F495557

General Info

Members Datasets Scaffolds Average Seq Length
1746 1209 866 245

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0002950|Ga0496119_0002950_9394_10170
Length 258
Sequence MILFPAIDLKDGQCVRLKFGDMDQATVYNEDPAAQAKAFEDQGFEWLHVVDLNGAFAGESVNGKAVEAILKATKNPVQLGGGIRTLAHIESWLSKGLRRVILGTVAVRDPALVIEACKEFPGQVAVGIDAKGGYVAVEGWAEASELGVVELAKKFEGAGVAAIIYTDIDRDGVLAGINWDSTLGLADSVSIPVIASGGLASMEDIKRLAAPDARKLEGAISGRALYDGRIDPTEALALLAASPAAAERRGRASEGTSV

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
8 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
9 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
10 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
11 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
12 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
13 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
14 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
15 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
16 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
17 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
18 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
19 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
20 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
21 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
22 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
23 2512875024 Mesorhizobium loti R88b Isolate Nodule
24 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
25 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
26 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
27 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
28 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
29 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
30 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
31 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
32 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
33 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
34 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
35 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
36 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
37 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
38 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
39 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
40 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
41 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
42 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
43 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
44 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
45 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
46 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
47 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
48 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
49 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
50 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
51 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
52 2516143018 Ensifer sp. BR816 Isolate Nodule
53 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
54 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
55 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
56 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
57 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
58 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
59 2519899620 Rhizobium sp. Pop5 Isolate Nodule
60 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
61 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
62 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
63 2534681786 Brucella suis 92/29 Isolate Unclassified
64 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
65 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
66 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
67 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
68 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
69 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
70 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
71 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
72 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
73 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
74 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
75 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
76 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
77 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
78 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
79 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
80 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
81 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
82 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
83 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
84 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
85 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
86 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
87 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
88 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
89 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
90 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
91 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
92 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
93 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
94 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
95 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
96 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
97 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
98 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
99 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
100 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
101 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
102 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
103 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
104 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
105 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
106 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
107 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
108 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
109 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
110 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
111 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
112 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
113 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
114 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
115 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
116 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
117 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
118 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
119 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
120 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
121 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
122 2643221557 Ensifer sp. Root558 Isolate Unclassified
123 2643221558 Rhizobium sp. Root149 Isolate Unclassified
124 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
125 2643221568 Rhizobium sp. Root564 Isolate Unclassified
126 2643221582 Rhizobium sp. Root651 Isolate Unclassified
127 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
128 2643221599 Rhizobium sp. Root708 Isolate Unclassified
129 2643221607 Rhizobium sp. Root73 Isolate Unclassified
130 2643221610 Ensifer sp. Root74 Isolate Unclassified
131 2643221618 Ensifer sp. Root231 Isolate Unclassified
132 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
133 2643221626 Ensifer sp. Root31 Isolate Unclassified
134 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
135 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
136 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
137 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
138 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
139 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
140 2643221655 Ensifer sp. Root1252 Isolate Unclassified
141 2643221659 Ensifer sp. Root127 Isolate Unclassified
142 2643221668 Ensifer sp. Root423 Isolate Unclassified
143 2643221674 Devosia sp. Root436 Isolate Unclassified
144 2643221675 Ensifer sp. Root1298 Isolate Unclassified
145 2643221680 Ensifer sp. Root1312 Isolate Unclassified
146 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
147 2643221688 Rhizobium sp. Root482 Isolate Unclassified
148 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
149 2643221693 Rhizobium sp. Root491 Isolate Unclassified
150 2643221698 Ensifer sp. Root142 Isolate Unclassified
151 2643221712 Ensifer sp. Root258 Isolate Unclassified
152 2643221718 Rhizobium sp. Root268 Isolate Unclassified
153 2643221719 Rhizobium sp. Root274 Isolate Unclassified
154 2643221723 Ensifer sp. Root278 Isolate Unclassified
155 2643221726 Ensifer sp. Root954 Isolate Unclassified
156 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
157 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
158 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
159 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
160 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
161 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
162 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
163 2718217882 Rhizobium sp. N741 Isolate Nodule
164 2718217927 Rhizobium sp. N324 Isolate Nodule
165 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
166 2718218009 Rhizobium sp. N561 Isolate Nodule
167 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
168 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
169 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
170 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
171 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
172 2718218363 Rhizobium sp. N113 Isolate Nodule
173 2718218365 Rhizobium sp. N731 Isolate Nodule
174 2718218366 Rhizobium sp. N621 Isolate Nodule
175 2718218423 Rhizobium sp. N941 Isolate Nodule
176 2721755514 Rhizobium sp. N6212 Isolate Nodule
177 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
178 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
179 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
180 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
181 2721755809 Rhizobium sp. N541 Isolate Nodule
182 2721755810 Rhizobium sp. N871 Isolate Nodule
183 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
184 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
185 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
186 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
187 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
188 2728369365 Rhizobium sp. N1341 Isolate Nodule
189 2728369397 Rhizobium sp. N1314 Isolate Nodule
190 2738541293 Rhizobium sp. GV031 Isolate Unclassified
191 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
192 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
193 2738543024 Aminobacter sp. AP02 Isolate Unclassified
194 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
195 2751185800 Brucella pituitosa AA2 Isolate Unclassified
196 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
197 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
198 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
199 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
200 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
201 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
202 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
203 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
204 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
205 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
206 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
207 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
208 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
209 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
210 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
211 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
212 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
213 2791355256 Rhizobium sp. M10 Isolate Nodule
214 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
215 2791355260 Rhizobium sp. L9 Isolate Nodule
216 2791355261 Rhizobium sp. J15 Isolate Nodule
217 2791355262 Rhizobium sp. M1 Isolate Nodule
218 2791355263 Rhizobium chutanense C5 Isolate Nodule
219 2791355264 Rhizobium sp. S9 Isolate Nodule
220 2791355265 Rhizobium sp. H4 Isolate Nodule
221 2791355266 Rhizobium sp. L43 Isolate Nodule
222 2791355267 Rhizobium sp. L18 Isolate Nodule
223 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
224 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
225 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
226 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
227 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
228 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
229 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
230 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
231 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
232 2802429633 Rhizobium anhuiense J3 Isolate Nodule
233 2802429634 Rhizobium anhuiense S10 Isolate Nodule
234 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
235 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
236 2802429637 Rhizobium anhuiense C15 Isolate Nodule
237 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
238 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
239 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
240 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
241 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
