030522 Ga0307512_10047890 Ga0307512_100478902 397
426 3300031616 Ga0307508_10007864 Ga0307508_100078648 397
427 3300031616 Ga0307508_10074409 Ga0307508_100744091 397
428 3300031649 Ga0307514_10040454 Ga0307514_100404542 397
429 3300031649 Ga0307514_10082332 Ga0307514_100823322 397
430 3300031665 Ga0316575_10063963 Ga0316575_100639632 397
431 3300031727 Ga0316576_10000511 Ga0316576_1000051115 397
432 3300031728 Ga0316578_10105522 Ga0316578_101055222 397
433 3300031730 Ga0307516_10003100 Ga0307516_1000310016 397
434 3300031733 Ga0316577_10056287 Ga0316577_100562872 397
435 3300031838 Ga0307518_10048571 Ga0307518_100485712 397
436 3300031901 Ga0307406_10083514 Ga0307406_100835142 397
437 3300032133 Ga0316583_10010209 Ga0316583_100102094 397
438 3300033180 Ga0307510_10008263 Ga0307510_100082638 397
439 3300037466 Ga0395898_0115035 Ga0395898_0115035_27_1241 397
440 3300037466 Ga0395898_0324087 Ga0395898_0324087_262_1458 397
441 3300037853 Ga0436364_0113323 Ga0436364_0113323_2436_3644 397
442 3300038443 Ga0395901_0054233 Ga0395901_0054233_2288_3484 397
443 3300038443 Ga0395901_0161745 Ga0395901_0161745_623_1819 397
444 3300041512 Ga0451853_0988203 Ga0451853_0988203_602_1795 397
445 3300042006 Ga0439432_027337 Ga0439432_027337_101_1297 397
446 3300044683 Ga0466965_0027934 Ga0466965_0027934_1084_2301 397
447 3300044684 Ga0466966_0012176 Ga0466966_0012176_541_1758 397
448 3300044693 Ga0466961_0000223 Ga0466961_0000223_31349_32566 397
449 3300044693 Ga0466961_0019719 Ga0466961_0019719_2377_3573 397
450 3300044693 Ga0466961_0162785 Ga0466961_0162785_61_1260 397
451 3300044694 Ga0466963_0000604 Ga0466963_0000604_502_1719 397
452 3300044694 Ga0466963_0104315 Ga0466963_0104315_450_1646 397
453 3300044719 Ga0466971_0000354 Ga0466971_0000354_906_2123 397
454 3300044719 Ga0466971_0023917 Ga0466971_0023917_783_2012 397
455 3300044735 Ga0466968_0001034 Ga0466968_0001034_2106_3323 397
456 3300044765 Ga0466970_0007113 Ga0466970_0007113_3972_5189 397
457 3300044842 Ga0466957_0000283 Ga0466957_0000283_2021_3238 397
458 3300045049 Ga0466959_0013261 Ga0466959_0013261_1057_2253 397
459 3300045049 Ga0466959_0040799 Ga0466959_0040799_1696_2916 397
460 3300045049 Ga0466959_0045121 Ga0466959_0045121_991_2208 397
461 3300045836 Ga0466958_0007421 Ga0466958_0007421_4274_5491 397
462 3300045976 Ga0466967_0001120 Ga0466967_0001120_541_1758 397
463 3300045976 Ga0466967_0024332 Ga0466967_0024332_81_1298 397
464 3300046453 Ga0495627_039472 Ga0495627_039472_224_1438 397
465 3300046453 Ga0495627_046758 Ga0495627_046758_48_1265 397
466 3300046454 Ga0495592_0064496 Ga0495592_0064496_214_1407 397
467 3300046455 Ga0495603_0000552 Ga0495603_0000552_18932_20146 397
468 3300046455 Ga0495603_0013090 Ga0495603_0013090_2275_3468 397
469 3300046455 Ga0495603_0054857 Ga0495603_0054857_883_2076 397
470 3300046459 Ga0495629_0001228 Ga0495629_0001228_6660_7853 397
471 3300046459 Ga0495629_0014332 Ga0495629_0014332_4016_5209 397
472 3300046460 Ga0495638_0040952 Ga0495638_0040952_907_2100 397
473 3300046474 Ga0495605_0004092 Ga0495605_0004092_6211_7425 397
474 3300046475 Ga0495639_0016313 Ga0495639_0016313_1031_2245 397
475 3300046492 Ga0495585_0024459 Ga0495585_0024459_240_1457 397
476 3300046499 Ga0495594_0000581 Ga0495594_0000581_10071_11264 397
477 3300046501 Ga0495607_0035772 Ga0495607_0035772_158_1351 397
478 3300046506 Ga0495583_0039585 Ga0495583_0039585_656_1849 397
479 3300046513 Ga0495616_0007512 Ga0495616_0007512_4751_5944 397
480 3300046516 Ga0495628_0030926 Ga0495628_0030926_2320_3513 397
481 3300046518 Ga0495631_0028018 Ga0495631_0028018_429_1622 397
482 3300046519 Ga0495632_0105050 Ga0495632_0105050_38_1231 397
483 3300046520 Ga0495637_0034811 Ga0495637_0034811_954_2147 397
484 3300046522 Ga0495643_0003144 Ga0495643_0003144_6545_7738 397
485 3300046524 Ga0495648_0057527 Ga0495648_0057527_548_1741 397
486 3300046526 Ga0495666_0019999 Ga0495666_0019999_2099_3292 397
487 3300046538 Ga0495609_0011345 Ga0495609_0011345_1795_2988 397
488 3300046543 Ga0495645_0019225 Ga0495645_0019225_1968_3167 397
489 3300046557 Ga0495622_0008572 Ga0495622_0008572_815_2008 397
490 3300046557 Ga0495622_0019863 Ga0495622_0019863_1862_3055 397
491 3300046558 Ga0495633_0006910 Ga0495633_0006910_2473_3687 397
492 3300046648 Ga0495611_0016203 Ga0495611_0016203_63_1256 397
493 3300046674 Ga0495588_0040447 Ga0495588_0040447_182_1375 397
494 3300046675 Ga0495657_0029164 Ga0495657_0029164_2261_3475 397
495 3300046679 Ga0495623_0050024 Ga0495623_0050024_1335_2543 397
496 3300046689 Ga0495613_0009856 Ga0495613_0009856_4906_6120 397
497 3300046689 Ga0495613_0027353 Ga0495613_0027353_2154_3368 397
498 3300046689 Ga0495613_0032534 Ga0495613_0032534_2450_3664 397
499 3300046690 Ga0495624_0058068 Ga0495624_0058068_618_1811 397
500 3300046794 Ga0495589_0032868 Ga0495589_0032868_493_1707 397
501 3300047317 Ga0495604_0003057 Ga0495604_0003057_48_1256 397
502 3300047317 Ga0495604_0038371 Ga0495604_0038371_2157_3371 397
503 3300047317 Ga0495604_0052981 Ga0495604_0052981_1380_2576 397
504 3300047321 Ga0495676_0000233 Ga0495676_0000233_27665_28879 397
505 3300047321 Ga0495676_0005210 Ga0495676_0005210_3174_4367 397
506 3300047321 Ga0495676_0017972 Ga0495676_0017972_3276_4469 397
507 3300047323 Ga0495683_0041213 Ga0495683_0041213_72_1265 397
508 3300047443 Ga0495687_000581 Ga0495687_000581_15885_17114 397
509 3300047444 Ga0495675_0015106 Ga0495675_0015106_3450_4658 397
510 3300047447 Ga0495685_012532 Ga0495685_012532_988_2202 397
511 3300047472 Ga0495686_0092934 Ga0495686_0092934_290_1504 397
512 3300048089 Ga0495614_0006858 Ga0495614_0006858_1584_2798 397
513 3300048905 Ga0496102_0202009 Ga0496102_0202009_292_1488 397
514 3300048908 Ga0496105_0036004 Ga0496105_0036004_2806_4005 397
515 3300048911 Ga0496108_0125407 Ga0496108_0125407_94_1287 397
516 3300048918 Ga0496115_0020283 Ga0496115_0020283_1492_2691 397
517 3300048920 Ga0496117_0002301 Ga0496117_0002301_19225_20421 397
518 3300048920 Ga0496117_0029473 Ga0496117_0029473_925_2121 397
519 3300048921 Ga0496118_0000398 Ga0496118_0000398_67984_69180 397
520 3300048921 Ga0496118_0072819 Ga0496118_0072819_18_1214 397
521 3300048922 Ga0496119_0018886 Ga0496119_0018886_371_1567 397
522 3300048923 Ga0496120_0004273 Ga0496120_0004273_3524_4720 397
523 3300048923 Ga0496120_0011458 Ga0496120_0011458_1491_2687 397
524 3300048925 Ga0496122_0099743 Ga0496122_0099743_361_1557 397
525 3300048926 Ga0496123_0088077 Ga0496123_0088077_429_1625 397
526 3300048927 Ga0496124_0000198 Ga0496124_0000198_113819_115015 397
527 3300048927 Ga0496124_0007726 Ga0496124_0007726_5737_6933 397
528 3300049570 Ga0501033_0027710 Ga0501033_0027710_16_1209 397
529 3300049571 Ga0501034_0022037 Ga0501034_0022037_185_1393 397
530 3300049571 Ga0501034_0080618 Ga0501034_0080618_1518_2714 397
531 3300049571 Ga0501034_0123811 Ga0501034_0123811_185_1393 397
532 3300049571 Ga0501034_0303310 Ga0501034_0303310_73_1284 397
533 3300049572 Ga0501036_0024970 Ga0501036_0024970_2630_3844 397
534 3300049573 Ga0501037_0068478 Ga0501037_0068478_169_1392 397
535 3300049573 Ga0501037_0126288 Ga0501037_0126288_542_1738 397
536 3300049574 Ga0501038_0099827 Ga0501038_0099827_326_1540 397
537 3300049574 Ga0501038_0197175 Ga0501038_0197175_354_1565 397
538 3300049575 Ga0501039_0009678 Ga0501039_0009678_3454_4668 397
539 3300049578 Ga0501042_0110801 Ga0501042_0110801_10_1221 397
540 3300049579 Ga0501043_0013569 Ga0501043_0013569_4176_5390 397
541 3300049579 Ga0501043_0024460 Ga0501043_0024460_3361_4572 397
542 3300049579 Ga0501043_0043569 Ga0501043_0043569_1347_2555 397
543 3300049579 Ga0501043_0052392 Ga0501043_0052392_1450_2646 397
544 3300049581 Ga0501047_0000268 Ga0501047_0000268_29349_30572 397
545 3300049581 Ga0501047_0027020 Ga0501047_0027020_2505_3716 397
546 3300049581 Ga0501047_0087040 Ga0501047_0087040_529_1725 397
547 3300049585 Ga0501069_0038097 Ga0501069_0038097_656_1870 397
548 3300049586 Ga0501070_0000925 Ga0501070_0000925_10535_11749 397
549 3300049586 Ga0501070_0042137 Ga0501070_0042137_1599_2807 397
550 3300049587 Ga0501071_0000938 Ga0501071_0000938_6196_7404 397
551 3300049589 Ga0501073_0000024 Ga0501073_0000024_12090_13286 397
552 3300049590 Ga0501074_0002652 Ga0501074_0002652_6165_7379 397
553 3300049742 Ga0501080_0006153 Ga0501080_0006153_7807_9003 397
554 3300049742 Ga0501080_0258973 Ga0501080_0258973_218_1414 397
555 3300049822 Ga0501035_0003186 Ga0501035_0003186_125_1339 397
556 3300049822 Ga0501035_0023019 Ga0501035_0023019_2051_3247 397
557 3300049823 Ga0501044_0043045 Ga0501044_0043045_1726_2943 397
558 3300049823 Ga0501044_0066591 Ga0501044_0066591_152_1375 397
559 3300049823 Ga0501044_0089672 Ga0501044_0089672_470_1681 397
560 3300050491 nmdc:mga00v17_37721_c1 nmdc:mga00v17_37721_c1_1377_2573 397
561 3300050509 nmdc:mga0qj67_695_c1 nmdc:mga0qj67_695_c1_8646_9905 397
562 3300050510 nmdc:mga06r32_261812_c1 nmdc:mga06r32_261812_c1_143_1336 397
563 3300053087 Ga0500643_000189 Ga0500643_000189_30139_31335 397
564 3300053102 Ga0500554_006511 Ga0500554_006511_1356_2552 397
565 3300053104 Ga0500556_0000062 Ga0500556_0000062_101075_102271 397
566 3300053136 Ga0500559_0000868 Ga0500559_0000868_14865_16064 397
567 3300053136 Ga0500559_0002901 Ga0500559_0002901_1433_2632 397
568 3300053136 Ga0500559_0020640 Ga0500559_0020640_352_1551 397
569 3300053139 Ga0500568_0000060 Ga0500568_0000060_102040_103236 397
570 3300053140 Ga0500573_0000007 Ga0500573_0000007_264935_266131 397
571 3300053155 Ga0500620_000387 Ga0500620_000387_6796_8001 397
572 3300054114 Ga0501084_0053198 Ga0501084_0053198_941_2137 397
573 3300061719 Ga0466962_0000302 Ga0466962_0000302_5224_6441 397
574 3300061719 Ga0466962_0004408 Ga0466962_0004408_1444_2640 397
575 iso_pu_bacteria 2837183177 2837187228 397
576 3300003792 Ga0055540_1000211 Ga0055540_100021118 398
577 3300005328 Ga0070676_10113118 Ga0070676_101131182 398
578 3300005329 Ga0070683_100008046 Ga0070683_1000080469 398
579 3300005334 Ga0068869_100030573 Ga0068869_1000305733 398
580 3300005335 Ga0070666_10012208 Ga0070666_100122085 398
581 3300005335 Ga0070666_10073071 Ga0070666_100730713 398
582 3300005337 Ga0070682_100003447 Ga0070682_1000034475 398
583 3300005338 Ga0068868_100013822 Ga0068868_1000138224 398
584 3300005338 Ga0068868_100014864 Ga0068868_1000148644 398
585 3300005339 Ga0070660_100103520 Ga0070660_1001035203 398
586 3300005344 Ga0070661_100047797 Ga0070661_1000477972 398
587 3300005347 Ga0070668_100016742 Ga0070668_1000167426 398
588 3300005347 Ga0070668_100068032 Ga0070668_1000680322 398
589 3300005354 Ga0070675_100000432 Ga0070675_10000043226 398
590 3300005356 Ga0070674_100090614 Ga0070674_1000906142 398
591 3300005364 Ga0070673_100031422 Ga0070673_1000314223 398
592 3300005367 Ga0070667_100001312 Ga0070667_1000013122 398
593 3300005367 Ga0070667_100014813 Ga0070667_1000148133 398