242 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
243 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
244 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
245 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
246 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
247 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
248 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
249 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
250 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
251 2838048938 Rhizobium pisi 27/80 Isolate Nodule
252 2838061910 Rhizobium phaseoli L15 Isolate Nodule
253 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
254 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
255 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
256 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
257 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
258 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
259 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
260 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
261 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
262 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
263 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
264 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
265 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
266 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
267 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
268 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
269 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
270 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
271 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
272 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
273 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
274 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
275 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
276 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
277 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
278 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
279 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
280 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
281 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
282 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
283 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
284 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
285 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
286 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
287 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
288 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
289 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
290 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
291 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
292 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
293 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
294 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
295 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
296 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
297 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
298 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
299 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
300 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
301 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
302 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
303 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
304 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
305 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
306 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
307 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
308 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
309 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
310 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
311 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
312 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
313 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
314 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
315 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
316 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
317 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
318 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
319 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
320 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
321 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
322 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
323 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
324 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
325 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
326 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
327 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
328 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
329 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
330 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
331 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
332 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
333 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
334 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
335 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
336 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
337 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
338 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
339 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
340 2844163670 Ensifer sp. 1H6 Isolate Unclassified
341 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
342 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
343 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
344 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
345 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
346 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
347 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
348 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
349 2854911287 Brucella lupini LUP21 Isolate Unclassified
350 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
351 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
352 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
353 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
354 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
355 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
356 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
357 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
358 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
359 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
360 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
361 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
362 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
363 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
364 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
365 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
366 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
367 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
368 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
369 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
370 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
371 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
372 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
373 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
374 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
375 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
376 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
377 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
378 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
379 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
380 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
381 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
382 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
383 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
384 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
385 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
386 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
387 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
388 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
389 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
390 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
391 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
392 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
393 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
394 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
395 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
396 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
397 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
398 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
399 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
400 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
401 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
402 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
403 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
404 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
405 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
406 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
407 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
408 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
409 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
410 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
411 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
412 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
413 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
414 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
415 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
416 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
417 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
418 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
419 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
420 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
421 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
422 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
423 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
424 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
425 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
426 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
427 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
428 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
429 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
430 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
431 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
432 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
433 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
434 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
435 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
436 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
437 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
438 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
439 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
440 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
441 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
442 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
443 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
444 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
445 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
446 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
447 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
448 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
449 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
450 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
451 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
452 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
453 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
454 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
455 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
456 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
457 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
458 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
459 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
460 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
461 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
462 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
463 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
464 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
465 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
466 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
467 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
468 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
469 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
470 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
471 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
472 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
473 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
474 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
475 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
476 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
477 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
478 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
479 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
480 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
481 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
482 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
483 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
484 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
485 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
486 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
487 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
488 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
489 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
490 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
491 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
492 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
493 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
494 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
495 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
496 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
497 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
498 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
499 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
500 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
501 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
502 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
503 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
504 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
505 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
506 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
507 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
508 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
509 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
510 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
511 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
512 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
513 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
514 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
515 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
516 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
517 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
518 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
519 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
520 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
521 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
522 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
523 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
524 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
525 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
526 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
527 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
528 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
529 2932401849 Devosia sp. 2618 Isolate Rhizosphere
530 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
531 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
532 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
533 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
534 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
535 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
536 2933599457 Rhizobium phaseoli M3 Isolate Nodule
537 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
538 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
539 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
540 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
541 2936381700 Rhizobium chutanense C16 Isolate Unclassified
542 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
543 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
544 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
545 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
546 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
547 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
548 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
549 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
550 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
551 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
552 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
553 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
554 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
555 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
556 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
557 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
558 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
559 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
560 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
561 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
562 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
563 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
564 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
565 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
566 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
567 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
568 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
569 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
570 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
571 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
572 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
573 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
574 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
575 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
576 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
577 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
578 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
579 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
580 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
581 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
582 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
583 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
584 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
585 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
586 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
587 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
588 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
589 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
590 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
591 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
592 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
593 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
594 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
595 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
596 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
597 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
598 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
599 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
600 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
601 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
602 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
603 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
604 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
605 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
606 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
607 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
608 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
609 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
610 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
611 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
612 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
613 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
614 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
615 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
616 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
617 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
618 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
619 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
620 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
621 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
622 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
623 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
624 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
625 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
626 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
627 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
628 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
629 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
630 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
631 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
632 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
633 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
634 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
635 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
636 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
637 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
638 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
639 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
640 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
641 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
642 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
643 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
644 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
645 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
646 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
647 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
648 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
649 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
650 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
651 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
652 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
653 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
654 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
655 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
656 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
657 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
658 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
659 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
660 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
661 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
662 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
663 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
664 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
665 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
666 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
667 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
668 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
669 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
670 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
671 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
672 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
673 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
674 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
675 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
676 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
677 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
678 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
679 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
680 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
681 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
682 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
683 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
684 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
685 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
686 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
687 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
688 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
689 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
690 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
691 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
692 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
693 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
694 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
695 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
696 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
697 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
698 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
699 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
700 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
701 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
702 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
703 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
704 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
705 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
706 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
707 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
708 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
709 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
710 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
711 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
712 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
713 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
714 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