594 3300005435 Ga0070714_100064441 Ga0070714_1000644412 398
595 3300005436 Ga0070713_100105853 Ga0070713_1001058533 398
596 3300005437 Ga0070710_10010958 Ga0070710_100109585 398
597 3300005438 Ga0070701_10058009 Ga0070701_100580091 398
598 3300005441 Ga0070700_100025985 Ga0070700_1000259852 398
599 3300005441 Ga0070700_100035573 Ga0070700_1000355734 398
600 3300005455 Ga0070663_100014886 Ga0070663_1000148864 398
601 3300005455 Ga0070663_100035622 Ga0070663_1000356223 398
602 3300005456 Ga0070678_100135038 Ga0070678_1001350382 398
603 3300005457 Ga0070662_100070790 Ga0070662_1000707902 398
604 3300005457 Ga0070662_100092533 Ga0070662_1000925332 398
605 3300005471 Ga0070698_100075451 Ga0070698_1000754514 398
606 3300005539 Ga0068853_100233417 Ga0068853_1002334171 398
607 3300005545 Ga0070695_100023511 Ga0070695_1000235112 398
608 3300005547 Ga0070693_100052400 Ga0070693_1000524003 398
609 3300005548 Ga0070665_100001805 Ga0070665_10000180521 398
610 3300005549 Ga0070704_100029852 Ga0070704_1000298522 398
611 3300005563 Ga0068855_100027492 Ga0068855_1000274926 398
612 3300005564 Ga0070664_100001189 Ga0070664_10000118915 398
613 3300005577 Ga0068857_100054554 Ga0068857_1000545544 398
614 3300005614 Ga0068856_100032411 Ga0068856_1000324113 398
615 3300005615 Ga0070702_100156110 Ga0070702_1001561102 398
616 3300005616 Ga0068852_100047617 Ga0068852_1000476171 398
617 3300005616 Ga0068852_100191948 Ga0068852_1001919482 398
618 3300005618 Ga0068864_100055401 Ga0068864_1000554013 398
619 3300005618 Ga0068864_100184358 Ga0068864_1001843581 398
620 3300005718 Ga0068866_10010288 Ga0068866_100102882 398
621 3300005841 Ga0068863_100040994 Ga0068863_1000409943 398
622 3300005841 Ga0068863_100048819 Ga0068863_1000488191 398
623 3300005841 Ga0068863_100156177 Ga0068863_1001561772 398
624 3300005843 Ga0068860_100000085 Ga0068860_1000000855 398
625 3300005844 Ga0068862_100102490 Ga0068862_1001024902 398
626 3300005844 Ga0068862_100130004 Ga0068862_1001300042 398
627 3300005937 Ga0081455_10007359 Ga0081455_100073596 398
628 3300005937 Ga0081455_10090029 Ga0081455_100900293 398
629 3300005981 Ga0081538_10001227 Ga0081538_1000122729 398
630 3300005985 Ga0081539_10001305 Ga0081539_1000130511 398
631 3300006028 Ga0070717_10338763 Ga0070717_103387631 398
632 3300006048 Ga0075363_100000882 Ga0075363_1000008823 398
633 3300006163 Ga0070715_10010123 Ga0070715_100101233 398
634 3300006173 Ga0070716_100023759 Ga0070716_1000237592 398
635 3300006175 Ga0070712_100024582 Ga0070712_1000245823 398
636 3300006353 Ga0075370_10058776 Ga0075370_100587762 398
637 3300006844 Ga0075428_100008931 Ga0075428_1000089318 398
638 3300006844 Ga0075428_100307936 Ga0075428_1003079361 398
639 3300006846 Ga0075430_100001812 Ga0075430_1000018124 398
640 3300006847 Ga0075431_100001436 Ga0075431_1000014364 398
641 3300006847 Ga0075431_100002862 Ga0075431_10000286212 398
642 3300006852 Ga0075433_10073782 Ga0075433_100737823 398
643 3300006871 Ga0075434_100311857 Ga0075434_1003118572 398
644 3300006880 Ga0075429_100000244 Ga0075429_1000002444 398
645 3300006914 Ga0075436_100095390 Ga0075436_1000953902 398
646 3300009094 Ga0111539_10053176 Ga0111539_100531762 398
647 3300009098 Ga0105245_10030109 Ga0105245_100301095 398
648 3300009098 Ga0105245_10042678 Ga0105245_100426783 398
649 3300009147 Ga0114129_10000723 Ga0114129_100007239 398
650 3300009147 Ga0114129_10018283 Ga0114129_100182834 398
651 3300009148 Ga0105243_10003603 Ga0105243_100036039 398
652 3300009148 Ga0105243_10019596 Ga0105243_100195962 398
653 3300009148 Ga0105243_10053995 Ga0105243_100539952 398
654 3300009174 Ga0105241_10107752 Ga0105241_101077522 398
655 3300009177 Ga0105248_10018635 Ga0105248_100186357 398
656 3300009545 Ga0105237_10175054 Ga0105237_101750543 398
657 3300009551 Ga0105238_10029500 Ga0105238_100295004 398
658 3300011119 Ga0105246_10016299 Ga0105246_100162993 398
659 3300013104 Ga0157370_10010594 Ga0157370_100105944 398
660 3300013296 Ga0157374_10105285 Ga0157374_101052852 398
661 3300013307 Ga0157372_10305276 Ga0157372_103052763 398
662 3300014325 Ga0163163_10109690 Ga0163163_101096902 398
663 3300014325 Ga0163163_10126143 Ga0163163_101261432 398
664 3300014326 Ga0157380_10049854 Ga0157380_100498542 398
665 3300014745 Ga0157377_10031449 Ga0157377_100314493 398
666 3300014968 Ga0157379_10021056 Ga0157379_100210562 398
667 3300014968 Ga0157379_10199641 Ga0157379_101996412 398
668 3300014969 Ga0157376_10101412 Ga0157376_101014122 398
669 3300017792 Ga0163161_10010399 Ga0163161_100103992 398
670 3300017792 Ga0163161_10038113 Ga0163161_100381132 398
671 3300021384 Ga0213876_10020805 Ga0213876_100208052 398
672 3300021388 Ga0213875_10035249 Ga0213875_100352492 398
673 3300025303 Ga0209051_1000011 Ga0209051_100001119 398
674 3300025903 Ga0207680_10055045 Ga0207680_100550452 398
675 3300025903 Ga0207680_10065139 Ga0207680_100651392 398
676 3300025905 Ga0207685_10006158 Ga0207685_100061582 398
677 3300025908 Ga0207643_10053204 Ga0207643_100532042 398
678 3300025913 Ga0207695_10113003 Ga0207695_101130032 398
679 3300025915 Ga0207693_10000420 Ga0207693_1000042036 398
680 3300025916 Ga0207663_10071693 Ga0207663_100716932 398
681 3300025919 Ga0207657_10018543 Ga0207657_100185434 398
682 3300025920 Ga0207649_10110283 Ga0207649_101102832 398
683 3300025926 Ga0207659_10027257 Ga0207659_100272572 398
684 3300025927 Ga0207687_10015347 Ga0207687_100153472 398
685 3300025932 Ga0207690_10045554 Ga0207690_100455542 398
686 3300025933 Ga0207706_10015108 Ga0207706_100151087 398
687 3300025933 Ga0207706_10129662 Ga0207706_101296622 398
688 3300025935 Ga0207709_10012673 Ga0207709_100126732 398
689 3300025938 Ga0207704_10067588 Ga0207704_100675882 398
690 3300025939 Ga0207665_10013756 Ga0207665_100137564 398
691 3300025942 Ga0207689_10002944 Ga0207689_100029442 398
692 3300025942 Ga0207689_10015723 Ga0207689_100157233 398
693 3300025944 Ga0207661_10056083 Ga0207661_100560832 398
694 3300025944 Ga0207661_10107587 Ga0207661_101075871 398
695 3300025945 Ga0207679_10007877 Ga0207679_100078774 398
696 3300025961 Ga0207712_10233252 Ga0207712_102332522 398
697 3300025986 Ga0207658_10057863 Ga0207658_100578632 398
698 3300026023 Ga0207677_10042913 Ga0207677_100429133 398
699 3300026023 Ga0207677_10067825 Ga0207677_100678253 398
700 3300026067 Ga0207678_10011889 Ga0207678_100118899 398
701 3300026067 Ga0207678_10019054 Ga0207678_100190543 398
702 3300026075 Ga0207708_10019476 Ga0207708_100194764 398
703 3300026078 Ga0207702_10174634 Ga0207702_101746342 398
704 3300026088 Ga0207641_10031413 Ga0207641_100314133 398
705 3300026116 Ga0207674_10020299 Ga0207674_100202997 398
706 3300026116 Ga0207674_10049467 Ga0207674_100494672 398
707 3300026121 Ga0207683_10010756 Ga0207683_100107569 398
708 3300026142 Ga0207698_10154594 Ga0207698_101545942 398
709 3300027907 Ga0207428_10079774 Ga0207428_100797742 398
710 3300028379 Ga0268266_10024077 Ga0268266_100240772 398
711 3300028381 Ga0268264_10000031 Ga0268264_10000031159 398
712 3300028381 Ga0268264_10145580 Ga0268264_101455802 398
713 3300031251 Ga0265327_10000041 Ga0265327_10000041270 398
714 3300031251 Ga0265327_10001529 Ga0265327_1000152912 398
715 3300031456 Ga0307513_10015478 Ga0307513_1001547810 398
716 3300031901 Ga0307406_10068534 Ga0307406_100685343 398
717 3300031995 Ga0307409_100021231 Ga0307409_1000212313 398
718 3300032002 Ga0307416_100240066 Ga0307416_1002400662 398
719 3300032126 Ga0307415_100037663 Ga0307415_1000376632 398
720 3300032126 Ga0307415_100114408 Ga0307415_1001144082 398
721 3300036401 Ga0373937_0123043 Ga0373937_0123043_571_1770 398
722 3300037418 Ga0395900_0102449 Ga0395900_0102449_1673_2875 398
723 3300037466 Ga0395898_0057223 Ga0395898_0057223_2470_3672 398
724 3300037853 Ga0436364_0647082 Ga0436364_0647082_1020_2216 398
725 3300039437 Ga0436365_0885952 Ga0436365_0885952_109_1305 398
726 3300039437 Ga0436365_1214067 Ga0436365_1214067_4520_5716 398
727 3300039450 Ga0436363_0330623 Ga0436363_0330623_1049_2245 398
728 3300041460 Ga0451802_0335608 Ga0451802_0335608_10_1221 398
729 3300041512 Ga0451853_2451760 Ga0451853_2451760_859_2058 398
730 3300044842 Ga0466957_0010194 Ga0466957_0010194_2368_3564 398
731 3300045976 Ga0466967_0019688 Ga0466967_0019688_2963_4162 398
732 3300045976 Ga0466967_0364757 Ga0466967_0364757_32_1249 398
733 3300046459 Ga0495629_0006771 Ga0495629_0006771_5085_6281 398
734 3300046473 Ga0495582_0005171 Ga0495582_0005171_1685_2881 398
735 3300046529 Ga0495652_0073275 Ga0495652_0073275_549_1748 398
736 3300046616 Ga0495668_0002662 Ga0495668_0002662_5364_6563 398
737 3300047319 Ga0495674_0101431 Ga0495674_0101431_544_1740 398
738 3300047673 Ga0495593_0017119 Ga0495593_0017119_2709_3905 398
739 3300048903 Ga0496100_0000335 Ga0496100_0000335_15856_17055 398
740 3300048904 Ga0496101_0001767 Ga0496101_0001767_4576_5775 398
741 3300048904 Ga0496101_0031811 Ga0496101_0031811_472_1671 398
742 3300048905 Ga0496102_0032948 Ga0496102_0032948_1833_3032 398
743 3300048906 Ga0496103_0001055 Ga0496103_0001055_900_2099 398
744 3300048907 Ga0496104_0093139 Ga0496104_0093139_1298_2497 398
745 3300048908 Ga0496105_0050189 Ga0496105_0050189_334_1533 398
746 3300048909 Ga0496106_0000199 Ga0496106_0000199_24916_26115 398
747 3300048909 Ga0496106_0058154 Ga0496106_0058154_901_2100 398
748 3300048910 Ga0496107_0001353 Ga0496107_0001353_13788_14987 398
749 3300048911 Ga0496108_0000966 Ga0496108_0000966_2756_3955 398
750 3300048911 Ga0496108_0022651 Ga0496108_0022651_356_1555 398
751 3300048911 Ga0496108_0051511 Ga0496108_0051511_1707_2906 398
752 3300048911 Ga0496108_0060482 Ga0496108_0060482_1736_2932 398
753 3300048912 Ga0496109_0008976 Ga0496109_0008976_4449_5648 398
754 3300048912 Ga0496109_0013820 Ga0496109_0013820_1173_2369 398
755 3300048912 Ga0496109_0038853 Ga0496109_0038853_2613_3812 398
756 3300048913 Ga0496110_0010603 Ga0496110_0010603_4451_5650 398
757 3300048913 Ga0496110_0028522 Ga0496110_0028522_2882_4081 398
758 3300048913 Ga0496110_0056148 Ga0496110_0056148_1213_2409 398
759 3300048915 Ga0496112_0018635 Ga0496112_0018635_645_1841 398
760 3300048915 Ga0496112_0197097 Ga0496112_0197097_99_1298 398
761 3300048916 Ga0496113_0006724 Ga0496113_0006724_1150_2346 398
762 3300048916 Ga0496113_0122804 Ga0496113_0122804_216_1415 398
763 3300048917 Ga0496114_0000559 Ga0496114_0000559_21920_23119 398
764 3300048917 Ga0496114_0017869 Ga0496114_0017869_3718_4917 398
765 3300048918 Ga0496115_0010823 Ga0496115_0010823_3008_4207 398
766 3300048919 Ga0496116_0031324 Ga0496116_0031324_627_1826 398
767 3300048920 Ga0496117_0034361 Ga0496117_0034361_1849_3048 398
768 3300048921 Ga0496118_0009080 Ga0496118_0009080_1957_3153 398
769 3300048921 Ga0496118_0045956 Ga0496118_0045956_578_1777 398
770 3300048924 Ga0496121_0000433 Ga0496121_0000433_65361_66560 398