715 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
716 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
717 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
718 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
719 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
720 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
721 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
722 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
723 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
724 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
725 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
726 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
727 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
728 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
729 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
730 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
731 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
732 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
733 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
734 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
735 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
736 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
737 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
738 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
739 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
740 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
741 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
742 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
743 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
744 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
745 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
746 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
747 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
748 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
749 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
750 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
751 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
752 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
753 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
754 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
755 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
756 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
757 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
758 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
759 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
760 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
761 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
762 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
763 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
764 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
765 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
766 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
767 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
768 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
769 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
770 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
771 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
772 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
773 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
774 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
775 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
776 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
777 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
778 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
779 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
780 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
781 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
782 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
783 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
784 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
785 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
786 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
787 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
788 2996887358 Rhizobium sp. R711 Isolate Nodule
789 2996893221 Rhizobium sp. R635 Isolate Nodule
790 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
791 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
792 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
793 3004167301 Mesorhizobium loti 582 Isolate Unclassified
794 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
795 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
796 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
797 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
798 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
799 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
800 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
801 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
802 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
803 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
804 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
805 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
806 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
807 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
808 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
809 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
810 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
811 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
812 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
813 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
814 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
815 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
816 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
817 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
818 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
819 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
820 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
821 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
822 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
823 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
824 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
825 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
826 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
827 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
828 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
829 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
830 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
831 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
832 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
833 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
834 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
835 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
836 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
837 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
838 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
839 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
840 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
841 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
842 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
843 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
844 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
845 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
846 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
847 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
848 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
849 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
850 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
851 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
852 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
853 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
854 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
855 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
856 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
857 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
858 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
859 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
860 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
861 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
862 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
863 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
864 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
865 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
866 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
867 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
868 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
869 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
870 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
871 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
872 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
873 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
874 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
875 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
876 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
877 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
878 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
879 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
880 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
881 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
882 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
883 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
884 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
885 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
886 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
887 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
888 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
889 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
890 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
891 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
892 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
893 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
894 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
895 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
896 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
897 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
898 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
899 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
900 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
901 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
902 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
903 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
904 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
905 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
906 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
907 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
908 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
909 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
910 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
911 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
912 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
913 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
914 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
915 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
916 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
917 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
918 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
919 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
920 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
921 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
922 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
923 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
924 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
925 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
926 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
927 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
928 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
929 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
930 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
931 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
932 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
933 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
934 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
935 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
936 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
937 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
938 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
939 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
940 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
941 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
942 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
943 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
944 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
945 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
946 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
947 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
948 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
949 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
950 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
951 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
952 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
953 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
954 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
955 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
956 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
957 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
958 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
959 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
960 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
961 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
962 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
963 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
964 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
965 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
966 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
967 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
968 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
969 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
970 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
971 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
972 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
973 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
974 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
975 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
976 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
977 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
978 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
979 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
980 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
981 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
982 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
983 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
984 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
985 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
986 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
987 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
988 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
989 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
990 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
991 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
992 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
993 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
994 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
995 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
996 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
997 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
998 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
999 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
1000 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
1001 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
1002 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
1003 3300041504 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT Metatranscriptome Unclassified
1004 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
1005 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
1006 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
1007 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
1008 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1009 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
1010 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
1011 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
1012 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
1013 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1014 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
1015 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
1016 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1017 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1018 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1019 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1020 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1021 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
1022 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
1023 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1024 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1025 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1026 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1027 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1028 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1029 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1030 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1031 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1032 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1033 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1034 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1035 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1036 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1037 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
1038 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1039 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1040 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1041 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
1042 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1043 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
1044 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1045 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1046 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1047 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1048 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1049 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1050 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1051 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1052 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1053 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1054 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1055 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1056 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
1057 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1058 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1059 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1060 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1061 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1062 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1063 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1064 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1065 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1066 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1067 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1068 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1069 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1070 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1071 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1072 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1073 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1074 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1075 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1076 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1077 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1078 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1079 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1080 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1081 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1082 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1083 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1084 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1085 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1086 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1087 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1088 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1089 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1090 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1091 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1092 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1093 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1094 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1095 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1096 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1097 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1098 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1099 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1100 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1101 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1103 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
1104 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1106 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1107 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1108 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1109 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1110 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1111 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1112 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1113 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1114 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1115 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1116 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1117 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1118 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
1119 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
1120 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1121 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1122 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1123 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1124 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1125 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1126 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1127 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1128 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1129 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1130 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1131 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
1132 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1133 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1134 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
1135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1136 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
1137 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1138 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1140 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1141 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1142 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1143 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1144 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1145 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1146 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1147 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1148 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1149 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1150 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1151 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1152 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1153 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1154 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1155 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1156 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1157 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1158 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1159 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1160 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1161 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1162 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1163 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1164 8005258706 Rhizobium sp. R693 Isolate Nodule
1165 8005275841 Rhizobium sp. N4311 Isolate Nodule
1166 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1167 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1168 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1169 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1170 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1171 8005321885 Rhizobium sp. R72 Isolate Nodule
1172 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1173 8005382845 Rhizobium sp. R634 Isolate Nodule
1174 8005395548 Rhizobium sp. R339 Isolate Nodule
1175 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1176 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1177 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1178 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1179 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1180 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1181 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1182 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1183 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1184 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1185 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1186 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1187 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1188 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1189 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1190 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1191 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1192 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1193 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1194 8018176218 Rhizobium sp. N122 Isolate Nodule