771 3300048925 Ga0496122_0008484 Ga0496122_0008484_4113_5312 398
772 3300048927 Ga0496124_0000015 Ga0496124_0000015_443623_444822 398
773 3300048928 Ga0496125_0000021 Ga0496125_0000021_15879_17078 398
774 3300048928 Ga0496125_0210415 Ga0496125_0210415_14_1213 398
775 3300048929 Ga0496126_0000015 Ga0496126_0000015_15879_17078 398
776 3300049570 Ga0501033_0034053 Ga0501033_0034053_1103_2299 398
777 3300049571 Ga0501034_0071162 Ga0501034_0071162_555_1751 398
778 3300049572 Ga0501036_0165471 Ga0501036_0165471_558_1775 398
779 3300049576 Ga0501040_0087038 Ga0501040_0087038_888_2105 398
780 3300049577 Ga0501041_0071309 Ga0501041_0071309_894_2111 398
781 3300049578 Ga0501042_0045990 Ga0501042_0045990_13_1230 398
782 3300049579 Ga0501043_0036812 Ga0501043_0036812_71_1267 398
783 3300049585 Ga0501069_0006022 Ga0501069_0006022_3506_4705 398
784 3300049586 Ga0501070_0002491 Ga0501070_0002491_14003_15202 398
785 3300049586 Ga0501070_0004541 Ga0501070_0004541_9333_10532 398
786 3300049586 Ga0501070_0068120 Ga0501070_0068120_1697_2896 398
787 3300049588 Ga0501072_0072579 Ga0501072_0072579_1346_2563 398
788 3300049590 Ga0501074_0001157 Ga0501074_0001157_13375_14574 398
789 3300049592 Ga0501076_0201480 Ga0501076_0201480_328_1545 398
790 3300049741 Ga0501079_0003055 Ga0501079_0003055_6333_7532 398
791 3300049742 Ga0501080_0001035 Ga0501080_0001035_17166_18365 398
792 3300049742 Ga0501080_0016596 Ga0501080_0016596_4187_5386 398
793 3300049742 Ga0501080_0022823 Ga0501080_0022823_659_1858 398
794 3300049822 Ga0501035_0014479 Ga0501035_0014479_2839_4035 398
795 3300049823 Ga0501044_0001612 Ga0501044_0001612_24826_26022 398
796 3300050490 nmdc:mga03n38_2844_c1 nmdc:mga03n38_2844_c1_2811_4007 398
797 3300050496 nmdc:mga07m45_41926_c1 nmdc:mga07m45_41926_c1_763_1962 398
798 3300050507 nmdc:mga05p37_2128_c1 nmdc:mga05p37_2128_c1_6434_7633 398
799 3300050508 nmdc:mga09592_1737_c1 nmdc:mga09592_1737_c1_6829_8028 398
800 3300050509 nmdc:mga0qj67_193_c1 nmdc:mga0qj67_193_c1_6426_7625 398
801 3300050510 nmdc:mga06r32_1594_c1 nmdc:mga06r32_1594_c1_3548_4750 398
802 3300050510 nmdc:mga06r32_275_c1 nmdc:mga06r32_275_c1_7560_8759 398
803 3300050511 nmdc:mga08y16_92314_c1 nmdc:mga08y16_92314_c1_608_1807 398
804 3300050512 nmdc:mga0n895_41320_c1 nmdc:mga0n895_41320_c1_2447_3646 398
805 3300053078 Ga0495612_0000472 Ga0495612_0000472_4123_5322 398
806 3300053085 Ga0495619_0061541 Ga0495619_0061541_532_1731 398
807 3300053090 Ga0500646_0000612 Ga0500646_0000612_2736_3935 398
808 3300053146 Ga0500588_0003567 Ga0500588_0003567_633_1832 398
809 3300054114 Ga0501084_0052351 Ga0501084_0052351_1311_2528 398
810 3300002773 JGI25152J39213_1000980 JGI25152J39213_100098010 399
811 3300003187 JGI25151J46595_10031792 JGI25151J46595_100317922 399
812 3300003792 Ga0055540_1006714 Ga0055540_10067145 399
813 3300005288 Ga0065714_10010605 Ga0065714_100106051 399
814 3300005290 Ga0065712_10022902 Ga0065712_100229021 399
815 3300005327 Ga0070658_10000155 Ga0070658_100001555 399
816 3300005327 Ga0070658_10002940 Ga0070658_100029409 399
817 3300005327 Ga0070658_10078060 Ga0070658_100780602 399
818 3300005327 Ga0070658_10112230 Ga0070658_101122303 399
819 3300005327 Ga0070658_10241926 Ga0070658_102419261 399
820 3300005329 Ga0070683_100133817 Ga0070683_1001338172 399
821 3300005329 Ga0070683_100140430 Ga0070683_1001404302 399
822 3300005331 Ga0070670_100052841 Ga0070670_1000528412 399
823 3300005334 Ga0068869_100011022 Ga0068869_1000110223 399
824 3300005336 Ga0070680_100001962 Ga0070680_1000019625 399
825 3300005336 Ga0070680_100021263 Ga0070680_1000212635 399
826 3300005336 Ga0070680_100045036 Ga0070680_1000450363 399
827 3300005337 Ga0070682_100165205 Ga0070682_1001652052 399
828 3300005338 Ga0068868_100178949 Ga0068868_1001789492 399
829 3300005338 Ga0068868_100254829 Ga0068868_1002548291 399
830 3300005339 Ga0070660_100011330 Ga0070660_1000113303 399
831 3300005341 Ga0070691_10002291 Ga0070691_100022913 399
832 3300005345 Ga0070692_10003769 Ga0070692_100037694 399
833 3300005345 Ga0070692_10007565 Ga0070692_100075651 399
834 3300005347 Ga0070668_100000964 Ga0070668_1000009641 399
835 3300005347 Ga0070668_100014132 Ga0070668_1000141324 399
836 3300005353 Ga0070669_100057955 Ga0070669_1000579552 399
837 3300005354 Ga0070675_100018048 Ga0070675_1000180485 399
838 3300005354 Ga0070675_100024819 Ga0070675_1000248192 399
839 3300005355 Ga0070671_100000370 Ga0070671_10000037013 399
840 3300005355 Ga0070671_100041360 Ga0070671_1000413603 399
841 3300005355 Ga0070671_100087577 Ga0070671_1000875772 399
842 3300005356 Ga0070674_100042205 Ga0070674_1000422052 399
843 3300005366 Ga0070659_100105731 Ga0070659_1001057311 399
844 3300005367 Ga0070667_100000562 Ga0070667_10000056212 399
845 3300005434 Ga0070709_10006919 Ga0070709_100069192 399
846 3300005435 Ga0070714_100000045 Ga0070714_1000000453 399
847 3300005435 Ga0070714_100048774 Ga0070714_1000487743 399
848 3300005435 Ga0070714_100068199 Ga0070714_1000681993 399
849 3300005435 Ga0070714_100123813 Ga0070714_1001238132 399
850 3300005435 Ga0070714_100289252 Ga0070714_1002892521 399
851 3300005436 Ga0070713_100001944 Ga0070713_1000019443 399
852 3300005436 Ga0070713_100007682 Ga0070713_1000076823 399
853 3300005436 Ga0070713_100093894 Ga0070713_1000938942 399
854 3300005436 Ga0070713_100172511 Ga0070713_1001725112 399
855 3300005437 Ga0070710_10001141 Ga0070710_100011414 399
856 3300005437 Ga0070710_10018959 Ga0070710_100189593 399
857 3300005439 Ga0070711_100004625 Ga0070711_1000046254 399
858 3300005439 Ga0070711_100081123 Ga0070711_1000811232 399
859 3300005441 Ga0070700_100000094 Ga0070700_1000000945 399
860 3300005445 Ga0070708_100022408 Ga0070708_1000224083 399
861 3300005455 Ga0070663_100009639 Ga0070663_1000096394 399
862 3300005456 Ga0070678_100003103 Ga0070678_1000031034 399
863 3300005456 Ga0070678_100050196 Ga0070678_1000501961 399
864 3300005456 Ga0070678_100144904 Ga0070678_1001449042 399
865 3300005456 Ga0070678_100146363 Ga0070678_1001463631 399
866 3300005458 Ga0070681_10000504 Ga0070681_1000050430 399
867 3300005458 Ga0070681_10009194 Ga0070681_100091949 399
868 3300005458 Ga0070681_10100015 Ga0070681_101000152 399
869 3300005466 Ga0070685_10006635 Ga0070685_100066354 399
870 3300005467 Ga0070706_100027267 Ga0070706_1000272673 399
871 3300005467 Ga0070706_100032645 Ga0070706_1000326453 399
872 3300005468 Ga0070707_100003790 Ga0070707_1000037906 399
873 3300005468 Ga0070707_100366908 Ga0070707_1003669081 399
874 3300005471 Ga0070698_100006733 Ga0070698_1000067337 399
875 3300005530 Ga0070679_100000687 Ga0070679_1000006872 399
876 3300005530 Ga0070679_100001838 Ga0070679_1000018382 399
877 3300005530 Ga0070679_100005358 Ga0070679_1000053585 399
878 3300005530 Ga0070679_100063294 Ga0070679_1000632941 399
879 3300005530 Ga0070679_100088386 Ga0070679_1000883863 399
880 3300005539 Ga0068853_100026901 Ga0068853_1000269012 399
881 3300005546 Ga0070696_100088676 Ga0070696_1000886761 399
882 3300005547 Ga0070693_100005567 Ga0070693_1000055673 399
883 3300005548 Ga0070665_100019654 Ga0070665_1000196543 399
884 3300005548 Ga0070665_100061354 Ga0070665_1000613542 399
885 3300005548 Ga0070665_100067128 Ga0070665_1000671283 399
886 3300005564 Ga0070664_100366178 Ga0070664_1003661781 399
887 3300005577 Ga0068857_100186618 Ga0068857_1001866182 399
888 3300005614 Ga0068856_100031138 Ga0068856_1000311385 399
889 3300005614 Ga0068856_100050005 Ga0068856_1000500054 399
890 3300005614 Ga0068856_100177027 Ga0068856_1001770273 399
891 3300005614 Ga0068856_100227229 Ga0068856_1002272292 399
892 3300005615 Ga0070702_100038061 Ga0070702_1000380612 399
893 3300005617 Ga0068859_100019700 Ga0068859_1000197002 399
894 3300005617 Ga0068859_100063907 Ga0068859_1000639072 399
895 3300005719 Ga0068861_100088673 Ga0068861_1000886733 399
896 3300005840 Ga0068870_10001152 Ga0068870_100011528 399
897 3300005841 Ga0068863_100015607 Ga0068863_1000156073 399
898 3300005841 Ga0068863_100034697 Ga0068863_1000346973 399
899 3300005841 Ga0068863_100055479 Ga0068863_1000554794 399
900 3300005841 Ga0068863_100077002 Ga0068863_1000770022 399
901 3300005841 Ga0068863_100390572 Ga0068863_1003905721 399
902 3300005842 Ga0068858_100000032 Ga0068858_1000000322 399
903 3300005842 Ga0068858_100121712 Ga0068858_1001217122 399
904 3300005842 Ga0068858_100121732 Ga0068858_1001217322 399
905 3300005843 Ga0068860_100000112 Ga0068860_10000011212 399
906 3300005844 Ga0068862_100001577 Ga0068862_10000157712 399
907 3300005937 Ga0081455_10001891 Ga0081455_100018912 399
908 3300005983 Ga0081540_1003275 Ga0081540_100327511 399
909 3300005983 Ga0081540_1005254 Ga0081540_10052542 399
910 3300005983 Ga0081540_1010341 Ga0081540_10103415 399
911 3300005985 Ga0081539_10001973 Ga0081539_1000197317 399
912 3300005985 Ga0081539_10020787 Ga0081539_100207873 399
913 3300006028 Ga0070717_10274918 Ga0070717_102749182 399
914 3300006038 Ga0075365_10002419 Ga0075365_100024197 399
915 3300006038 Ga0075365_10038497 Ga0075365_100384972 399
916 3300006048 Ga0075363_100017745 Ga0075363_1000177454 399
917 3300006058 Ga0075432_10031113 Ga0075432_100311133 399
918 3300006163 Ga0070715_10001858 Ga0070715_100018584 399
919 3300006163 Ga0070715_10037487 Ga0070715_100374872 399
920 3300006173 Ga0070716_100001032 Ga0070716_1000010329 399
921 3300006186 Ga0075369_10001816 Ga0075369_100018164 399
922 3300006186 Ga0075369_10032463 Ga0075369_100324633 399
923 3300006358 Ga0068871_100292839 Ga0068871_1002928391 399
924 3300006844 Ga0075428_100016382 Ga0075428_1000163824 399
925 3300006846 Ga0075430_100053863 Ga0075430_1000538633 399
926 3300006847 Ga0075431_100143546 Ga0075431_1001435462 399
927 3300006852 Ga0075433_10003068 Ga0075433_1000306813 399
928 3300006852 Ga0075433_10046700 Ga0075433_100467002 399
929 3300006871 Ga0075434_100003178 Ga0075434_1000031783 399
930 3300006880 Ga0075429_100006508 Ga0075429_1000065083 399
931 3300006880 Ga0075429_100020851 Ga0075429_1000208512 399
932 3300006914 Ga0075436_100010015 Ga0075436_1000100154 399
933 3300006931 Ga0097620_100019700 Ga0097620_1000197002 399
934 3300006931 Ga0097620_100063914 Ga0097620_1000639142 399
935 3300007076 Ga0075435_100004538 Ga0075435_1000045386 399
936 3300009011 Ga0105251_10057996 Ga0105251_100579961 399
937 3300009036 Ga0105244_10004000 Ga0105244_100040007 399
938 3300009098 Ga0105245_10225790 Ga0105245_102257902 399
939 3300009098 Ga0105245_10296646 Ga0105245_102966462 399
940 3300009101 Ga0105247_10000007 Ga0105247_1000000712 399
941 3300009101 Ga0105247_10000164 Ga0105247_100001643 399
942 3300009101 Ga0105247_10004913 Ga0105247_100049135 399
943 3300009101 Ga0105247_10013514 Ga0105247_100135142 399
944 3300009147 Ga0114129_10006158 Ga0114129_1000615811 399
945 3300009147 Ga0114129_10012498 Ga0114129_100124987 399
946 3300009147 Ga0114129_10032957 Ga0114129_100329572 399
947 3300009147 Ga0114129_10178042 Ga0114129_101780423 399
948 3300009148 Ga0105243_10083040 Ga0105243_100830402 399
949 3300009174 Ga0105241_10004546 Ga0105241_100045465 399
950 3300009174 Ga0105241_10117969 Ga0105241_101179692 399
951 3300009176 Ga0105242_10057362 Ga0105242_100573623 399
952 3300009177 Ga0105248_10002480 Ga0105248_1000248012 399
953 3300009177 Ga0105248_10013762 Ga0105248_100137622 399
954 3300009177 Ga0105248_10059757 Ga0105248_100597573 399
955 3300009177 Ga0105248_10070636 Ga0105248_100706362 399
956 3300009177 Ga0105248_10092277 Ga0105248_100922773 399
957 3300009545 Ga0105237_10002337 Ga0105237_1000233710 399
958 3300009551 Ga0105238_10318583 Ga0105238_103185831 399
959 3300009553 Ga0105249_10000001 Ga0105249_10000001480 399
960 3300009553 Ga0105249_10122582 Ga0105249_101225822 399
961 3300010375 Ga0105239_10037404 Ga0105239_100374043 399
962 3300010375 Ga0105239_10221394 Ga0105239_102213942 399
963 3300011119 Ga0105246_10020035 Ga0105246_100200352 399
964 3300013102 Ga0157371_10063256 Ga0157371_100632563 399
965 3300013104 Ga0157370_10069579 Ga0157370_100695792 399
966 3300013104 Ga0157370_10297806 Ga0157370_102978062 399
967 3300013105 Ga0157369_10003546 Ga0157369_100035465 399
968 3300013105 Ga0157369_10013234 Ga0157369_100132345 399
969 3300013105 Ga0157369_10179918 Ga0157369_101799182 399
970 3300013105 Ga0157369_10228215 Ga0157369_102282152 399
971 3300013296 Ga0157374_10022265 Ga0157374_100222654 399
972 3300013296 Ga0157374_10161367 Ga0157374_101613671 399
973 3300013297 Ga0157378_10035250 Ga0157378_100352502 399
974 3300013306 Ga0163162_10020493 Ga0163162_100204933 399
975 3300013307 Ga0157372_10002203 Ga0157372_1000220318 399
976 3300013308 Ga0157375_10049534 Ga0157375_100495345 399
977 3300013308 Ga0157375_10109831 Ga0157375_101098312 399
978 3300013308 Ga0157375_10153028 Ga0157375_101530282 399
979 3300014325 Ga0163163_10016347 Ga0163163_100163473 399
980 3300014325 Ga0163163_10137611 Ga0163163_101376112 399
981 3300014325 Ga0163163_10366663 Ga0163163_103666632 399
982 3300014326 Ga0157380_10030521 Ga0157380_100305212 399
983 3300014745 Ga0157377_10026431 Ga0157377_100264313 399
984 3300014968 Ga0157379_10000802 Ga0157379_100008022 399
985 3300014968 Ga0157379_10012652 Ga0157379_100126527 399
986 3300014968 Ga0157379_10075892 Ga0157379_100758923 399
987 3300014969 Ga0157376_10179127 Ga0157376_101791272 399
988 3300020082 Ga0206353_11145561 Ga0206353_111455613 399
989 3300021358 Ga0213873_10000096 Ga0213873_100000966 399
990 3300021384 Ga0213876_10008265 Ga0213876_100082652 399
991 3300025258 Ga0209129_1000079 Ga0209129_10000798 399
992 3300025273 Ga0209673_1006798 Ga0209673_10067986 399
993 3300025294 Ga0209025_1001940 Ga0209025_100194011 399
994 3300025303 Ga0209051_1002312 Ga0209051_100231210 399
995 3300025303 Ga0209051_1017900 Ga0209051_10179002 399
996 3300025728 Ga0207655_1005143 Ga0207655_10051434 399
997 3300025728 Ga0207655_1049401 Ga0207655_10494011 399
998 3300025735 Ga0207713_1012442 Ga0207713_10124422 399
999 3300025893 Ga0207682_10007444 Ga0207682_100074442 399
1000 3300025898 Ga0207692_10003209 Ga0207692_100032095 399
1001 3300025898 Ga0207692_10007932 Ga0207692_100079321 399
1002 3300025900 Ga0207710_10000013 Ga0207710_1000001312 399
1003 3300025900 Ga0207710_10000082 Ga0207710_10000082102 399
1004 3300025900 Ga0207710_10000178 Ga0207710_100001783 399
1005 3300025900 Ga0207710_10018838 Ga0207710_100188382 399
1006 3300025901 Ga0207688_10002930 Ga0207688_100029302 399
1007 3300025904 Ga0207647_10067875 Ga0207647_100678752 399
1008 3300025906 Ga0207699_10003242 Ga0207699_100032424 399
1009 3300025906 Ga0207699_10008552 Ga0207699_100085523 399
1010 3300025906 Ga0207699_10044092 Ga0207699_100440921 399
1011 3300025907 Ga0207645_10011165 Ga0207645_100111652 399
1012 3300025908 Ga0207643_10000642 Ga0207643_100006425 399
1013 3300025909 Ga0207705_10000595 Ga0207705_100005955 399
1014 3300025909 Ga0207705_10015540 Ga0207705_100155403 399
1015 3300025909 Ga0207705_10015936 Ga0207705_100159362 399
1016 3300025909 Ga0207705_10036392 Ga0207705_100363922 399
1017 3300025909 Ga0207705_10242994 Ga0207705_102429941 399
1018 3300025910 Ga0207684_10011027 Ga0207684_100110273 399
1019 3300025910 Ga0207684_10110326 Ga0207684_101103263 399
1020 3300025910 Ga0207684_10299946 Ga0207684_102999461 399
1021 3300025911 Ga0207654_10021949 Ga0207654_100219492 399
1022 3300025911 Ga0207654_10107808 Ga0207654_101078082 399
1023 3300025912 Ga0207707_10021899 Ga0207707_100218994 399
1024 3300025912 Ga0207707_10026215 Ga0207707_100262155 399
1025 3300025915 Ga0207693_10006587 Ga0207693_100065879 399
1026 3300025915 Ga0207693_10011553 Ga0207693_100115535 399
1027 3300025916 Ga0207663_10013983 Ga0207663_100139833 399
1028 3300025917 Ga0207660_10009254 Ga0207660_100092547 399
1029 3300025917 Ga0207660_10147980 Ga0207660_101479802 399
1030 3300025919 Ga0207657_10021331 Ga0207657_100213312 399
1031 3300025919 Ga0207657_10038028 Ga0207657_100380284 399
1032 3300025920 Ga0207649_10003700 Ga0207649_100037007 399
1033 3300025920 Ga0207649_10030705 Ga0207649_100307051 399
1034 3300025921 Ga0207652_10001493 Ga0207652_100014935 399
1035 3300025921 Ga0207652_10010256 Ga0207652_100102564 399
1036 3300025921 Ga0207652_10011363 Ga0207652_100113634 399
1037 3300025921 Ga0207652_10047865 Ga0207652_100478652 399
1038 3300025921 Ga0207652_10126575 Ga0207652_101265752 399
1039 3300025921 Ga0207652_10190258 Ga0207652_101902582 399
1040 3300025921 Ga0207652_10203646 Ga0207652_102036462 399
1041 3300025922 Ga0207646_10004909 Ga0207646_100049098 399
1042 3300025922 Ga0207646_10224067 Ga0207646_102240672 399
1043 3300025923 Ga0207681_10001110 Ga0207681_100011104 399
1044 3300025924 Ga0207694_10055020 Ga0207694_100550202 399
1045 3300025924 Ga0207694_10257031 Ga0207694_102570312 399
1046 3300025925 Ga0207650_10032659 Ga0207650_100326593 399
1047 3300025927 Ga0207687_10040902 Ga0207687_100409023 399
1048 3300025927 Ga0207687_10238274 Ga0207687_102382742 399
1049 3300025928 Ga0207700_10004533 Ga0207700_100045332 399
1050 3300025928 Ga0207700_10005586 Ga0207700_100055864 399
1051 3300025928 Ga0207700_10056479 Ga0207700_100564793 399
1052 3300025928 Ga0207700_10070499 Ga0207700_100704992 399
1053 3300025928 Ga0207700_10248327 Ga0207700_102483272 399
1054 3300025929 Ga0207664_10000063 Ga0207664_10000063110 399
1055 3300025929 Ga0207664_10003992 Ga0207664_100039922 399
1056 3300025929 Ga0207664_10006346 Ga0207664_100063465 399
1057 3300025929 Ga0207664_10018596 Ga0207664_100185964 399
1058 3300025929 Ga0207664_10054555 Ga0207664_100545552 399
1059 3300025931 Ga0207644_10033273 Ga0207644_100332733 399
1060 3300025933 Ga0207706_10051457 Ga0207706_100514573 399
1061 3300025936 Ga0207670_10074152 Ga0207670_100741523 399
1062 3300025937 Ga0207669_10242228 Ga0207669_102422281 399
1063 3300025939 Ga0207665_10001654 Ga0207665_100016549 399
1064 3300025939 Ga0207665_10003273 Ga0207665_1000327310 399
1065 3300025939 Ga0207665_10009362 Ga0207665_100093624 399
1066 3300025940 Ga0207691_10001332 Ga0207691_1000133212 399
1067 3300025941 Ga0207711_10001465 Ga0207711_1000146513 399
1068 3300025941 Ga0207711_10005962 Ga0207711_100059628 399
1069 3300025941 Ga0207711_10203309 Ga0207711_102033092 399
1070 3300025942 Ga0207689_10000187 Ga0207689_1000018753 399
1071 3300025944 Ga0207661_10005113 Ga0207661_100051138 399
1072 3300025944 Ga0207661_10123319 Ga0207661_101233192 399
1073 3300025961 Ga0207712_10000006 Ga0207712_1000000612 399
1074 3300025972 Ga0207668_10001742 Ga0207668_100017424 399
1075 3300025986 Ga0207658_10000970 Ga0207658_100009709 399
1076 3300026023 Ga0207677_10048470 Ga0207677_100484702 399
1077 3300026023 Ga0207677_10143290 Ga0207677_101432902 399
1078 3300026023 Ga0207677_10225495 Ga0207677_102254951 399
1079 3300026035 Ga0207703_10000015 Ga0207703_100000152 399
1080 3300026035 Ga0207703_10218624 Ga0207703_102186242 399
1081 3300026067 Ga0207678_10002354 Ga0207678_1000235413 399
1082 3300026067 Ga0207678_10075426 Ga0207678_100754263 399
1083 3300026075 Ga0207708_10000123 Ga0207708_1000012348 399
1084 3300026078 Ga0207702_10004958 Ga0207702_1000495811 399
1085 3300026078 Ga0207702_10019652 Ga0207702_100196523 399
1086 3300026078 Ga0207702_10171037 Ga0207702_101710372 399
1087 3300026088 Ga0207641_10022729 Ga0207641_100227291 399
1088 3300026095 Ga0207676_10001957 Ga0207676_100019577 399
1089 3300026118 Ga0207675_100086914 Ga0207675_1000869143 399
1090 3300026118 Ga0207675_100146475 Ga0207675_1001464752 399
1091 3300026118 Ga0207675_100219272 Ga0207675_1002192721 399
1092 3300026121 Ga0207683_10003430 Ga0207683_100034303 399
1093 3300026121 Ga0207683_10024562 Ga0207683_100245622 399
1094 3300026121 Ga0207683_10115208 Ga0207683_101152082 399
1095 3300026121 Ga0207683_10178115 Ga0207683_101781151 399
1096 3300026121 Ga0207683_10305466 Ga0207683_103054661 399
1097 3300026142 Ga0207698_10023505 Ga0207698_100235054 399
1098 3300026142 Ga0207698_10080506 Ga0207698_100805062 399
1099 3300027907 Ga0207428_10068649 Ga0207428_100686492 399
1100 3300028379 Ga0268266_10007851 Ga0268266_100078513 399
1101 3300028379 Ga0268266_10064306 Ga0268266_100643062 399
1102 3300028380 Ga0268265_10000016 Ga0268265_1000001612 399
1103 3300028380 Ga0268265_10273693 Ga0268265_102736932 399
1104 3300028381 Ga0268264_10000026 Ga0268264_1000002612 399
1105 3300028573 Ga0265334_10000839 Ga0265334_1000083910 399
1106 3300028794 Ga0307515_10014277 Ga0307515_100142777 399
1107 3300028794 Ga0307515_10021795 Ga0307515_100217953 399
1108 3300028794 Ga0307515_10022335 Ga0307515_100223359 399
1109 3300030522 Ga0307512_10009276 Ga0307512_100092767 399
1110 3300031247 Ga0265340_10035175 Ga0265340_100351753 399
1111 3300031247 Ga0265340_10040806 Ga0265340_100408062 399
1112 3300031456 Ga0307513_10000001 Ga0307513_100000011453 399
1113 3300031456 Ga0307513_10022497 Ga0307513_100224973 399
1114 3300031548 Ga0307408_100019307 Ga0307408_1000193075 399
1115 3300031548 Ga0307408_100022759 Ga0307408_1000227594 399
1116 3300031548 Ga0307408_100035646 Ga0307408_1000356462 399
1117 3300031548 Ga0307408_100325912 Ga0307408_1003259121 399
1118 3300031595 Ga0265313_10035630 Ga0265313_100356303 399
1119 3300031595 Ga0265313_10040218 Ga0265313_100402182 399
1120 3300031616 Ga0307508_10001163 Ga0307508_1000116320 399
1121 3300031616 Ga0307508_10024539 Ga0307508_100245393 399
1122 3300031711 Ga0265314_10057721 Ga0265314_100577212 399
1123 3300031712 Ga0265342_10041432 Ga0265342_100414322 399
1124 3300031712 Ga0265342_10118549 Ga0265342_101185491 399
1125 3300031727 Ga0316576_10017182 Ga0316576_100171823 399
1126 3300031727 Ga0316576_10048395 Ga0316576_100483951 399
1127 3300031727 Ga0316576_10140041 Ga0316576_101400413 399
1128 3300031824 Ga0307413_10042245 Ga0307413_100422452 399