1195 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1196 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1197 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1198 8024501048 Rhizobium sp. H4 Isolate Nodule
1199 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1200 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1201 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1202 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1203 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1204 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1205 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1206 8056382006 Rhizobium croatiense 13T Isolate Nodule
1207 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1208 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1209 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 49.2
Metatranscriptomes 0.4
Isolates 50.4

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 15.18
Nodule 39.06
Rhizoplane 1.6
Rhizosphere 27.95
Stem 0
Stem Tuber 0
Unclassified 15.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006155 3300001979 Bacteria 5005
2 JGI24740J21852_10038669 3300001979 Bacteria 1462
3 JGI24740J21852_10042192 3300001979 Bacteria 1369
4 JGI24740J21852_10062525 3300001979 Bacteria 1022
5 JGI24739J22299_10024983 3300001989 Bacteria 2103
6 JGI24739J22299_10060935 3300001989 Bacteria 1193
7 JGI24735J21928_10022063 3300002067 Bacteria 1941
8 JGI25155J39150_1000018 3300002704 Bacteria 157606
9 JGI25156J39149_1000055 3300002705 Bacteria 87733
10 JGI25156J39149_1003248 3300002705 Bacteria 5410
11 JGI25162J39368_1000947 3300002737 Bacteria 18623
12 JGI25162J39368_1003062 3300002737 Bacteria 5396
13 JGI25154J39366_1000384 3300002738 Bacteria 24221
14 JGI25158J39367_1000055 3300002739 Bacteria 25879
15 JGI25157J39369_1000076 3300002741 Bacteria 87678
16 JGI25157J39369_1001109 3300002741 Bacteria 11987
17 JGI25152J39213_1000309 3300002773 Bacteria 31571
18 JGI25152J39213_1000648 3300002773 Bacteria 18401
19 JGI25152J39213_1001491 3300002773 Bacteria 9993
20 JGI25152J39213_1002000 3300002773 Bacteria 8042
21 JGI25152J39213_1014405 3300002773 Bacteria 1605
22 JGI25152J39213_1014413 3300002773 Bacteria 1605
23 JGI25150J39212_1000018 3300002774 Bacteria 146535
24 JGI25150J39212_1004906 3300002774 Bacteria 2914
25 JGI25150J39212_1008805 3300002774 Bacteria 1956
26 JGI25159J45721_1000022 3300002987 Bacteria 119463
27 JGI25159J45721_1001234 3300002987 Bacteria 10806
28 JGI25159J45721_1002837 3300002987 Bacteria 6363
29 JGI25151J46595_10000034 3300003187 Bacteria 192271
30 JGI25151J46595_10000554 3300003187 Bacteria 34028
31 JGI25151J46595_10011026 3300003187 Bacteria 4172
32 JGI25151J46595_10019122 3300003187 Bacteria 2919
33 JGI25151J46595_10022565 3300003187 Bacteria 2610
34 JGI25406J46586_10008175 3300003203 Bacteria 4750
35 JGI25165J46597_1000078 3300003214 Bacteria 179320
36 JGI25165J46597_1001060 3300003214 Bacteria 17691
37 JGI25165J46597_1001760 3300003214 Bacteria 9427
38 JGI25153J46596_10011306 3300003215 Bacteria 3956
39 JGI25153J46596_10016620 3300003215 Bacteria 2937
40 JGI25153J46596_10024895 3300003215 Bacteria 2149
41 JGI25153J46596_10027599 3300003215 Bacteria 1985
42 JGI25153J46596_10030991 3300003215 Bacteria 1809
43 JGI25153J46596_10030993 3300003215 Bacteria 1809
44 JGI25160J50197_1000051 3300003354 Bacteria 132923
45 JGI25160J50197_1000056 3300003354 Bacteria 119463
46 JGI25160J50197_1000329 3300003354 Bacteria 32252
47 JGI25160J50197_1014944 3300003354 Bacteria 2571
48 JGI25160J50197_1018030 3300003354 Bacteria 2214
49 JGI25161J50226_1000011 3300003374 Bacteria 210140
50 JGI25161J50226_1000192 3300003374 Bacteria 39913
51 JGI25161J50226_1000328 3300003374 Bacteria 25873
52 JGI25161J50226_1004069 3300003374 Bacteria 3152
53 Ga0006562J51391_1044137 3300003578 Bacteria 1439
54 Ga0055542_1001659 3300003762 Bacteria 9937
55 Ga0055526_1003086 3300003771 Bacteria 10819
56 Ga0055526_1011560 3300003771 Bacteria 3960
57 Ga0055526_1016525 3300003771 Bacteria 2880
58 Ga0055526_1023503 3300003771 Bacteria 2054
59 Ga0055526_1023826 3300003771 Bacteria 2028
60 Ga0055524_1002222 3300003775 Bacteria 10168
61 Ga0055524_1003145 3300003775 Bacteria 8134
62 Ga0055524_1005310 3300003775 Bacteria 5782
63 Ga0055524_1009053 3300003775 Bacteria 4084
64 Ga0055524_1018007 3300003775 Bacteria 2469
65 Ga0055524_1023743 3300003775 Bacteria 1967
66 Ga0055536_1036349 3300003781 Bacteria 1219
67 Ga0055528_1000840 3300003790 Bacteria 20921
68 Ga0055528_1005904 3300003790 Bacteria 5617
69 Ga0055528_1006719 3300003790 Bacteria 5183
70 Ga0055528_1013061 3300003790 Bacteria 3177
71 Ga0055528_1022347 3300003790 Bacteria 1973
72 Ga0055528_1050015 3300003790 Bacteria 852
73 Ga0055530_10047995 3300003791 Bacteria 1006
74 Ga0055540_1000886 3300003792 Bacteria 19743
75 Ga0055540_1003139 3300003792 Bacteria 8179
76 Ga0055540_1004541 3300003792 Bacteria 6190
77 Ga0055540_1011350 3300003792 Bacteria 2881
78 Ga0055531_10001474 3300003794 Bacteria 17319
79 Ga0055531_10027636 3300003794 Bacteria 1983
80 Ga0055543_1000041 3300004625 Bacteria 118501
81 Ga0055543_1000180 3300004625 Bacteria 52220
82 Ga0055543_1000205 3300004625 Bacteria 48094
83 Ga0055543_1000322 3300004625 Bacteria 33145
84 Ga0065165_1000155 3300005262 Bacteria 119501
85 Ga0065165_1000303 3300005262 Bacteria 82513
86 Ga0065165_1008578 3300005262 Bacteria 4752
87 Ga0065165_1009018 3300005262 Bacteria 4550
88 Ga0065165_1017999 3300005262 Bacteria 2579
89 Ga0065704_10241189 3300005289 Bacteria 1015
90 Ga0070658_10036715 3300005327 Bacteria 3949
91 Ga0070670_100000217 3300005331 Bacteria 53128
92 Ga0070670_100345398 3300005331 Bacteria 1307
93 Ga0070680_100043877 3300005336 Bacteria 3633
94 Ga0070660_100108479 3300005339 Bacteria 2207
95 Ga0070668_100009043 3300005347 Bacteria 7398
96 Ga0070669_100018736 3300005353 Bacteria 4948
97 Ga0070669_100079363 3300005353 Bacteria 2441
98 Ga0070669_100109115 3300005353 Bacteria 2098
99 Ga0070669_100220952 3300005353 Bacteria 1498
100 Ga0070671_100013359 3300005355 Bacteria 6620
101 Ga0070674_100174359 3300005356 Bacteria 1642
102 Ga0070663_100091605 3300005455 Bacteria 2253
103 Ga0070663_100786271 3300005455 Bacteria 815
104 Ga0070662_100296050 3300005457 Bacteria 1313
105 Ga0068867_100464038 3300005459 Bacteria 1082
106 Ga0068853_100013757 3300005539 Bacteria 6610
107 Ga0068853_100022250 3300005539 Bacteria 5293
108 Ga0068853_100303606 3300005539 Bacteria 1476
109 Ga0070696_100292561 3300005546 Bacteria 1245
110 Ga0070665_100010257 3300005548 Bacteria 9480
111 Ga0070665_100060919 3300005548 Bacteria 3783
112 Ga0070665_100091369 3300005548 Bacteria 3049
113 Ga0070665_100141205 3300005548 Bacteria 2411
114 Ga0070665_100453414 3300005548 Bacteria 1292
115 Ga0070665_100699333 3300005548 Bacteria 1027
116 Ga0068855_100197680 3300005563 Bacteria 2265
117 Ga0068857_100335529 3300005577 Bacteria 1398
118 Ga0068854_100028161 3300005578 Bacteria 3879
119 Ga0068854_100120124 3300005578 Bacteria 1994
120 Ga0068856_100051454 3300005614 Bacteria 4061
121 Ga0068856_100080282 3300005614 Bacteria 3235
122 Ga0068856_100183254 3300005614 Bacteria 2107
123 Ga0068852_100008312 3300005616 Bacteria 7638
124 Ga0081455_10123737 3300005937 Bacteria 2034
125 Ga0081539_10000690 3300005985 Bacteria 67656
126 Ga0075365_10000540 3300006038 Bacteria 14537
127 Ga0075365_10006590 3300006038 Bacteria 6405
128 Ga0075365_10012733 3300006038 Bacteria 5006
129 Ga0075365_10042272 3300006038 Bacteria 2979
130 Ga0075365_10043478 3300006038 Bacteria 2941
131 Ga0075365_10049634 3300006038 Bacteria 2765
132 Ga0075365_10052274 3300006038 Bacteria 2701
133 Ga0075365_10150975 3300006038 Bacteria 1616
134 Ga0075365_10157444 3300006038 Bacteria 1581
135 Ga0075365_10309110 3300006038 Bacteria 1113
136 Ga0075365_10431060 3300006038 Bacteria 931
137 Ga0075368_10001546 3300006042 Bacteria 7380
138 Ga0075368_10137886 3300006042 Bacteria 1016
139 Ga0075363_100007089 3300006048 Bacteria 5127
140 Ga0075363_100041815 3300006048 Bacteria 2418
141 Ga0075363_100228598 3300006048 Bacteria 1067
142 Ga0075363_100234736 3300006048 Bacteria 1053
143 Ga0075363_100417597 3300006048 Bacteria 789
144 Ga0075364_10025945 3300006051 Bacteria 3734
145 Ga0075364_10084053 3300006051 Bacteria 2107
146 Ga0075364_10086681 3300006051 Bacteria 2075
147 Ga0075364_10244059 3300006051 Bacteria 1220
148 Ga0075362_10014363 3300006177 Bacteria 3194
149 Ga0075362_10064135 3300006177 Bacteria 1666
150 Ga0075362_10076286 3300006177 Bacteria 1539
151 Ga0075367_10002288 3300006178 Bacteria 8689
152 Ga0075367_10012889 3300006178 Bacteria 4478
153 Ga0075367_10073208 3300006178 Bacteria 2064
154 Ga0075367_10172603 3300006178 Bacteria 1347
155 Ga0075367_10188953 3300006178 Bacteria 1285
156 Ga0075369_10001016 3300006186 Bacteria 9361
157 Ga0075369_10040815 3300006186 Bacteria 1984
158 Ga0075369_10041825 3300006186 Bacteria 1962
159 Ga0075369_10065239 3300006186 Bacteria 1595
160 Ga0075369_10100141 3300006186 Bacteria 1299
161 Ga0075366_10004165 3300006195 Bacteria 7748
162 Ga0075366_10190134 3300006195 Bacteria 1248
163 Ga0075370_10013312 3300006353 Bacteria 4368
164 Ga0075370_10098820 3300006353 Bacteria 1688
165 Ga0075428_100142461 3300006844 Bacteria 2606
166 Ga0079104_1000534 3300006946 Bacteria 40267
167 Ga0099826_10000099 3300006948 Bacteria 40813
168 Ga0099826_10011043 3300006948 Bacteria 6789
169 Ga0105251_10069616 3300009011 Bacteria 1640
170 Ga0105240_10000142 3300009093 Bacteria 146932
171 Ga0105240_10142647 3300009093 Bacteria 2862
172 Ga0105240_10164299 3300009093 Bacteria 2634
173 Ga0105240_10190548 3300009093 Bacteria 2412
174 Ga0105240_10265159 3300009093 Bacteria 1980
175 Ga0105247_10287551 3300009101 Bacteria 1136
176 Ga0105241_10052607 3300009174 Bacteria 3110
177 Ga0105248_10171324 3300009177 Bacteria 2446
178 Ga0105237_10003956 3300009545 Bacteria 17343
179 Ga0105237_10059716 3300009545 Bacteria 3815
180 Ga0105237_10150709 3300009545 Bacteria 2322
181 Ga0105237_10292551 3300009545 Bacteria 1631
182 Ga0105238_10013898 3300009551 Bacteria 8141
183 Ga0105238_10261933 3300009551 Bacteria 1709
184 Ga0105238_10465432 3300009551 Bacteria 1262
185 Ga0105249_10085746 3300009553 Bacteria 2935
186 Ga0105249_10345157 3300009553 Bacteria 1507
187 Ga0123340_1060560 3300009763 Bacteria 1100
188 Ga0123341_1001285 3300009765 Bacteria 18434
189 Ga0123341_1088342 3300009765 Bacteria 1137
190 Ga0123342_1005926 3300009766 Bacteria 17311
191 Ga0105239_10091672 3300010375 Bacteria 3354
192 Ga0105239_10180103 3300010375 Bacteria 2364
193 Ga0105239_10923850 3300010375 Bacteria 1002
194 Ga0157373_10001304 3300013100 Bacteria 19035
195 Ga0157371_10000071 3300013102 Bacteria 164088
196 Ga0157371_10004987 3300013102 Bacteria 11391
197 Ga0157371_10006514 3300013102 Bacteria 9609
198 Ga0157370_10000079 3300013104 Bacteria 107305
199 Ga0157370_10016534 3300013104 Bacteria 7464
200 Ga0157370_10027388 3300013104 Bacteria 5620
201 Ga0157370_10072428 3300013104 Bacteria 3251
202 Ga0157369_10001671 3300013105 Bacteria 27057
203 Ga0157369_10228157 3300013105 Bacteria 1948
204 Ga0171463_1004 3300013249 Bacteria 437207
205 Ga0157378_10026218 3300013297 Bacteria 5138
206 Ga0163163_10616890 3300014325 Bacteria 1148
207 Ga0157380_10117978 3300014326 Bacteria 2242
208 Ga0182008_10017526 3300014497 Bacteria 3714
209 Ga0182007_10004894 3300015262 Bacteria 5983
210 Ga0182005_1004876 3300015265 Bacteria 4264
211 Ga0183363_1113 3300015690 Bacteria 22078
212 Ga0163161_10358795 3300017792 Bacteria 1160
213 Ga0214544_1000079 3300021320 Bacteria 121742
214 Ga0214542_1000064 3300021321 Bacteria 127681
215 Ga0214542_1016102 3300021321 Bacteria 7425
216 Ga0214543_1000015 3300021327 Bacteria 305679
217 Ga0214543_1000063 3300021327 Bacteria 127694
218 Ga0213876_10141061 3300021384 Bacteria 1282
219 Ga0228711_1000030 3300022739 Bacteria 94546
220 Ga0228710_1000002 3300022740 Bacteria 287279
221 Ga0209435_100031 3300025206 Bacteria 164115
222 Ga0209436_100013 3300025208 Bacteria 131492
223 Ga0209436_101962 3300025208 Bacteria 6585
224 Ga0209563_101894 3300025230 Bacteria 5059
225 Ga0209437_100179 3300025233 Bacteria 134210
226 Ga0209437_100181 3300025233 Bacteria 132953
227 Ga0209437_102732 3300025233 Bacteria 3331
228 Ga0207425_1000035 3300025245 Bacteria 225942
229 Ga0207425_1001786 3300025245 Bacteria 8356
230 Ga0207425_1031285 3300025245 Bacteria 1061
231 Ga0209646_1000102 3300025246 Bacteria 164115
232 Ga0209646_1006416 3300025246 Bacteria 1979
233 Ga0209646_1010873 3300025246 Bacteria 1417
234 Ga0209026_1000096 3300025250 Bacteria 164115
235 Ga0209026_1000151 3300025250 Bacteria 110338
236 Ga0209677_101381 3300025253 Bacteria 10560
237 Ga0209148_1000032 3300025254 Bacteria 557660
238 Ga0209759_1000076 3300025256 Bacteria 175911
239 Ga0209759_1000090 3300025256 Bacteria 164115
240 Ga0209129_1000029 3300025258 Bacteria 401149
241 Ga0209129_1000050 3300025258 Bacteria 267408
242 Ga0209129_1000409 3300025258 Bacteria 33785
243 Ga0209129_1000988 3300025258 Bacteria 17029
244 Ga0209129_1005837 3300025258 Bacteria 4193
245 Ga0209129_1005977 3300025258 Bacteria 4092
246 Ga0209129_1006612 3300025258 Bacteria 3686
247 Ga0209129_1006873 3300025258 Bacteria 3542
248 Ga0209233_1000150 3300025261 Bacteria 179401
249 Ga0209233_1000185 3300025261 Bacteria 133788
250 Ga0209233_1000475 3300025261 Bacteria 24854
251 Ga0209233_1000514 3300025261 Bacteria 22716
252 Ga0209455_1000085 3300025272 Bacteria 247601
253 Ga0209455_1028817 3300025272 Bacteria 966