1129 3300031852 Ga0307410_10024068 Ga0307410_100240683 399
1130 3300031852 Ga0307410_10024166 Ga0307410_100241663 399
1131 3300031852 Ga0307410_10068104 Ga0307410_100681043 399
1132 3300031852 Ga0307410_10109058 Ga0307410_101090582 399
1133 3300031901 Ga0307406_10093638 Ga0307406_100936383 399
1134 3300031901 Ga0307406_10093771 Ga0307406_100937712 399
1135 3300031903 Ga0307407_10173283 Ga0307407_101732832 399
1136 3300031911 Ga0307412_10029765 Ga0307412_100297653 399
1137 3300031995 Ga0307409_100058000 Ga0307409_1000580002 399
1138 3300031995 Ga0307409_100107967 Ga0307409_1001079672 399
1139 3300031995 Ga0307409_100276950 Ga0307409_1002769502 399
1140 3300031995 Ga0307409_100385132 Ga0307409_1003851322 399
1141 3300032002 Ga0307416_100015187 Ga0307416_1000151874 399
1142 3300032002 Ga0307416_100039444 Ga0307416_1000394443 399
1143 3300032004 Ga0307414_10268980 Ga0307414_102689801 399
1144 3300032005 Ga0307411_10001113 Ga0307411_100011132 399
1145 3300032005 Ga0307411_10248123 Ga0307411_102481232 399
1146 3300032126 Ga0307415_100005815 Ga0307415_1000058154 399
1147 3300032126 Ga0307415_100032681 Ga0307415_1000326812 399
1148 3300032126 Ga0307415_100315876 Ga0307415_1003158761 399
1149 3300034816 Ga0373930_0002591 Ga0373930_0002591_1450_2652 399
1150 3300034817 Ga0373948_0001069 Ga0373948_0001069_906_2108 399
1151 3300035086 Ga0373934_0000014 Ga0373934_0000014_53457_54659 399
1152 3300035086 Ga0373934_0019070 Ga0373934_0019070_999_2201 399
1153 3300035090 Ga0373949_0013828 Ga0373949_0013828_268_1470 399
1154 3300035091 Ga0373951_0000127 Ga0373951_0000127_6031_7233 399
1155 3300035091 Ga0373951_0004369 Ga0373951_0004369_1614_2816 399
1156 3300035112 Ga0373932_0003524 Ga0373932_0003524_1373_2575 399
1157 3300035117 Ga0373953_0001755 Ga0373953_0001755_4630_5832 399
1158 3300035117 Ga0373953_0046502 Ga0373953_0046502_99_1301 399
1159 3300035118 Ga0373954_0001669 Ga0373954_0001669_3141_4343 399
1160 3300035118 Ga0373954_0034701 Ga0373954_0034701_1085_2287 399
1161 3300035119 Ga0373956_0001414 Ga0373956_0001414_4894_6096 399
1162 3300035119 Ga0373956_0007651 Ga0373956_0007651_1730_2938 399
1163 3300035120 Ga0373957_0000846 Ga0373957_0000846_4643_5845 399
1164 3300035120 Ga0373957_0001048 Ga0373957_0001048_5640_6842 399
1165 3300035170 Ga0373943_0015990 Ga0373943_0015990_878_2080 399
1166 3300035171 Ga0373946_0040136 Ga0373946_0040136_573_1775 399
1167 3300035172 Ga0373955_0000040 Ga0373955_0000040_4548_5750 399
1168 3300035172 Ga0373955_0003554 Ga0373955_0003554_3621_4823 399
1169 3300035241 Ga0373961_0019195 Ga0373961_0019195_171_1373 399
1170 3300035398 Ga0316574_0031353 Ga0316574_0031353_760_1968 399
1171 3300035398 Ga0316574_0040647 Ga0316574_0040647_1571_2773 399
1172 3300035410 Ga0373924_0001593 Ga0373924_0001593_4235_5437 399
1173 3300035410 Ga0373924_0038344 Ga0373924_0038344_480_1682 399
1174 3300035692 Ga0373935_0013523 Ga0373935_0013523_1348_2550 399
1175 3300035724 Ga0373933_0000085 Ga0373933_0000085_4429_5631 399
1176 3300036401 Ga0373937_0000197 Ga0373937_0000197_53485_54687 399
1177 3300036401 Ga0373937_0121631 Ga0373937_0121631_1180_2382 399
1178 3300036712 Ga0316584_0011739 Ga0316584_0011739_3338_4540 399
1179 3300036712 Ga0316584_0052838 Ga0316584_0052838_1021_2232 399
1180 3300036712 Ga0316584_0075219 Ga0316584_0075219_563_1771 399
1181 3300036712 Ga0316584_0090142 Ga0316584_0090142_236_1447 399
1182 3300037312 Ga0395899_0002958 Ga0395899_0002958_3960_5171 399
1183 3300037312 Ga0395899_0004671 Ga0395899_0004671_109_1314 399
1184 3300037312 Ga0395899_0046758 Ga0395899_0046758_920_2125 399
1185 3300037312 Ga0395899_0114071 Ga0395899_0114071_17_1222 399
1186 3300037418 Ga0395900_0006397 Ga0395900_0006397_10981_12183 399
1187 3300037418 Ga0395900_0010840 Ga0395900_0010840_2207_3412 399
1188 3300037418 Ga0395900_0019678 Ga0395900_0019678_4927_6132 399
1189 3300037418 Ga0395900_0025509 Ga0395900_0025509_3547_4749 399
1190 3300037418 Ga0395900_0197109 Ga0395900_0197109_667_1908 399
1191 3300037466 Ga0395898_0006003 Ga0395898_0006003_3727_4929 399
1192 3300037466 Ga0395898_0006892 Ga0395898_0006892_9665_10870 399
1193 3300037466 Ga0395898_0013311 Ga0395898_0013311_217_1422 399
1194 3300037466 Ga0395898_0017536 Ga0395898_0017536_750_1955 399
1195 3300037466 Ga0395898_0077820 Ga0395898_0077820_1831_3036 399
1196 3300037466 Ga0395898_0083918 Ga0395898_0083918_982_2223 399
1197 3300037466 Ga0395898_0112966 Ga0395898_0112966_1245_2450 399
1198 3300037466 Ga0395898_0348124 Ga0395898_0348124_117_1349 399
1199 3300037471 Ga0395905_0001026 Ga0395905_0001026_30489_31691 399
1200 3300037471 Ga0395905_0303095 Ga0395905_0303095_161_1366 399
1201 3300037471 Ga0395905_0405009 Ga0395905_0405009_25_1248 399
1202 3300037853 Ga0436364_0418931 Ga0436364_0418931_388_1593 399
1203 3300037853 Ga0436364_1255815 Ga0436364_1255815_8285_9517 399
1204 3300037853 Ga0436364_1390545 Ga0436364_1390545_1280_2482 399
1205 3300038443 Ga0395901_0003412 Ga0395901_0003412_13475_14680 399
1206 3300038443 Ga0395901_0021006 Ga0395901_0021006_1152_2354 399
1207 3300038443 Ga0395901_0113011 Ga0395901_0113011_1289_2494 399
1208 3300039437 Ga0436365_0613236 Ga0436365_0613236_4272_5480 399
1209 3300039450 Ga0436363_0076260 Ga0436363_0076260_560_1774 399
1210 3300039450 Ga0436363_0265210 Ga0436363_0265210_1819_3033 399
1211 3300039453 Ga0436362_0604249 Ga0436362_0604249_3805_5013 399
1212 3300041407 Ga0439447_010755 Ga0439447_010755_72_1277 399
1213 3300041411 Ga0439466_0030633 Ga0439466_0030633_136_1335 399
1214 3300041413 Ga0439465_0010651 Ga0439465_0010651_1282_2481 399
1215 3300041413 Ga0439465_0031545 Ga0439465_0031545_331_1536 399
1216 3300041460 Ga0451802_1677789 Ga0451802_1677789_348_1559 399
1217 3300041997 Ga0439431_0000706 Ga0439431_0000706_4922_6121 399
1218 3300041999 Ga0439433_0000016 Ga0439433_0000016_19073_20278 399
1219 3300042002 Ga0439442_000124 Ga0439442_000124_7761_8966 399
1220 3300042002 Ga0439442_000483 Ga0439442_000483_6325_7530 399
1221 3300042002 Ga0439442_012154 Ga0439442_012154_415_1620 399
1222 3300042007 Ga0439449_0000123 Ga0439449_0000123_1556_2761 399
1223 3300042007 Ga0439449_0044932 Ga0439449_0044932_48_1253 399
1224 3300042010 Ga0439452_008147 Ga0439452_008147_583_1788 399
1225 3300042010 Ga0439452_027059 Ga0439452_027059_66_1271 399
1226 3300042016 Ga0439463_026533 Ga0439463_026533_75_1295 399
1227 3300042122 Ga0450920_001002 Ga0450920_001002_3337_4542 399
1228 3300042122 Ga0450920_008485 Ga0450920_008485_221_1426 399
1229 3300042146 Ga0450907_000606 Ga0450907_000606_2710_3915 399
1230 3300042435 Ga0439434_0000220 Ga0439434_0000220_13769_14974 399
1231 3300044658 Ga0466972_0017406 Ga0466972_0017406_2123_3322 399
1232 3300044683 Ga0466965_0008270 Ga0466965_0008270_889_2088 399
1233 3300044683 Ga0466965_0010455 Ga0466965_0010455_109_1308 399
1234 3300044684 Ga0466966_0030188 Ga0466966_0030188_2189_3421 399
1235 3300044684 Ga0466966_0076601 Ga0466966_0076601_110_1315 399
1236 3300044684 Ga0466966_0078802 Ga0466966_0078802_47_1258 399
1237 3300044684 Ga0466966_0143115 Ga0466966_0143115_94_1296 399
1238 3300044693 Ga0466961_0005237 Ga0466961_0005237_4745_5956 399
1239 3300044693 Ga0466961_0016492 Ga0466961_0016492_494_1717 399
1240 3300044693 Ga0466961_0049608 Ga0466961_0049608_1418_2620 399
1241 3300044693 Ga0466961_0050180 Ga0466961_0050180_1344_2549 399
1242 3300044693 Ga0466961_0107930 Ga0466961_0107930_420_1652 399
1243 3300044706 Ga0466964_0068658 Ga0466964_0068658_218_1417 399
1244 3300044719 Ga0466971_0019022 Ga0466971_0019022_613_1818 399
1245 3300044719 Ga0466971_0083518 Ga0466971_0083518_133_1338 399
1246 3300044735 Ga0466968_0046781 Ga0466968_0046781_373_1572 399
1247 3300044765 Ga0466970_0034538 Ga0466970_0034538_1380_2579 399
1248 3300044765 Ga0466970_0050609 Ga0466970_0050609_852_2063 399
1249 3300044842 Ga0466957_0012679 Ga0466957_0012679_2890_4089 399
1250 3300044842 Ga0466957_0043592 Ga0466957_0043592_246_1451 399
1251 3300044842 Ga0466957_0066258 Ga0466957_0066258_857_2062 399
1252 3300044901 Ga0466960_0002656 Ga0466960_0002656_5033_6232 399
1253 3300044901 Ga0466960_0004820 Ga0466960_0004820_3687_4886 399
1254 3300044901 Ga0466960_0005643 Ga0466960_0005643_2390_3613 399
1255 3300044901 Ga0466960_0019496 Ga0466960_0019496_1086_2297 399
1256 3300045049 Ga0466959_0014077 Ga0466959_0014077_1949_3181 399
1257 3300045836 Ga0466958_0005582 Ga0466958_0005582_5321_6526 399
1258 3300045836 Ga0466958_0020417 Ga0466958_0020417_443_1663 399
1259 3300045836 Ga0466958_0032227 Ga0466958_0032227_144_1349 399
1260 3300045976 Ga0466967_0006791 Ga0466967_0006791_854_2059 399
1261 3300045976 Ga0466967_0027636 Ga0466967_0027636_483_1688 399
1262 3300045976 Ga0466967_0075584 Ga0466967_0075584_705_1916 399
1263 3300046454 Ga0495592_0000157 Ga0495592_0000157_5012_6214 399
1264 3300046459 Ga0495629_0001111 Ga0495629_0001111_3371_4573 399
1265 3300046460 Ga0495638_0001596 Ga0495638_0001596_7584_8783 399
1266 3300046460 Ga0495638_0059658 Ga0495638_0059658_229_1431 399
1267 3300046461 Ga0495641_0008500 Ga0495641_0008500_2368_3570 399
1268 3300046461 Ga0495641_0051617 Ga0495641_0051617_369_1571 399
1269 3300046462 Ga0495651_0000115 Ga0495651_0000115_4443_5645 399
1270 3300046462 Ga0495651_0006516 Ga0495651_0006516_5407_6609 399
1271 3300046462 Ga0495651_0035816 Ga0495651_0035816_2328_3530 399
1272 3300046463 Ga0495653_0011549 Ga0495653_0011549_4440_5642 399
1273 3300046463 Ga0495653_0068042 Ga0495653_0068042_532_1734 399
1274 3300046472 Ga0495580_0003950 Ga0495580_0003950_8359_9564 399
1275 3300046475 Ga0495639_0002427 Ga0495639_0002427_2398_3603 399
1276 3300046475 Ga0495639_0029477 Ga0495639_0029477_216_1418 399
1277 3300046477 Ga0495664_0001861 Ga0495664_0001861_7332_8537 399
1278 3300046511 Ga0495608_0003716 Ga0495608_0003716_5036_6238 399
1279 3300046514 Ga0495618_0076007 Ga0495618_0076007_922_2124 399
1280 3300046516 Ga0495628_0000492 Ga0495628_0000492_4438_5640 399
1281 3300046519 Ga0495632_0023354 Ga0495632_0023354_838_2040 399
1282 3300046522 Ga0495643_0060299 Ga0495643_0060299_693_1898 399
1283 3300046524 Ga0495648_0018440 Ga0495648_0018440_2910_4118 399
1284 3300046526 Ga0495666_0043441 Ga0495666_0043441_554_1756 399
1285 3300046529 Ga0495652_0007274 Ga0495652_0007274_4438_5640 399
1286 3300046529 Ga0495652_0022385 Ga0495652_0022385_834_2036 399
1287 3300046529 Ga0495652_0060817 Ga0495652_0060817_1082_2284 399
1288 3300046531 Ga0495665_0030387 Ga0495665_0030387_878_2080 399
1289 3300046533 Ga0495640_0026843 Ga0495640_0026843_2363_3565 399
1290 3300046535 Ga0495586_0002370 Ga0495586_0002370_352_1557 399
1291 3300046535 Ga0495586_0015897 Ga0495586_0015897_214_1419 399
1292 3300046535 Ga0495586_0092857 Ga0495586_0092857_142_1344 399
1293 3300046536 Ga0495587_0000123 Ga0495587_0000123_4443_5645 399
1294 3300046536 Ga0495587_0002547 Ga0495587_0002547_1682_2887 399
1295 3300046543 Ga0495645_0001555 Ga0495645_0001555_6384_7589 399
1296 3300046543 Ga0495645_0027772 Ga0495645_0027772_2316_3518 399
1297 3300046543 Ga0495645_0034357 Ga0495645_0034357_1285_2487 399
1298 3300046543 Ga0495645_0155719 Ga0495645_0155719_103_1308 399
1299 3300046557 Ga0495622_0058800 Ga0495622_0058800_408_1613 399
1300 3300046559 Ga0495667_0000107 Ga0495667_0000107_5680_6882 399
1301 3300046559 Ga0495667_0001041 Ga0495667_0001041_6729_7934 399
1302 3300046559 Ga0495667_0007253 Ga0495667_0007253_3995_5197 399
1303 3300046642 Ga0495634_0020569 Ga0495634_0020569_2793_3995 399
1304 3300046663 Ga0495635_0028622 Ga0495635_0028622_1342_2544 399
1305 3300046675 Ga0495657_0000169 Ga0495657_0000169_53483_54685 399
1306 3300046675 Ga0495657_0011577 Ga0495657_0011577_3909_5111 399
1307 3300046675 Ga0495657_0036625 Ga0495657_0036625_1370_2572 399
1308 3300046678 Ga0495599_0002521 Ga0495599_0002521_4698_5900 399
1309 3300046678 Ga0495599_0037427 Ga0495599_0037427_661_1863 399
1310 3300046678 Ga0495599_0042368 Ga0495599_0042368_442_1644 399
1311 3300046679 Ga0495623_0000166 Ga0495623_0000166_447_1649 399
1312 3300046679 Ga0495623_0033496 Ga0495623_0033496_431_1633 399
1313 3300046680 Ga0495646_0059942 Ga0495646_0059942_110_1312 399
1314 3300046680 Ga0495646_0111000 Ga0495646_0111000_309_1511 399
1315 3300046683 Ga0495658_0116082 Ga0495658_0116082_309_1523 399
1316 3300046683 Ga0495658_0154287 Ga0495658_0154287_180_1382 399
1317 3300046689 Ga0495613_0015671 Ga0495613_0015671_2796_3998 399
1318 3300046690 Ga0495624_0169833 Ga0495624_0169833_99_1301 399
1319 3300046809 Ga0495600_0005572 Ga0495600_0005572_2118_3323 399
1320 3300046809 Ga0495600_0009464 Ga0495600_0009464_3609_4811 399
1321 3300046809 Ga0495600_0017124 Ga0495600_0017124_1851_3053 399
1322 3300047315 Ga0495581_0009107 Ga0495581_0009107_4098_5303 399
1323 3300047315 Ga0495581_0027592 Ga0495581_0027592_1650_2852 399
1324 3300047315 Ga0495581_0043604 Ga0495581_0043604_525_1727 399
1325 3300047317 Ga0495604_0000161 Ga0495604_0000161_4410_5612 399
1326 3300047317 Ga0495604_0027138 Ga0495604_0027138_2870_4072 399
1327 3300047318 Ga0495636_0026434 Ga0495636_0026434_356_1561 399
1328 3300047319 Ga0495674_0012623 Ga0495674_0012623_4404_5606 399
1329 3300047320 Ga0495672_0003416 Ga0495672_0003416_2272_3471 399
1330 3300047322 Ga0495680_0007013 Ga0495680_0007013_4438_5640 399
1331 3300047322 Ga0495680_0023511 Ga0495680_0023511_1934_3136 399
1332 3300047443 Ga0495687_030957 Ga0495687_030957_853_2070 399
1333 3300047444 Ga0495675_0002978 Ga0495675_0002978_4547_5749 399
1334 3300047444 Ga0495675_0011761 Ga0495675_0011761_1940_3142 399
1335 3300047444 Ga0495675_0022673 Ga0495675_0022673_214_1419 399
1336 3300047445 Ga0495677_0036674 Ga0495677_0036674_222_1427 399
1337 3300047471 Ga0495684_0050867 Ga0495684_0050867_876_2078 399
1338 3300047471 Ga0495684_0122680 Ga0495684_0122680_506_1708 399
1339 3300047673 Ga0495593_0047132 Ga0495593_0047132_381_1583 399
1340 3300048088 Ga0495602_0000182 Ga0495602_0000182_4438_5640 399
1341 3300048088 Ga0495602_0075152 Ga0495602_0075152_304_1506 399
1342 3300048903 Ga0496100_0018499 Ga0496100_0018499_212_1411 399
1343 3300048903 Ga0496100_0067268 Ga0496100_0067268_251_1450 399
1344 3300048903 Ga0496100_0125109 Ga0496100_0125109_558_1763 399
1345 3300048904 Ga0496101_0015785 Ga0496101_0015785_2675_3874 399
1346 3300048904 Ga0496101_0038237 Ga0496101_0038237_147_1367 399
1347 3300048904 Ga0496101_0056663 Ga0496101_0056663_1463_2668 399
1348 3300048904 Ga0496101_0215633 Ga0496101_0215633_230_1435 399
1349 3300048905 Ga0496102_0000750 Ga0496102_0000750_14037_15236 399
1350 3300048905 Ga0496102_0021913 Ga0496102_0021913_4214_5434 399
1351 3300048905 Ga0496102_0147261 Ga0496102_0147261_213_1418 399
1352 3300048905 Ga0496102_0198432 Ga0496102_0198432_118_1320 399
1353 3300048905 Ga0496102_0284190 Ga0496102_0284190_316_1518 399
1354 3300048906 Ga0496103_0042265 Ga0496103_0042265_1004_2206 399
1355 3300048907 Ga0496104_0012811 Ga0496104_0012811_3646_4848 399
1356 3300048907 Ga0496104_0025727 Ga0496104_0025727_1776_2987 399
1357 3300048907 Ga0496104_0039321 Ga0496104_0039321_2691_3890 399
1358 3300048907 Ga0496104_0059938 Ga0496104_0059938_249_1469 399
1359 3300048908 Ga0496105_0002855 Ga0496105_0002855_3191_4393 399
1360 3300048908 Ga0496105_0021733 Ga0496105_0021733_891_2111 399
1361 3300048908 Ga0496105_0069758 Ga0496105_0069758_520_1722 399
1362 3300048909 Ga0496106_0008646 Ga0496106_0008646_216_1436 399
1363 3300048909 Ga0496106_0014818 Ga0496106_0014818_3255_4457 399
1364 3300048909 Ga0496106_0163455 Ga0496106_0163455_474_1676 399
1365 3300048910 Ga0496107_0013481 Ga0496107_0013481_3883_5082 399
1366 3300048910 Ga0496107_0067460 Ga0496107_0067460_1063_2283 399
1367 3300048910 Ga0496107_0202652 Ga0496107_0202652_46_1251 399
1368 3300048911 Ga0496108_0012159 Ga0496108_0012159_2907_4127 399
1369 3300048912 Ga0496109_0066894 Ga0496109_0066894_1178_2380 399
1370 3300048912 Ga0496109_0078672 Ga0496109_0078672_1099_2328 399
1371 3300048912 Ga0496109_0114351 Ga0496109_0114351_614_1816 399
1372 3300048912 Ga0496109_0171944 Ga0496109_0171944_281_1495 399
1373 3300048913 Ga0496110_0003627 Ga0496110_0003627_8690_9904 399
1374 3300048913 Ga0496110_0020318 Ga0496110_0020318_2124_3344 399
1375 3300048913 Ga0496110_0032924 Ga0496110_0032924_793_1998 399
1376 3300048913 Ga0496110_0080305 Ga0496110_0080305_1440_2675 399
1377 3300048914 Ga0496111_0045908 Ga0496111_0045908_1147_2352 399
1378 3300048914 Ga0496111_0057655 Ga0496111_0057655_1377_2591 399
1379 3300048914 Ga0496111_0095915 Ga0496111_0095915_142_1362 399
1380 3300048914 Ga0496111_0218902 Ga0496111_0218902_13_1254 399
1381 3300048915 Ga0496112_0002892 Ga0496112_0002892_1376_2578 399
1382 3300048915 Ga0496112_0044614 Ga0496112_0044614_1799_3163 399
1383 3300048915 Ga0496112_0066522 Ga0496112_0066522_2044_3243 399
1384 3300048915 Ga0496112_0181212 Ga0496112_0181212_712_1917 399
1385 3300048916 Ga0496113_0007107 Ga0496113_0007107_1524_2726 399
1386 3300048916 Ga0496113_0297112 Ga0496113_0297112_22_1221 399
1387 3300048917 Ga0496114_0001803 Ga0496114_0001803_3276_4475 399
1388 3300048917 Ga0496114_0008348 Ga0496114_0008348_2775_4004 399
1389 3300048918 Ga0496115_0019920 Ga0496115_0019920_2604_3803 399
1390 3300048918 Ga0496115_0059407 Ga0496115_0059407_397_1599 399
1391 3300048918 Ga0496115_0101116 Ga0496115_0101116_142_1347 399
1392 3300048918 Ga0496115_0124763 Ga0496115_0124763_393_1595 399
1393 3300048918 Ga0496115_0151615 Ga0496115_0151615_92_1306 399
1394 3300048920 Ga0496117_0003028 Ga0496117_0003028_14037_15236 399
1395 3300048921 Ga0496118_0002102 Ga0496118_0002102_12739_13938 399
1396 3300048921 Ga0496118_0099499 Ga0496118_0099499_170_1408 399
1397 3300048922 Ga0496119_0000375 Ga0496119_0000375_57907_59109 399
1398 3300048922 Ga0496119_0010507 Ga0496119_0010507_4555_5772 399
1399 3300048923 Ga0496120_0000453 Ga0496120_0000453_61001_62203 399
1400 3300048923 Ga0496120_0016881 Ga0496120_0016881_2475_3674 399
1401 3300048923 Ga0496120_0089304 Ga0496120_0089304_334_1533 399
1402 3300048924 Ga0496121_0011354 Ga0496121_0011354_1988_3187 399
1403 3300048924 Ga0496121_0043764 Ga0496121_0043764_1981_3198 399
1404 3300048925 Ga0496122_0001536 Ga0496122_0001536_29412_30650 399
1405 3300048925 Ga0496122_0009000 Ga0496122_0009000_2990_4189 399
1406 3300048926 Ga0496123_0001055 Ga0496123_0001055_4731_5993 399
1407 3300048926 Ga0496123_0054573 Ga0496123_0054573_1259_2458 399
1408 3300048927 Ga0496124_0007779 Ga0496124_0007779_5279_6541 399
1409 3300048928 Ga0496125_0000172 Ga0496125_0000172_137446_138684 399
1410 3300048928 Ga0496125_0003069 Ga0496125_0003069_5540_6778 399
1411 3300048928 Ga0496125_0020233 Ga0496125_0020233_1382_2581 399
1412 3300048929 Ga0496126_0000676 Ga0496126_0000676_4482_5738 399
1413 3300048929 Ga0496126_0008414 Ga0496126_0008414_5750_6949 399
1414 3300048929 Ga0496126_0009487 Ga0496126_0009487_848_2047 399
1415 3300048929 Ga0496126_0064670 Ga0496126_0064670_1500_2711 399
1416 3300049127 Ga0501306_006485 Ga0501306_006485_150_1355 399
1417 3300049568 Ga0501031_0005824 Ga0501031_0005824_4986_6191 399
1418 3300049568 Ga0501031_0089703 Ga0501031_0089703_428_1642 399
1419 3300049569 Ga0501032_0001836 Ga0501032_0001836_8927_10132 399
1420 3300049569 Ga0501032_0008992 Ga0501032_0008992_777_2015 399
1421 3300049569 Ga0501032_0013197 Ga0501032_0013197_1276_2475 399
1422 3300049570 Ga0501033_0110295 Ga0501033_0110295_651_1889 399
1423 3300049570 Ga0501033_0130203 Ga0501033_0130203_433_1638 399
1424 3300049571 Ga0501034_0000015 Ga0501034_0000015_9040_10245 399
1425 3300049571 Ga0501034_0098570 Ga0501034_0098570_1166_2404 399
1426 3300049571 Ga0501034_0171816 Ga0501034_0171816_419_1618 399
1427 3300049572 Ga0501036_0002530 Ga0501036_0002530_11498_12697 399
1428 3300049572 Ga0501036_0003852 Ga0501036_0003852_7935_9140 399
1429 3300049572 Ga0501036_0015135 Ga0501036_0015135_2991_4229 399
1430 3300049573 Ga0501037_0001123 Ga0501037_0001123_11701_12900 399
1431 3300049573 Ga0501037_0013330 Ga0501037_0013330_2409_3614 399
1432 3300049574 Ga0501038_0006115 Ga0501038_0006115_1276_2475 399
1433 3300049574 Ga0501038_0007725 Ga0501038_0007725_1069_2274 399
1434 3300049574 Ga0501038_0017810 Ga0501038_0017810_447_1685 399
1435 3300049575 Ga0501039_0001048 Ga0501039_0001048_11679_12878 399
1436 3300049575 Ga0501039_0006498 Ga0501039_0006498_1304_2509 399
1437 3300049576 Ga0501040_0022837 Ga0501040_0022837_569_1774 399
1438 3300049577 Ga0501041_0000703 Ga0501041_0000703_8913_10118 399
1439 3300049578 Ga0501042_0067621 Ga0501042_0067621_779_1984 399
1440 3300049579 Ga0501043_0000606 Ga0501043_0000606_11673_12872 399
1441 3300049579 Ga0501043_0009509 Ga0501043_0009509_183_1388 399
1442 3300049579 Ga0501043_0016803 Ga0501043_0016803_3481_4719 399
1443 3300049579 Ga0501043_0117528 Ga0501043_0117528_663_1868 399
1444 3300049580 Ga0501046_0002135 Ga0501046_0002135_8913_10118 399
1445 3300049580 Ga0501046_0003857 Ga0501046_0003857_6203_7441 399
1446 3300049581 Ga0501047_0000107 Ga0501047_0000107_49525_50727 399
1447 3300049581 Ga0501047_0008765 Ga0501047_0008765_5192_6430 399
1448 3300049582 Ga0501048_0003331 Ga0501048_0003331_2317_3522 399
1449 3300049582 Ga0501048_0164294 Ga0501048_0164294_158_1396 399
1450 3300049584 Ga0501068_0017903 Ga0501068_0017903_659_1864 399
1451 3300049584 Ga0501068_0106361 Ga0501068_0106361_54_1253 399
1452 3300049586 Ga0501070_0008759 Ga0501070_0008759_3227_4426 399
1453 3300049586 Ga0501070_0043498 Ga0501070_0043498_2046_3251 399
1454 3300049586 Ga0501070_0095453 Ga0501070_0095453_517_1731 399
1455 3300049588 Ga0501072_0006940 Ga0501072_0006940_1706_2911 399
1456 3300049588 Ga0501072_0161952 Ga0501072_0161952_515_1753 399
1457 3300049588 Ga0501072_0192834 Ga0501072_0192834_257_1471 399