254 Ga0209673_1000033 3300025273 Bacteria 335369
255 Ga0209673_1000050 3300025273 Bacteria 285287
256 Ga0209673_1000370 3300025273 Bacteria 81047
257 Ga0209673_1002748 3300025273 Bacteria 11549
258 Ga0209673_1004458 3300025273 Bacteria 7491
259 Ga0209673_1010254 3300025273 Bacteria 3965
260 Ga0209673_1015711 3300025273 Bacteria 2862
261 Ga0209130_1000009 3300025284 Bacteria 498952
262 Ga0209130_1000058 3300025284 Bacteria 210250
263 Ga0209130_1000133 3300025284 Bacteria 119561
264 Ga0209130_1017428 3300025284 Bacteria 1711
265 Ga0209676_1005439 3300025292 Bacteria 6654
266 Ga0209676_1007720 3300025292 Bacteria 4969
267 Ga0209676_1033688 3300025292 Bacteria 1523
268 Ga0209676_1040724 3300025292 Bacteria 1306
269 Ga0209025_1000042 3300025294 Bacteria 370577
270 Ga0209025_1000132 3300025294 Bacteria 197432
271 Ga0209025_1000914 3300025294 Bacteria 45435
272 Ga0209025_1001178 3300025294 Bacteria 37028
273 Ga0209025_1001839 3300025294 Bacteria 24932
274 Ga0209025_1002260 3300025294 Bacteria 21106
275 Ga0209025_1008765 3300025294 Bacteria 7200
276 Ga0209025_1027301 3300025294 Bacteria 2834
277 Ga0209025_1053342 3300025294 Bacteria 1587
278 Ga0209025_1098907 3300025294 Bacteria 930
279 Ga0209564_1000227 3300025295 Bacteria 125497
280 Ga0209564_1000700 3300025295 Bacteria 49128
281 Ga0209564_1000738 3300025295 Bacteria 46490
282 Ga0209564_1006217 3300025295 Bacteria 6520
283 Ga0209564_1011757 3300025295 Bacteria 3888
284 Ga0209564_1015455 3300025295 Bacteria 3102
285 Ga0209564_1015526 3300025295 Bacteria 3089
286 Ga0209758_1000811 3300025297 Bacteria 44054
287 Ga0209758_1001061 3300025297 Bacteria 35810
288 Ga0209758_1001207 3300025297 Bacteria 32535
289 Ga0209758_1001208 3300025297 Bacteria 32514
290 Ga0209758_1001810 3300025297 Bacteria 23620
291 Ga0209758_1002888 3300025297 Bacteria 16624
292 Ga0209758_1018922 3300025297 Bacteria 3349
293 Ga0209758_1023147 3300025297 Bacteria 2819
294 Ga0209758_1039237 3300025297 Bacteria 1803
295 Ga0209050_1002378 3300025298 Bacteria 16346
296 Ga0209050_1006819 3300025298 Bacteria 6645
297 Ga0209050_1007445 3300025298 Bacteria 6133
298 Ga0209256_1000459 3300025299 Bacteria 61577
299 Ga0209256_1000737 3300025299 Bacteria 43040
300 Ga0209256_1001010 3300025299 Bacteria 33243
301 Ga0209256_1002893 3300025299 Bacteria 13006
302 Ga0209256_1004467 3300025299 Bacteria 8754
303 Ga0209256_1004937 3300025299 Bacteria 7993
304 Ga0209256_1009461 3300025299 Bacteria 4268
305 Ga0209256_1011551 3300025299 Bacteria 3512
306 Ga0209256_1012371 3300025299 Bacteria 3281
307 Ga0209256_1024892 3300025299 Bacteria 1754
308 Ga0207426_1000131 3300025302 Bacteria 210250
309 Ga0207426_1000214 3300025302 Bacteria 137296
310 Ga0207426_1000248 3300025302 Bacteria 119561
311 Ga0207426_1000450 3300025302 Bacteria 65777
312 Ga0207426_1000747 3300025302 Bacteria 36594
313 Ga0209051_1001765 3300025303 Bacteria 17171
314 Ga0209051_1002754 3300025303 Bacteria 12165
315 Ga0209051_1003191 3300025303 Bacteria 10947
316 Ga0209051_1008080 3300025303 Bacteria 5630
317 Ga0209051_1009264 3300025303 Bacteria 5090
318 Ga0209257_1006186 3300025304 Bacteria 7870
319 Ga0209257_1006301 3300025304 Bacteria 7739
320 Ga0209257_1041666 3300025304 Bacteria 1360
321 Ga0207647_10018216 3300025904 Bacteria 4757
322 Ga0207647_10136981 3300025904 Bacteria 1436
323 Ga0207705_10356539 3300025909 Bacteria 1127
324 Ga0207707_10052631 3300025912 Bacteria 3544
325 Ga0207695_10000234 3300025913 Bacteria 146987
326 Ga0207695_10083691 3300025913 Bacteria 3223
327 Ga0207695_10127042 3300025913 Bacteria 2511
328 Ga0207695_10314958 3300025913 Bacteria 1455
329 Ga0207695_10391282 3300025913 Bacteria 1275
330 Ga0207671_10000234 3300025914 Bacteria 83448
331 Ga0207671_10049593 3300025914 Bacteria 3108
332 Ga0207671_10353340 3300025914 Bacteria 1166
333 Ga0207657_10047396 3300025919 Bacteria 3758
334 Ga0207657_10073077 3300025919 Bacteria 2899
335 Ga0207681_10034296 3300025923 Bacteria 3336
336 Ga0207681_10135657 3300025923 Bacteria 1826
337 Ga0207694_10023324 3300025924 Bacteria 4697
338 Ga0207694_10191584 3300025924 Bacteria 1661
339 Ga0207650_10001202 3300025925 Bacteria 19013
340 Ga0207650_10207121 3300025925 Bacteria 1574
341 Ga0207644_10162582 3300025931 Bacteria 1736
342 Ga0207690_10098289 3300025932 Bacteria 2084
343 Ga0207709_10075638 3300025935 Bacteria 2153
344 Ga0207689_10576812 3300025942 Bacteria 945
345 Ga0207667_10054345 3300025949 Bacteria 4213
346 Ga0207712_10666634 3300025961 Bacteria 905
347 Ga0207668_10007293 3300025972 Bacteria 6566
348 Ga0207668_10066406 3300025972 Bacteria 2557
349 Ga0207668_10635011 3300025972 Bacteria 933
350 Ga0207640_10064391 3300025981 Bacteria 2441
351 Ga0207640_10168833 3300025981 Bacteria 1628
352 Ga0207658_10807822 3300025986 Bacteria 852
353 Ga0207639_10005199 3300026041 Bacteria 8779
354 Ga0207639_10236414 3300026041 Bacteria 1586
355 Ga0207678_10045203 3300026067 Bacteria 3808
356 Ga0207678_10067252 3300026067 Bacteria 3076
357 Ga0207702_10135205 3300026078 Bacteria 2224
358 Ga0207648_10182303 3300026089 Bacteria 1859
359 Ga0207674_10301753 3300026116 Bacteria 1550
360 Ga0209281_1000030 3300027111 Bacteria 425931
361 Ga0209281_1000610 3300027111 Bacteria 40263
362 Ga0209281_1000893 3300027111 Bacteria 25367
363 Ga0209371_1000037 3300027312 Bacteria 367074
364 Ga0209371_1002161 3300027312 Bacteria 11540
365 Ga0209371_1005245 3300027312 Bacteria 5227
366 Ga0209282_1000004 3300027666 Bacteria 425931
367 Ga0209282_1014246 3300027666 Bacteria 5061
368 Ga0209282_1043440 3300027666 Bacteria 2643
369 Ga0268266_10013752 3300028379 Bacteria 6970
370 Ga0268266_10110288 3300028379 Bacteria 2437
371 Ga0268266_10143967 3300028379 Bacteria 2141
372 Ga0268266_10307850 3300028379 Bacteria 1480
373 Ga0268266_10483602 3300028379 Bacteria 1180
374 Ga0268266_10537775 3300028379 Bacteria 1118
375 Ga0268266_10626506 3300028379 Bacteria 1034
376 Ga0268265_10165971 3300028380 Bacteria 1882
377 Ga0265318_10030352 3300028577 Bacteria 2104
378 Ga0307515_10001115 3300028794 Bacteria 61466
379 Ga0307515_10001473 3300028794 Bacteria 52908
380 Ga0307515_10004817 3300028794 Bacteria 27624
381 Ga0307515_10037447 3300028794 Bacteria 7801
382 Ga0307515_10118494 3300028794 Bacteria 3021
383 Ga0307515_10273428 3300028794 Bacteria 1407
384 Ga0268256_1000832 3300030500 Bacteria 21913
385 Ga0268256_1007723 3300030500 Bacteria 3790
386 Ga0268256_1014584 3300030500 Bacteria 2324
387 Ga0265328_10016684 3300031239 Bacteria 2852
388 Ga0265320_10004226 3300031240 Bacteria 9436
389 Ga0265331_10000150 3300031250 Bacteria 90008
390 Ga0265327_10000324 3300031251 Bacteria 90964
391 Ga0307513_10000926 3300031456 Bacteria 42368
392 Ga0307513_10014966 3300031456 Bacteria 9422
393 Ga0307408_100049137 3300031548 Bacteria 3028
394 Ga0307408_100665589 3300031548 Bacteria 932
395 Ga0307514_10187636 3300031649 Bacteria 1322
396 Ga0316575_10065357 3300031665 Bacteria 1457
397 Ga0265314_10016118 3300031711 Bacteria 5917
398 Ga0316576_10423888 3300031727 Bacteria 984
399 Ga0316578_10296788 3300031728 Bacteria 966
400 Ga0307405_10018137 3300031731 Bacteria 3877
401 Ga0307413_10280098 3300031824 Bacteria 1254
402 Ga0307413_10398460 3300031824 Bacteria 1078
403 Ga0307406_10004456 3300031901 Bacteria 7624
404 Ga0307412_10000806 3300031911 Bacteria 18035
405 Ga0315914_1000001 3300031967 Bacteria 416633
406 Ga0307416_100376244 3300032002 Bacteria 1448
407 Ga0307414_10010279 3300032004 Bacteria 5421
408 Ga0307414_10026741 3300032004 Bacteria 3718
409 Ga0316583_10019692 3300032133 Bacteria 2419
410 Ga0316580_10040971 3300032139 Bacteria 1430
411 Ga0315913_1000022 3300033430 Bacteria 94546
412 Ga0315915_1000002 3300033464 Bacteria 425854
413 Ga0316574_0216033 3300035398 Bacteria 1229
414 Ga0373935_0379905 3300035692 Bacteria 1011
415 Ga0373927_0000068 3300035695 Bacteria 75823
416 Ga0316582_0299926 3300036647 Bacteria 1104
417 Ga0373925_0001851 3300037068 Bacteria 17620
418 Ga0395899_0000107 3300037312 Bacteria 144087
419 Ga0395899_0226645 3300037312 Bacteria 1292
420 Ga0395899_0447721 3300037312 Bacteria 846
421 Ga0395900_0000101 3300037418 Bacteria 153550
422 Ga0395900_0061014 3300037418 Bacteria 3878
423 Ga0395900_0239920 3300037418 Bacteria 1819
424 Ga0395898_0000043 3300037466 Bacteria 301783
425 Ga0395898_0243897 3300037466 Bacteria 1714
426 Ga0395905_0000101 3300037471 Bacteria 144115
427 Ga0395905_0001904 3300037471 Bacteria 24039
428 Ga0395905_0040527 3300037471 Bacteria 4369
429 Ga0395905_0104032 3300037471 Bacteria 2665
430 Ga0395905_0110361 3300037471 Bacteria 2583
431 Ga0395905_0209857 3300037471 Bacteria 1824
432 Ga0395905_0836368 3300037471 Bacteria 823
433 Ga0395901_0000068 3300038443 Bacteria 144095
434 Ga0395901_0013412 3300038443 Bacteria 8330
435 Ga0395901_0030541 3300038443 Bacteria 5551
436 Ga0395901_0221777 3300038443 Bacteria 1976
437 Ga0436365_1812542 3300039437 Bacteria 1371
438 Ga0439465_0001581 3300041413 Bacteria 7410
439 Ga0439465_0001905 3300041413 Bacteria 6833
440 Ga0439465_0015529 3300041413 Bacteria 2376
441 Ga0439465_0055476 3300041413 Bacteria 1305
442 Ga0451787_478853 3300041441 Bacteria 1795
443 Ga0451789_1023080 3300041443 Bacteria 1044
444 Ga0451798_0082093 3300041458 Bacteria 2750
445 Ga0451833_1412313 3300041491 Bacteria 1049
446 Ga0451835_0739892 3300041492 Bacteria 1097
447 Ga0451837_1550804 3300041494 Bacteria 1991
448 Ga0451839_1184936 3300041496 Bacteria 912
449 Ga0451840_11301 3300041497 Bacteria 839
450 Ga0451841_0045710 3300041498 Bacteria 1836
451 Ga0451841_1238617 3300041498 Bacteria 842
452 Ga0451846_33480 3300041502 Bacteria 2785
453 Ga0451847_0004229 3300041503 Bacteria 1859
454 Ga0451848_16121 3300041504 Bacteria 807
455 Ga0451851_0286109 3300041507 Bacteria 2283
456 Ga0451855_1229833 3300041511 Bacteria 1516
457 Ga0452268_46788 3300041907 Bacteria 1064
458 Ga0439431_0014674 3300041997 Bacteria 1818
459 Ga0439449_0012067 3300042007 Bacteria 3248
460 Ga0439462_0002202 3300042015 Bacteria 4496
461 Ga0450920_004809 3300042122 Bacteria 2387
462 Ga0439446_0041797 3300042156 Bacteria 1352
463 Ga0450918_002772 3300042531 Bacteria 3285
464 Ga0466972_0021064 3300044658 Bacteria 3254
465 Ga0466972_0027854 3300044658 Bacteria 2793
466 Ga0453683_0007838 3300044673 Bacteria 7207
467 Ga0453684_0011626 3300044712 Bacteria 14700
468 Ga0466970_0047732 3300044765 Bacteria 2282
469 Ga0466960_0021901 3300044901 Bacteria 2851
470 Ga0466960_0255561 3300044901 Bacteria 975
471 Ga0451576_0000203 3300045051 Bacteria 149655
472 Ga0451576_0006551 3300045051 Bacteria 14249
473 Ga0495629_0028295 3300046459 Bacteria 3979
474 Ga0495638_0000110 3300046460 Bacteria 131410
475 Ga0495638_0036678 3300046460 Bacteria 3122
476 Ga0495638_0038669 3300046460 Bacteria 3030
477 Ga0495638_0059028 3300046460 Bacteria 2376
478 Ga0495653_0312548 3300046463 Bacteria 1021
479 Ga0495650_0025541 3300046471 Bacteria 2766
480 Ga0495605_0024669 3300046474 Bacteria 3143
481 Ga0495585_0191116 3300046492 Bacteria 1047
482 Ga0495607_0007380 3300046501 Bacteria 7610
483 Ga0495583_0009254 3300046506 Bacteria 5903
484 Ga0495606_0009386 3300046507 Bacteria 8283
485 Ga0495606_0010590 3300046507 Bacteria 7631
486 Ga0495606_0066858 3300046507 Bacteria 2278
487 Ga0495610_0011163 3300046512 Bacteria 5511
488 Ga0495610_0017922 3300046512 Bacteria 4018
489 Ga0495610_0049896 3300046512 Bacteria 2046
490 Ga0495610_0151607 3300046512 Bacteria 988
491 Ga0495620_0037814 3300046515 Bacteria 2146
492 Ga0495620_0047666 3300046515 Bacteria 1843
493 Ga0495620_0055192 3300046515 Bacteria 1675
494 Ga0495631_0024379 3300046518 Bacteria 2793
495 Ga0495632_0044741 3300046519 Bacteria 2208
496 Ga0495632_0062139 3300046519 Bacteria 1811
497 Ga0495632_0128994 3300046519 Bacteria 1178
498 Ga0495643_0033152 3300046522 Bacteria 2860
499 Ga0495643_0053561 3300046522 Bacteria 2162
500 Ga0495648_0066678 3300046524 Bacteria 2109
501 Ga0495652_0152861 3300046529 Bacteria 1801
502 Ga0495654_0000839 3300046530 Bacteria 23281
503 Ga0495654_0051094 3300046530 Bacteria 2018
504 Ga0495587_0207858 3300046536 Bacteria 1106
505 Ga0495609_0068433 3300046538 Bacteria 1562
506 Ga0495622_0008505 3300046557 Bacteria 4753
507 Ga0495633_0020417 3300046558 Bacteria 3332
508 Ga0495633_0047216 3300046558 Bacteria 2035
509 Ga0495668_0028990 3300046616 Bacteria 3128
510 Ga0495668_0054955 3300046616 Bacteria 2199
511 Ga0495611_0171912 3300046648 Bacteria 1013
512 Ga0495625_0014886 3300046660 Bacteria 6186
513 Ga0495625_0030641 3300046660 Bacteria 4010
514 Ga0495625_0259920 3300046660 Bacteria 1124
515 Ga0495625_0351613 3300046660 Bacteria 931
516 Ga0495625_0389670 3300046660 Bacteria 872
517 Ga0495659_0165960 3300046664 Bacteria 894
518 Ga0495661_0040697 3300046665 Bacteria 2880
519 Ga0495588_0005928 3300046674 Bacteria 5478
520 Ga0495588_0160944 3300046674 Bacteria 1187
521 Ga0495657_0055740 3300046675 Bacteria 2636
522 Ga0495658_0168180 3300046683 Bacteria 1355
523 Ga0495671_0043186 3300046692 Bacteria 2263
524 Ga0495671_0103682 3300046692 Bacteria 1389
525 Ga0495649_0082256 3300046694 Bacteria 1721
526 Ga0495649_0096939 3300046694 Bacteria 1569
527 Ga0495600_0108649 3300046809 Bacteria 1806
528 Ga0495604_0077159 3300047317 Bacteria 2504
529 Ga0495672_0188510 3300047320 Bacteria 1039
530 Ga0495687_033553 3300047443 Bacteria 2327
531 Ga0495681_0009775 3300047470 Bacteria 5871
532 Ga0495686_0000972 3300047472 Bacteria 35241
533 Ga0495686_0006107 3300047472 Bacteria 9329
534 Ga0495686_0006562 3300047472 Bacteria 8878
535 Ga0495686_0256510 3300047472 Bacteria 980
536 Ga0495626_0098278 3300048091 Bacteria 1279
537 Ga0496100_0717729 3300048903 Bacteria 781
538 Ga0496104_0332839 3300048907 Bacteria 1431
539 Ga0496105_0102145 3300048908 Bacteria 2368
540 Ga0496106_0082803 3300048909 Bacteria 2467
541 Ga0496108_0085104 3300048911 Bacteria 2684
542 Ga0496108_0453122 3300048911 Bacteria 1121