1458 3300049589 Ga0501073_0016913 Ga0501073_0016913_159_1358 399
1459 3300049589 Ga0501073_0183129 Ga0501073_0183129_193_1398 399
1460 3300049590 Ga0501074_0018015 Ga0501074_0018015_2737_3942 399
1461 3300049590 Ga0501074_0090092 Ga0501074_0090092_771_1985 399
1462 3300049592 Ga0501076_0022476 Ga0501076_0022476_2459_3664 399
1463 3300049593 Ga0501077_0014871 Ga0501077_0014871_1648_2853 399
1464 3300049741 Ga0501079_0011446 Ga0501079_0011446_4049_5254 399
1465 3300049743 Ga0501081_0006271 Ga0501081_0006271_3703_4908 399
1466 3300049744 Ga0501083_0005406 Ga0501083_0005406_1859_3097 399
1467 3300049822 Ga0501035_0019336 Ga0501035_0019336_3919_5124 399
1468 3300049822 Ga0501035_0023206 Ga0501035_0023206_488_1726 399
1469 3300049823 Ga0501044_0006459 Ga0501044_0006459_4592_5821 399
1470 3300049823 Ga0501044_0007748 Ga0501044_0007748_5240_6478 399
1471 3300049823 Ga0501044_0035143 Ga0501044_0035143_328_1527 399
1472 3300050491 nmdc:mga00v17_10006_c1 nmdc:mga00v17_10006_c1_1635_2834 399
1473 3300050492 nmdc:mga0yw44_2056_c1 nmdc:mga0yw44_2056_c1_5861_7060 399
1474 3300050507 nmdc:mga05p37_11899_c1 nmdc:mga05p37_11899_c1_5691_6893 399
1475 3300050507 nmdc:mga05p37_172547_c1 nmdc:mga05p37_172547_c1_967_2196 399
1476 3300050507 nmdc:mga05p37_46755_c1 nmdc:mga05p37_46755_c1_2193_3398 399
1477 3300050508 nmdc:mga09592_199312_c1 nmdc:mga09592_199312_c1_61_1281 399
1478 3300050509 nmdc:mga0qj67_36297_c1 nmdc:mga0qj67_36297_c1_1235_2440 399
1479 3300050510 nmdc:mga06r32_111190_c1 nmdc:mga06r32_111190_c1_461_1666 399
1480 3300050510 nmdc:mga06r32_15489_c1 nmdc:mga06r32_15489_c1_1288_2493 399
1481 3300050510 nmdc:mga06r32_198_c1 nmdc:mga06r32_198_c1_4932_6203 399
1482 3300050511 nmdc:mga08y16_5920_c1 nmdc:mga08y16_5920_c1_6339_7559 399
1483 3300050512 nmdc:mga0n895_7027_c1 nmdc:mga0n895_7027_c1_2977_4197 399
1484 3300050512 nmdc:mga0n895_93647_c1 nmdc:mga0n895_93647_c1_1364_2566 399
1485 3300050512 nmdc:mga0n895_99740_c1 nmdc:mga0n895_99740_c1_211_1413 399
1486 3300050513 nmdc:mga0rr50_41993_c1 nmdc:mga0rr50_41993_c1_509_1711 399
1487 3300050513 nmdc:mga0rr50_64626_c1 nmdc:mga0rr50_64626_c1_1381_2583 399
1488 3300050514 nmdc:mga08x19_6450_c1 nmdc:mga08x19_6450_c1_124_1326 399
1489 3300050515 nmdc:mga0a205_109248_c1 nmdc:mga0a205_109248_c1_1018_2220 399
1490 3300050515 nmdc:mga0a205_38254_c1 nmdc:mga0a205_38254_c1_1815_3017 399
1491 3300050515 nmdc:mga0a205_56142_c1 nmdc:mga0a205_56142_c1_2537_3739 399
1492 3300050515 nmdc:mga0a205_8625_c2 nmdc:mga0a205_8625_c2_4066_5286 399
1493 3300050516 nmdc:mga0sz30_4791_c1 nmdc:mga0sz30_4791_c1_3462_4673 399
1494 3300053077 Ga0495601_0125810 Ga0495601_0125810_415_1617 399
1495 3300053078 Ga0495612_0029687 Ga0495612_0029687_402_1604 399
1496 3300053078 Ga0495612_0043180 Ga0495612_0043180_303_1505 399
1497 3300053084 Ga0495595_0006267 Ga0495595_0006267_50_1252 399
1498 3300053084 Ga0495595_0017594 Ga0495595_0017594_1282_2484 399
1499 3300053085 Ga0495619_0077770 Ga0495619_0077770_303_1505 399
1500 3300053085 Ga0495619_0103658 Ga0495619_0103658_296_1501 399
1501 3300053087 Ga0500643_000352 Ga0500643_000352_25306_26520 399
1502 3300053093 Ga0500651_0131400 Ga0500651_0131400_197_1399 399
1503 3300053096 Ga0500641_0035450 Ga0500641_0035450_117_1319 399
1504 3300053118 Ga0500594_0004228 Ga0500594_0004228_1324_2526 399
1505 3300053139 Ga0500568_0002651 Ga0500568_0002651_4642_5880 399
1506 3300053149 Ga0500600_0068994 Ga0500600_0068994_407_1609 399
1507 3300054114 Ga0501084_0002094 Ga0501084_0002094_10506_11711 399
1508 3300054114 Ga0501084_0028238 Ga0501084_0028238_19_1257 399
1509 3300060353 Ga0501082_0013306 Ga0501082_0013306_4786_6024 399
1510 3300060353 Ga0501082_0064397 Ga0501082_0064397_415_1620 399
1511 3300061719 Ga0466962_0028426 Ga0466962_0028426_1259_2464 399
1512 iso_pu_bacteria 2939582691 2939589358 399
1513 3300001977 JGI24746J21847_1000536 JGI24746J21847_10005365 400
1514 3300001990 JGI24737J22298_10021667 JGI24737J22298_100216672 400
1515 3300002073 JGI24745J21846_1000370 JGI24745J21846_10003702 400
1516 3300002076 JGI24749J21850_1007903 JGI24749J21850_10079031 400
1517 3300002077 JGI24744J21845_10000965 JGI24744J21845_100009654 400
1518 3300002239 JGI24034J26672_10008906 JGI24034J26672_100089061 400
1519 3300002244 JGI24742J22300_10001394 JGI24742J22300_100013942 400
1520 3300003792 Ga0055540_1004259 Ga0055540_10042593 400
1521 3300005330 Ga0070690_100027643 Ga0070690_1000276434 400
1522 3300005330 Ga0070690_100074970 Ga0070690_1000749702 400
1523 3300005334 Ga0068869_100018593 Ga0068869_1000185934 400
1524 3300005337 Ga0070682_100054024 Ga0070682_1000540242 400
1525 3300005338 Ga0068868_100000794 Ga0068868_10000079413 400
1526 3300005340 Ga0070689_100053548 Ga0070689_1000535483 400
1527 3300005341 Ga0070691_10006343 Ga0070691_100063434 400
1528 3300005347 Ga0070668_100001978 Ga0070668_10000197810 400
1529 3300005347 Ga0070668_100017923 Ga0070668_1000179234 400
1530 3300005353 Ga0070669_100027727 Ga0070669_1000277272 400
1531 3300005356 Ga0070674_100185527 Ga0070674_1001855272 400
1532 3300005365 Ga0070688_100010888 Ga0070688_1000108882 400
1533 3300005367 Ga0070667_100006829 Ga0070667_1000068298 400
1534 3300005367 Ga0070667_100092326 Ga0070667_1000923262 400
1535 3300005435 Ga0070714_100120606 Ga0070714_1001206062 400
1536 3300005437 Ga0070710_10004138 Ga0070710_100041386 400
1537 3300005437 Ga0070710_10115985 Ga0070710_101159851 400
1538 3300005439 Ga0070711_100001916 Ga0070711_1000019166 400
1539 3300005440 Ga0070705_100017002 Ga0070705_1000170023 400
1540 3300005441 Ga0070700_100007945 Ga0070700_1000079454 400
1541 3300005441 Ga0070700_100008853 Ga0070700_1000088534 400
1542 3300005455 Ga0070663_100067628 Ga0070663_1000676282 400
1543 3300005455 Ga0070663_100201281 Ga0070663_1002012811 400
1544 3300005456 Ga0070678_100011769 Ga0070678_1000117696 400
1545 3300005456 Ga0070678_100027420 Ga0070678_1000274202 400
1546 3300005457 Ga0070662_100002734 Ga0070662_1000027347 400
1547 3300005459 Ga0068867_100002956 Ga0068867_1000029565 400
1548 3300005466 Ga0070685_10022713 Ga0070685_100227134 400
1549 3300005539 Ga0068853_100028554 Ga0068853_1000285544 400
1550 3300005546 Ga0070696_100006572 Ga0070696_1000065727 400
1551 3300005547 Ga0070693_100004975 Ga0070693_1000049751 400
1552 3300005548 Ga0070665_100063798 Ga0070665_1000637982 400
1553 3300005549 Ga0070704_100005363 Ga0070704_1000053636 400
1554 3300005578 Ga0068854_100002196 Ga0068854_10000219611 400
1555 3300005615 Ga0070702_100000252 Ga0070702_10000025215 400
1556 3300005615 Ga0070702_100019881 Ga0070702_1000198813 400
1557 3300005617 Ga0068859_100001857 Ga0068859_1000018578 400
1558 3300005617 Ga0068859_100030262 Ga0068859_1000302623 400
1559 3300005718 Ga0068866_10002581 Ga0068866_100025816 400
1560 3300005719 Ga0068861_100009286 Ga0068861_1000092862 400
1561 3300005719 Ga0068861_100053137 Ga0068861_1000531373 400
1562 3300005719 Ga0068861_100082531 Ga0068861_1000825312 400
1563 3300005843 Ga0068860_100023080 Ga0068860_1000230804 400
1564 3300005843 Ga0068860_100056291 Ga0068860_1000562912 400
1565 3300005844 Ga0068862_100283589 Ga0068862_1002835891 400
1566 3300005937 Ga0081455_10142666 Ga0081455_101426661 400
1567 3300006038 Ga0075365_10018831 Ga0075365_100188313 400
1568 3300006038 Ga0075365_10035009 Ga0075365_100350092 400
1569 3300006048 Ga0075363_100002130 Ga0075363_1000021302 400
1570 3300006048 Ga0075363_100009173 Ga0075363_1000091732 400
1571 3300006048 Ga0075363_100014328 Ga0075363_1000143282 400
1572 3300006051 Ga0075364_10003955 Ga0075364_100039556 400
1573 3300006051 Ga0075364_10007221 Ga0075364_100072214 400
1574 3300006051 Ga0075364_10019257 Ga0075364_100192575 400
1575 3300006051 Ga0075364_10030027 Ga0075364_100300273 400
1576 3300006051 Ga0075364_10091633 Ga0075364_100916332 400
1577 3300006173 Ga0070716_100007759 Ga0070716_1000077596 400
1578 3300006175 Ga0070712_100021261 Ga0070712_1000212612 400
1579 3300006175 Ga0070712_100132874 Ga0070712_1001328742 400
1580 3300006178 Ga0075367_10002786 Ga0075367_100027864 400
1581 3300006178 Ga0075367_10096811 Ga0075367_100968112 400
1582 3300006186 Ga0075369_10004962 Ga0075369_100049625 400
1583 3300006186 Ga0075369_10070535 Ga0075369_100705352 400
1584 3300006353 Ga0075370_10018399 Ga0075370_100183993 400
1585 3300006844 Ga0075428_100000630 Ga0075428_10000063016 400
1586 3300006846 Ga0075430_100004627 Ga0075430_1000046277 400
1587 3300006881 Ga0068865_100000680 Ga0068865_10000068015 400
1588 3300006881 Ga0068865_100019322 Ga0068865_1000193223 400
1589 3300006931 Ga0097620_100001857 Ga0097620_10000185715 400
1590 3300006931 Ga0097620_100030263 Ga0097620_1000302633 400
1591 3300009098 Ga0105245_10001865 Ga0105245_100018655 400
1592 3300009101 Ga0105247_10001456 Ga0105247_1000145616 400
1593 3300009147 Ga0114129_10009646 Ga0114129_100096463 400
1594 3300009148 Ga0105243_10002145 Ga0105243_1000214515 400
1595 3300009176 Ga0105242_10013158 Ga0105242_100131585 400
1596 3300009177 Ga0105248_10007605 Ga0105248_100076055 400
1597 3300009553 Ga0105249_10001870 Ga0105249_100018705 400
1598 3300009553 Ga0105249_10016303 Ga0105249_100163032 400
1599 3300009553 Ga0105249_10028646 Ga0105249_100286462 400
1600 3300010375 Ga0105239_10037820 Ga0105239_100378205 400
1601 3300013105 Ga0157369_10101407 Ga0157369_101014071 400
1602 3300013297 Ga0157378_10009029 Ga0157378_100090296 400
1603 3300013306 Ga0163162_10016133 Ga0163162_100161336 400
1604 3300013307 Ga0157372_10003317 Ga0157372_100033176 400
1605 3300013308 Ga0157375_10011217 Ga0157375_100112174 400
1606 3300014969 Ga0157376_10056950 Ga0157376_100569502 400
1607 3300017792 Ga0163161_10007436 Ga0163161_100074365 400
1608 3300025303 Ga0209051_1000795 Ga0209051_100079512 400
1609 3300025898 Ga0207692_10001723 Ga0207692_100017235 400
1610 3300025899 Ga0207642_10002272 Ga0207642_100022722 400
1611 3300025900 Ga0207710_10001332 Ga0207710_100013324 400
1612 3300025901 Ga0207688_10001000 Ga0207688_1000100013 400
1613 3300025901 Ga0207688_10003558 Ga0207688_100035587 400
1614 3300025904 Ga0207647_10031084 Ga0207647_100310844 400
1615 3300025907 Ga0207645_10067665 Ga0207645_100676651 400
1616 3300025911 Ga0207654_10081089 Ga0207654_100810892 400
1617 3300025915 Ga0207693_10002493 Ga0207693_1000249314 400
1618 3300025915 Ga0207693_10031552 Ga0207693_100315524 400
1619 3300025916 Ga0207663_10005192 Ga0207663_100051923 400
1620 3300025916 Ga0207663_10005313 Ga0207663_100053135 400
1621 3300025923 Ga0207681_10032269 Ga0207681_100322693 400
1622 3300025927 Ga0207687_10004349 Ga0207687_100043493 400
1623 3300025927 Ga0207687_10011308 Ga0207687_100113084 400
1624 3300025933 Ga0207706_10002446 Ga0207706_100024465 400
1625 3300025935 Ga0207709_10010193 Ga0207709_100101935 400
1626 3300025935 Ga0207709_10114899 Ga0207709_101148992 400
1627 3300025936 Ga0207670_10034938 Ga0207670_100349382 400
1628 3300025937 Ga0207669_10000932 Ga0207669_1000093212 400
1629 3300025939 Ga0207665_10004483 Ga0207665_100044836 400
1630 3300025941 Ga0207711_10253167 Ga0207711_102531672 400
1631 3300025942 Ga0207689_10006655 Ga0207689_100066558 400
1632 3300025942 Ga0207689_10023181 Ga0207689_100231812 400
1633 3300025961 Ga0207712_10011671 Ga0207712_100116712 400
1634 3300025981 Ga0207640_10004946 Ga0207640_100049464 400
1635 3300025981 Ga0207640_10016616 Ga0207640_100166162 400
1636 3300025981 Ga0207640_10042940 Ga0207640_100429402 400
1637 3300025986 Ga0207658_10009505 Ga0207658_100095054 400
1638 3300025986 Ga0207658_10176404 Ga0207658_101764042 400
1639 3300026023 Ga0207677_10052078 Ga0207677_100520782 400
1640 3300026035 Ga0207703_10013056 Ga0207703_100130562 400
1641 3300026035 Ga0207703_10021554 Ga0207703_100215546 400
1642 3300026041 Ga0207639_10005218 Ga0207639_100052187 400
1643 3300026067 Ga0207678_10032883 Ga0207678_100328833 400
1644 3300026067 Ga0207678_10037802 Ga0207678_100378024 400
1645 3300026075 Ga0207708_10008837 Ga0207708_100088374 400
1646 3300026089 Ga0207648_10009571 Ga0207648_100095717 400
1647 3300026089 Ga0207648_10023728 Ga0207648_100237282 400
1648 3300026118 Ga0207675_100004425 Ga0207675_1000044255 400
1649 3300026118 Ga0207675_100036517 Ga0207675_1000365173 400
1650 3300026118 Ga0207675_100192367 Ga0207675_1001923672 400
1651 3300026121 Ga0207683_10125260 Ga0207683_101252602 400
1652 3300027907 Ga0207428_10099720 Ga0207428_100997201 400
1653 3300028379 Ga0268266_10068211 Ga0268266_100682111 400
1654 3300028381 Ga0268264_10012141 Ga0268264_100121415 400
1655 3300028381 Ga0268264_10052844 Ga0268264_100528442 400
1656 3300031251 Ga0265327_10008570 Ga0265327_100085705 400
1657 3300031852 Ga0307410_10057129 Ga0307410_100571292 400
1658 3300031852 Ga0307410_10155605 Ga0307410_101556052 400
1659 3300031903 Ga0307407_10080026 Ga0307407_100800262 400
1660 3300032002 Ga0307416_100133681 Ga0307416_1001336812 400
1661 3300032002 Ga0307416_100232592 Ga0307416_1002325922 400
1662 3300032002 Ga0307416_100424511 Ga0307416_1004245111 400
1663 3300032004 Ga0307414_10107423 Ga0307414_101074232 400
1664 3300032126 Ga0307415_100023748 Ga0307415_1000237482 400
1665 3300035091 Ga0373951_0019293 Ga0373951_0019293_311_1513 400
1666 3300035691 Ga0373931_0019275 Ga0373931_0019275_2171_3373 400
1667 3300037853 Ga0436364_0453470 Ga0436364_0453470_550_1770 400
1668 3300041411 Ga0439466_0020498 Ga0439466_0020498_897_2099 400
1669 3300041413 Ga0439465_0008353 Ga0439465_0008353_370_1572 400
1670 3300041413 Ga0439465_0011796 Ga0439465_0011796_529_1731 400
1671 3300042002 Ga0439442_007840 Ga0439442_007840_668_1870 400
1672 3300044656 Ga0466969_0031467 Ga0466969_0031467_550_1758 400
1673 3300044658 Ga0466972_0102840 Ga0466972_0102840_118_1320 400
1674 3300044683 Ga0466965_0014794 Ga0466965_0014794_1302_2504 400
1675 3300044684 Ga0466966_0003105 Ga0466966_0003105_1267_2475 400
1676 3300044684 Ga0466966_0074689 Ga0466966_0074689_511_1719 400
1677 3300044693 Ga0466961_0014413 Ga0466961_0014413_1170_2372 400
1678 3300044693 Ga0466961_0035925 Ga0466961_0035925_1189_2397 400
1679 3300044735 Ga0466968_0014236 Ga0466968_0014236_1007_2215 400
1680 3300044765 Ga0466970_0001205 Ga0466970_0001205_3128_4330 400
1681 3300044765 Ga0466970_0026731 Ga0466970_0026731_836_2050 400
1682 3300044842 Ga0466957_0004553 Ga0466957_0004553_4069_5277 400
1683 3300044842 Ga0466957_0024790 Ga0466957_0024790_283_1485 400
1684 3300044901 Ga0466960_0025646 Ga0466960_0025646_659_1861 400
1685 3300045049 Ga0466959_0009115 Ga0466959_0009115_1010_2218 400
1686 3300045049 Ga0466959_0017810 Ga0466959_0017810_2604_3806 400
1687 3300045836 Ga0466958_0000748 Ga0466958_0000748_4791_5999 400
1688 3300045836 Ga0466958_0075985 Ga0466958_0075985_694_1911 400
1689 3300045836 Ga0466958_0098160 Ga0466958_0098160_32_1234 400
1690 3300045976 Ga0466967_0025471 Ga0466967_0025471_695_1912 400
1691 3300045976 Ga0466967_0031995 Ga0466967_0031995_2799_4016 400
1692 3300045976 Ga0466967_0119314 Ga0466967_0119314_1111_2313 400
1693 3300047320 Ga0495672_0041435 Ga0495672_0041435_27_1235 400
1694 3300047323 Ga0495683_0002632 Ga0495683_0002632_9397_10599 400
1695 3300048903 Ga0496100_0003473 Ga0496100_0003473_918_2120 400
1696 3300048904 Ga0496101_0000193 Ga0496101_0000193_11801_13003 400
1697 3300048904 Ga0496101_0001504 Ga0496101_0001504_7323_8525 400
1698 3300048905 Ga0496102_0000403 Ga0496102_0000403_34486_35688 400
1699 3300048905 Ga0496102_0031975 Ga0496102_0031975_38_1240 400
1700 3300048905 Ga0496102_0139973 Ga0496102_0139973_267_1475 400
1701 3300048906 Ga0496103_0000284 Ga0496103_0000284_34529_35731 400
1702 3300048906 Ga0496103_0002082 Ga0496103_0002082_3149_4351 400
1703 3300048908 Ga0496105_0062054 Ga0496105_0062054_1222_2424 400
1704 3300048909 Ga0496106_0005688 Ga0496106_0005688_4046_5248 400
1705 3300048909 Ga0496106_0017751 Ga0496106_0017751_1063_2265 400
1706 3300048910 Ga0496107_0003743 Ga0496107_0003743_1667_2869 400
1707 3300048910 Ga0496107_0014415 Ga0496107_0014415_344_1546 400
1708 3300048911 Ga0496108_0006263 Ga0496108_0006263_1181_2383 400
1709 3300048911 Ga0496108_0045925 Ga0496108_0045925_728_1930 400
1710 3300048912 Ga0496109_0001398 Ga0496109_0001398_3787_4989 400
1711 3300048912 Ga0496109_0053536 Ga0496109_0053536_1999_3201 400
1712 3300048912 Ga0496109_0257216 Ga0496109_0257216_410_1612 400
1713 3300048915 Ga0496112_0017061 Ga0496112_0017061_4041_5243 400
1714 3300048917 Ga0496114_0015343 Ga0496114_0015343_2429_3631 400
1715 3300048918 Ga0496115_0003426 Ga0496115_0003426_5582_6784 400
1716 3300048919 Ga0496116_0000059 Ga0496116_0000059_11619_12821 400
1717 3300048920 Ga0496117_0000055 Ga0496117_0000055_261690_262892 400
1718 3300048921 Ga0496118_0000879 Ga0496118_0000879_34536_35738 400
1719 3300048922 Ga0496119_0016974 Ga0496119_0016974_628_1830 400
1720 3300048923 Ga0496120_0016566 Ga0496120_0016566_3162_4364 400
1721 3300048924 Ga0496121_0001114 Ga0496121_0001114_11627_12829 400
1722 3300048928 Ga0496125_0051644 Ga0496125_0051644_1274_2482 400
1723 3300048929 Ga0496126_0005915 Ga0496126_0005915_11723_12925 400
1724 3300049569 Ga0501032_0005443 Ga0501032_0005443_6492_7709 400
1725 3300049571 Ga0501034_0005064 Ga0501034_0005064_1879_3096 400
1726 3300049579 Ga0501043_0046336 Ga0501043_0046336_813_2030 400
1727 3300049580 Ga0501046_0001735 Ga0501046_0001735_15016_16233 400
1728 3300049581 Ga0501047_0002183 Ga0501047_0002183_1533_2750 400
1729 3300049585 Ga0501069_0066513 Ga0501069_0066513_701_1918 400
1730 3300049589 Ga0501073_0024223 Ga0501073_0024223_1469_2686 400
1731 3300049742 Ga0501080_0091423 Ga0501080_0091423_1029_2246 400
1732 3300049822 Ga0501035_0014942 Ga0501035_0014942_1805_3022 400
1733 3300049823 Ga0501044_0005882 Ga0501044_0005882_9311_10528 400
1734 3300050489 nmdc:mga03683_17583_c1 nmdc:mga03683_17583_c1_341_1543 400
1735 3300050490 nmdc:mga03n38_1081_c1 nmdc:mga03n38_1081_c1_5530_6735 400
1736 3300050490 nmdc:mga03n38_38141_c1 nmdc:mga03n38_38141_c1_605_1807 400
1737 3300050491 nmdc:mga00v17_16972_c1 nmdc:mga00v17_16972_c1_152_1357 400
1738 3300050491 nmdc:mga00v17_3299_c1 nmdc:mga00v17_3299_c1_3203_4405 400
1739 3300050491 nmdc:mga00v17_3766_c1 nmdc:mga00v17_3766_c1_6385_7602 400
1740 3300050491 nmdc:mga00v17_72057_c1 nmdc:mga00v17_72057_c1_655_1857 400
1741 3300050491 nmdc:mga00v17_9193_c1 nmdc:mga00v17_9193_c1_2931_4133 400
1742 3300050492 nmdc:mga0yw44_4555_c1 nmdc:mga0yw44_4555_c1_4063_5265 400
1743 3300050494 nmdc:mga06z11_11779_c1 nmdc:mga06z11_11779_c1_673_1878 400
1744 3300050496 nmdc:mga07m45_113737_c1 nmdc:mga07m45_113737_c1_233_1435 400
1745 3300050496 nmdc:mga07m45_18278_c1 nmdc:mga07m45_18278_c1_750_1952 400
1746 3300050496 nmdc:mga07m45_3115_c1 nmdc:mga07m45_3115_c1_4350_5552 400
1747 3300050496 nmdc:mga07m45_47346_c1 nmdc:mga07m45_47346_c1_195_1397 400
1748 3300050496 nmdc:mga07m45_7793_c1 nmdc:mga07m45_7793_c1_1802_3007 400
1749 3300050507 nmdc:mga05p37_59920_c1 nmdc:mga05p37_59920_c1_721_1923 400
1750 3300050509 nmdc:mga0qj67_3435_c1 nmdc:mga0qj67_3435_c1_8964_10166 400
1751 3300050510 nmdc:mga06r32_77316_c1 nmdc:mga06r32_77316_c1_565_1767 400
1752 3300050516 nmdc:mga0sz30_65576_c1 nmdc:mga0sz30_65576_c1_181_1386 400
1753 3300050516 nmdc:mga0sz30_656_c1 nmdc:mga0sz30_656_c1_2358_3560 400
1754 3300050516 nmdc:mga0sz30_8114_c1 nmdc:mga0sz30_8114_c1_1048_2250 400
1755 3300053131 Ga0500652_058759 Ga0500652_058759_161_1369 400
1756 3300053134 Ga0500658_0039444 Ga0500658_0039444_330_1538 400
1757 3300053153 Ga0500616_0064516 Ga0500616_0064516_594_1799 400
1758 3300053730 Ga0500645_000128 Ga0500645_000128_15996_17204 400
1759 3300061719 Ga0466962_0006025 Ga0466962_0006025_2764_3966 400

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00764

Arginosuc_synth

Arginosuccinate synthase N-terminal HUP domain

4

165

0.99

PF20979

Arginosuc_syn_C

Arginosuccinate synthase C-terminal domain

174

391

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xfj-assembly1.cif.gz_A-2 crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine 0.9851 2 397
4xfj-assembly1.cif.gz_B crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine 0.984 2 397
4u7j-assembly1.cif.gz_B-2 crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile 0.9821 3 397
4xfj-assembly1.cif.gz_A-2 crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine 0.9802 2 397
4xfj-assembly1.cif.gz_B crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine 0.9791 2 397
ID Description Score Start End Superfamily
4xfjA02 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9983 175 361 3.90.1260.10
4xfjA02 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9929 175 361 3.90.1260.10
af_A0A0R0IGZ2_74_244_3.90.1260.10 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9816 175 344 3.90.1260.10
1kh1C02 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9778 66 355 3.90.1260.10
af_A0A0P0Y1E8_15_149_3.90.1260.10 Alpha Beta;Alpha-Beta Complex;Argininosuccinate synthetase, chain A, domain 2;Argininosuccinate synthetase, chain A, domain 2 0.9736 252 378 3.90.1260.10
ID Description Score Start End GO Terms
AF-A0A3D1ZR42-F1-model_v4 Argininosuccinate synthase (EC 6.3.4.5) 0.9997 3 73 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526
AF-A0A0E3N9I3-F1-model_v4 argininosuccinate synthase (EC 6.3.4.5) 0.9991 183 352 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526
AF-A0A7G1ICP1-F1-model_v4 argininosuccinate synthase (EC 6.3.4.5) 0.9973 235 397 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526
AF-A0A3E2CCP6-F1-model_v4 Argininosuccinate synthase (EC 6.3.4.5) 0.9969 3 147 GO:0000050
GO:0000053
GO:0004055
GO:0005524
GO:0005737
GO:0006526
AF-A0A365UVF0-F1-model_v4 deleted 0.995 1 398

Feature Viewer

pLDDT pTM Quality
93.02 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map