543 Ga0496110_0277368 3300048913 Bacteria 1526
544 Ga0496110_0583200 3300048913 Bacteria 1015
545 Ga0496112_0107439 3300048915 Bacteria 2760
546 Ga0496113_0452964 3300048916 Bacteria 1031
547 Ga0496114_0375345 3300048917 Bacteria 1259
548 Ga0496115_0129918 3300048918 Bacteria 2076
549 Ga0496115_0923943 3300048918 Bacteria 671
550 Ga0496116_0000057 3300048919 Bacteria 281652
551 Ga0496116_0011521 3300048919 Bacteria 7307
552 Ga0496116_0016473 3300048919 Bacteria 5781
553 Ga0496116_0031401 3300048919 Bacteria 3803
554 Ga0496116_0061396 3300048919 Bacteria 2433
555 Ga0496116_0074157 3300048919 Bacteria 2141
556 Ga0496116_0083393 3300048919 Bacteria 1973
557 Ga0496116_0098852 3300048919 Bacteria 1749
558 Ga0496116_0139606 3300048919 Bacteria 1365
559 Ga0496116_0258592 3300048919 Bacteria 860
560 Ga0496117_0000031 3300048920 Bacteria 381048
561 Ga0496117_0005441 3300048920 Bacteria 13375
562 Ga0496117_0015342 3300048920 Bacteria 6537
563 Ga0496117_0035542 3300048920 Bacteria 3738
564 Ga0496117_0040154 3300048920 Bacteria 3446
565 Ga0496117_0045019 3300048920 Bacteria 3192
566 Ga0496117_0121772 3300048920 Bacteria 1601
567 Ga0496117_0168096 3300048920 Bacteria 1276
568 Ga0496117_0272989 3300048920 Bacteria 910
569 Ga0496118_0003703 3300048921 Bacteria 18940
570 Ga0496118_0026334 3300048921 Bacteria 4957
571 Ga0496118_0049784 3300048921 Bacteria 3222
572 Ga0496118_0061514 3300048921 Bacteria 2779
573 Ga0496118_0099098 3300048921 Bacteria 1977
574 Ga0496118_0107472 3300048921 Bacteria 1863
575 Ga0496119_0002950 3300048922 Bacteria 18077
576 Ga0496119_0013035 3300048922 Bacteria 6673
577 Ga0496119_0017605 3300048922 Bacteria 5368
578 Ga0496119_0047632 3300048922 Bacteria 2665
579 Ga0496119_0069220 3300048922 Bacteria 2074
580 Ga0496119_0136602 3300048922 Bacteria 1329
581 Ga0496119_0163992 3300048922 Bacteria 1179
582 Ga0496120_0000387 3300048923 Bacteria 71224
583 Ga0496120_0002559 3300048923 Bacteria 18148
584 Ga0496120_0033056 3300048923 Bacteria 3111
585 Ga0496120_0046132 3300048923 Bacteria 2519
586 Ga0496121_0000034 3300048924 Bacteria 377095
587 Ga0496121_0000660 3300048924 Bacteria 64425
588 Ga0496121_0028678 3300048924 Bacteria 5176
589 Ga0496121_0032220 3300048924 Bacteria 4768
590 Ga0496121_0043889 3300048924 Bacteria 3865
591 Ga0496121_0057142 3300048924 Bacteria 3235
592 Ga0496121_0060057 3300048924 Bacteria 3130
593 Ga0496121_0076315 3300048924 Bacteria 2672
594 Ga0496121_0102487 3300048924 Bacteria 2205
595 Ga0496121_0122001 3300048924 Bacteria 1966
596 Ga0496121_0154635 3300048924 Bacteria 1684
597 Ga0496122_0000023 3300048925 Bacteria 381035
598 Ga0496122_0000082 3300048925 Bacteria 209159
599 Ga0496122_0000308 3300048925 Bacteria 107960
600 Ga0496122_0007305 3300048925 Bacteria 12339
601 Ga0496122_0010979 3300048925 Bacteria 9256
602 Ga0496122_0034508 3300048925 Bacteria 4138
603 Ga0496122_0077336 3300048925 Bacteria 2337
604 Ga0496122_0110872 3300048925 Bacteria 1801
605 Ga0496122_0229247 3300048925 Bacteria 1057
606 Ga0496122_0330470 3300048925 Bacteria 805
607 Ga0496122_0345455 3300048925 Bacteria 779
608 Ga0496123_0000027 3300048926 Bacteria 306773
609 Ga0496123_0000066 3300048926 Bacteria 210327
610 Ga0496123_0000067 3300048926 Bacteria 209159
611 Ga0496123_0020487 3300048926 Bacteria 5171
612 Ga0496123_0020739 3300048926 Bacteria 5131
613 Ga0496123_0030745 3300048926 Bacteria 3924
614 Ga0496123_0033011 3300048926 Bacteria 3733
615 Ga0496123_0083501 3300048926 Bacteria 1931
616 Ga0496123_0087085 3300048926 Bacteria 1870
617 Ga0496123_0088457 3300048926 Bacteria 1849
618 Ga0496123_0137133 3300048926 Bacteria 1344
619 Ga0496123_0171357 3300048926 Bacteria 1144
620 Ga0496124_0000294 3300048927 Bacteria 93153
621 Ga0496124_0000917 3300048927 Bacteria 47584
622 Ga0496124_0003003 3300048927 Bacteria 21101
623 Ga0496124_0015593 3300048927 Bacteria 7273
624 Ga0496124_0028249 3300048927 Bacteria 5021
625 Ga0496124_0035328 3300048927 Bacteria 4373
626 Ga0496124_0048971 3300048927 Bacteria 3606
627 Ga0496124_0056206 3300048927 Bacteria 3320
628 Ga0496124_0062382 3300048927 Bacteria 3119
629 Ga0496124_0186896 3300048927 Bacteria 1589
630 Ga0496124_0214479 3300048927 Bacteria 1453
631 Ga0496124_0248225 3300048927 Bacteria 1318
632 Ga0496124_0329088 3300048927 Bacteria 1090
633 Ga0496124_0426912 3300048927 Bacteria 911
634 Ga0496125_0000030 3300048928 Bacteria 375023
635 Ga0496125_0001030 3300048928 Bacteria 43251
636 Ga0496125_0007286 3300048928 Bacteria 11779
637 Ga0496125_0020980 3300048928 Bacteria 6110
638 Ga0496125_0031676 3300048928 Bacteria 4709
639 Ga0496125_0081252 3300048928 Bacteria 2477
640 Ga0496125_0123716 3300048928 Bacteria 1838
641 Ga0496126_0000115 3300048929 Bacteria 188546
642 Ga0496126_0000258 3300048929 Bacteria 113843
643 Ga0496126_0015454 3300048929 Bacteria 7677
644 Ga0496126_0057927 3300048929 Bacteria 3494
645 Ga0496126_0066960 3300048929 Bacteria 3210
646 Ga0496126_0069410 3300048929 Bacteria 3143
647 Ga0496126_0080075 3300048929 Bacteria 2891
648 Ga0496126_0250151 3300048929 Bacteria 1477
649 Ga0496126_0434930 3300048929 Bacteria 1058
650 Ga0501031_0000002 3300049568 Bacteria 217588
651 Ga0501031_0003364 3300049568 Bacteria 10275
652 Ga0501031_0009932 3300049568 Bacteria 6197
653 Ga0501031_0032716 3300049568 Bacteria 3391
654 Ga0501031_0042827 3300049568 Bacteria 2955
655 Ga0501031_0066231 3300049568 Bacteria 2353
656 Ga0501031_0104767 3300049568 Bacteria 1846
657 Ga0501031_0563914 3300049568 Bacteria 733
658 Ga0501032_0000001 3300049569 Bacteria 422097
659 Ga0501032_0000004 3300049569 Bacteria 310855
660 Ga0501032_0001391 3300049569 Bacteria 19212
661 Ga0501032_0076687 3300049569 Bacteria 2226
662 Ga0501032_0141929 3300049569 Bacteria 1582
663 Ga0501032_0148347 3300049569 Bacteria 1543
664 Ga0501032_0219494 3300049569 Bacteria 1237
665 Ga0501032_0227460 3300049569 Bacteria 1213
666 Ga0501032_0399348 3300049569 Bacteria 883
667 Ga0501033_0000016 3300049570 Bacteria 217458
668 Ga0501033_0000275 3300049570 Bacteria 49587
669 Ga0501033_0000281 3300049570 Bacteria 49116
670 Ga0501033_0000304 3300049570 Bacteria 46485
671 Ga0501033_0004330 3300049570 Bacteria 11389
672 Ga0501033_0007579 3300049570 Bacteria 8444
673 Ga0501033_0085596 3300049570 Bacteria 2309
674 Ga0501033_0133806 3300049570 Bacteria 1794
675 Ga0501033_0219931 3300049570 Bacteria 1352
676 Ga0501033_0427700 3300049570 Bacteria 922
677 Ga0501034_0000011 3300049571 Bacteria 310855
678 Ga0501034_0002200 3300049571 Bacteria 24125
679 Ga0501034_0009670 3300049571 Bacteria 10085
680 Ga0501034_0023386 3300049571 Bacteria 6297
681 Ga0501034_0027699 3300049571 Bacteria 5762
682 Ga0501034_0039528 3300049571 Bacteria 4778
683 Ga0501034_0058388 3300049571 Bacteria 3878
684 Ga0501034_0062879 3300049571 Bacteria 3727
685 Ga0501034_0159948 3300049571 Bacteria 2224
686 Ga0501034_0235450 3300049571 Bacteria 1779
687 Ga0501034_0301358 3300049571 Bacteria 1539
688 Ga0501034_0314631 3300049571 Bacteria 1499
689 Ga0501034_0365033 3300049571 Bacteria 1371
690 Ga0501034_0373264 3300049571 Bacteria 1352
691 Ga0501034_0431453 3300049571 Bacteria 1237
692 Ga0501034_0577846 3300049571 Bacteria 1031
693 Ga0501034_0705905 3300049571 Bacteria 907
694 Ga0501036_0000001 3300049572 Bacteria 310855
695 Ga0501036_0000358 3300049572 Bacteria 32271
696 Ga0501036_0216068 3300049572 Bacteria 1610
697 Ga0501037_0000006 3300049573 Bacteria 217461
698 Ga0501037_0000091 3300049573 Bacteria 84811
699 Ga0501037_0000154 3300049573 Bacteria 64077
700 Ga0501037_0012627 3300049573 Bacteria 6223
701 Ga0501037_0020694 3300049573 Bacteria 4858
702 Ga0501037_0189625 3300049573 Bacteria 1456
703 Ga0501038_0000003 3300049574 Bacteria 310855
704 Ga0501038_0003916 3300049574 Bacteria 13845
705 Ga0501038_0045603 3300049574 Bacteria 3805
706 Ga0501038_0048130 3300049574 Bacteria 3691
707 Ga0501038_0104528 3300049574 Bacteria 2353
708 Ga0501038_0117117 3300049574 Bacteria 2201
709 Ga0501038_0137595 3300049574 Bacteria 2000
710 Ga0501038_0182506 3300049574 Bacteria 1692
711 Ga0501039_0000004 3300049575 Bacteria 310855
712 Ga0501039_0000011 3300049575 Bacteria 245124
713 Ga0501039_0495622 3300049575 Bacteria 959
714 Ga0501040_0010669 3300049576 Bacteria 6009
715 Ga0501040_0080669 3300049576 Bacteria 2254
716 Ga0501042_0020648 3300049578 Bacteria 4585
717 Ga0501043_0000007 3300049579 Bacteria 224595
718 Ga0501043_0000016 3300049579 Bacteria 170869
719 Ga0501043_0000765 3300049579 Bacteria 28587
720 Ga0501043_0100150 3300049579 Bacteria 2278
721 Ga0501043_0167806 3300049579 Bacteria 1713
722 Ga0501043_0189009 3300049579 Bacteria 1602
723 Ga0501043_0291242 3300049579 Bacteria 1250
724 Ga0501046_0071668 3300049580 Bacteria 2692
725 Ga0501046_0165886 3300049580 Bacteria 1659
726 Ga0501046_0239072 3300049580 Bacteria 1340
727 Ga0501047_0000740 3300049581 Bacteria 34045
728 Ga0501047_0008050 3300049581 Bacteria 9947
729 Ga0501047_0053862 3300049581 Bacteria 3892
730 Ga0501047_0068774 3300049581 Bacteria 3411
731 Ga0501047_0088599 3300049581 Bacteria 2972
732 Ga0501047_0252833 3300049581 Bacteria 1610
733 Ga0501047_0463172 3300049581 Bacteria 1096
734 Ga0501048_0258695 3300049582 Bacteria 1237
735 Ga0501067_0123421 3300049583 Bacteria 1441
736 Ga0501067_0176964 3300049583 Bacteria 1188
737 Ga0501068_0005949 3300049584 Bacteria 6695
738 Ga0501068_0037501 3300049584 Bacteria 2901
739 Ga0501069_0000027 3300049585 Bacteria 106217
740 Ga0501069_0003825 3300049585 Bacteria 7752
741 Ga0501069_0162240 3300049585 Bacteria 1287
742 Ga0501070_0000014 3300049586 Bacteria 180454
743 Ga0501070_0000650 3300049586 Bacteria 31944
744 Ga0501070_0006268 3300049586 Bacteria 10122
745 Ga0501070_0013025 3300049586 Bacteria 7009
746 Ga0501070_0021805 3300049586 Bacteria 5368
747 Ga0501070_0025476 3300049586 Bacteria 4961
748 Ga0501070_0054195 3300049586 Bacteria 3325
749 Ga0501070_0083485 3300049586 Bacteria 2644
750 Ga0501070_0099928 3300049586 Bacteria 2400
751 Ga0501071_0004099 3300049587 Bacteria 9216
752 Ga0501071_0067377 3300049587 Bacteria 2603
753 Ga0501072_0041000 3300049588 Bacteria 3636
754 Ga0501073_0076590 3300049589 Bacteria 2327
755 Ga0501073_0095523 3300049589 Bacteria 2064
756 Ga0501073_0148438 3300049589 Bacteria 1625
757 Ga0501073_0199602 3300049589 Bacteria 1383
758 Ga0501073_0273153 3300049589 Bacteria 1166
759 Ga0501073_0421728 3300049589 Bacteria 922
760 Ga0501074_0000066 3300049590 Bacteria 50258
761 Ga0501074_0016429 3300049590 Bacteria 5375
762 Ga0501074_0081602 3300049590 Bacteria 2319
763 Ga0501079_0460124 3300049741 Bacteria 999
764 Ga0501080_0002117 3300049742 Bacteria 17234
765 Ga0501080_0003548 3300049742 Bacteria 13744
766 Ga0501080_0007654 3300049742 Bacteria 9769
767 Ga0501080_0368067 3300049742 Bacteria 1296
768 Ga0501080_0397136 3300049742 Bacteria 1241
769 Ga0501083_0000012 3300049744 Bacteria 178668
770 Ga0501083_0113881 3300049744 Bacteria 1777
771 Ga0501083_0270475 3300049744 Bacteria 1105
772 Ga0501280_001213 3300049776 Bacteria 5039
773 Ga0501035_0000009 3300049822 Bacteria 310827
774 Ga0501035_0000073 3300049822 Bacteria 122603
775 Ga0501035_0000607 3300049822 Bacteria 39537
776 Ga0501035_0000806 3300049822 Bacteria 33416
777 Ga0501035_0002615 3300049822 Bacteria 17557
778 Ga0501035_0004991 3300049822 Bacteria 12570
779 Ga0501035_0021669 3300049822 Bacteria 5909
780 Ga0501035_0022781 3300049822 Bacteria 5752
781 Ga0501035_0041727 3300049822 Bacteria 4142
782 Ga0501035_0222590 3300049822 Bacteria 1610
783 Ga0501035_0328762 3300049822 Bacteria 1283
784 Ga0501044_0000005 3300049823 Bacteria 310855
785 Ga0501044_0000118 3300049823 Bacteria 95218
786 Ga0501044_0003065 3300049823 Bacteria 18912
787 Ga0501044_0005415 3300049823 Bacteria 14179
788 Ga0501044_0016850 3300049823 Bacteria 7839
789 Ga0501044_0040258 3300049823 Bacteria 4870
790 Ga0501044_0056156 3300049823 Bacteria 4042
791 Ga0501044_0058724 3300049823 Bacteria 3944
792 Ga0501044_0066879 3300049823 Bacteria 3663
793 Ga0501044_0105957 3300049823 Bacteria 2824
794 Ga0501044_0108418 3300049823 Bacteria 2787
795 Ga0501044_0269363 3300049823 Bacteria 1639
796 Ga0501044_0281841 3300049823 Bacteria 1595
797 Ga0501044_0429770 3300049823 Bacteria 1230
798 Ga0501044_0560756 3300049823 Bacteria 1038
799 Ga0501045_0046413 3300049824 Bacteria 3163
800 Ga0501045_0543002 3300049824 Bacteria 862
801 nmdc:mga03683_198984_c1 3300050489 Bacteria 919
802 nmdc:mga03n38_14125_c1 3300050490 Bacteria 3054
803 nmdc:mga03n38_169900_c1 3300050490 Bacteria 1110
804 nmdc:mga03n38_268437_c1 3300050490 Bacteria 907
805 nmdc:mga03n38_6378_c1 3300050490 Bacteria 4093
806 nmdc:mga03n38_93329_c1 3300050490 Bacteria 1437
807 nmdc:mga00v17_1099_c1 3300050491 Bacteria 14223
808 nmdc:mga00v17_15_c1 3300050491 Bacteria 126234
809 nmdc:mga0yw44_152745_c1 3300050492 Bacteria 1507
810 nmdc:mga0yw44_174991_c1 3300050492 Bacteria 1411
811 nmdc:mga0yw44_24199_c1 3300050492 Bacteria 3433
812 nmdc:mga0yw44_398738_c1 3300050492 Bacteria 930
813 nmdc:mga0yw44_43274_c1 3300050492 Bacteria 2688
814 nmdc:mga0yw44_469367_c1 3300050492 Bacteria 853
815 nmdc:mga0yw44_469592_c1 3300050492 Bacteria 853
816 nmdc:mga0yw44_76912_c1 3300050492 Bacteria 2084
817 nmdc:mga0yw44_839_c1 3300050492 Bacteria 11481
818 nmdc:mga0k408_35003_c1 3300050493 Bacteria 2878
819 nmdc:mga0k408_90217_c1 3300050493 Bacteria 1800
820 nmdc:mga06z11_111287_c1 3300050494 Bacteria 1517
821 nmdc:mga06z11_232340_c1 3300050494 Bacteria 1081
822 nmdc:mga06z11_26345_c1 3300050494 Bacteria 2766
823 nmdc:mga06z11_29277_c1 3300050494 Bacteria 2651
824 nmdc:mga06z11_64483_c1 3300050494 Bacteria 1920
825 nmdc:mga04h51_171540_c1 3300050495 Bacteria 840
826 nmdc:mga07m45_31582_c1 3300050496 Bacteria 2935
827 nmdc:mga07m45_6295_c1 3300050496 Bacteria 5994
828 nmdc:mga07m45_79519_c1 3300050496 Bacteria 1872
829 nmdc:mga0sz30_171917_c1 3300050516 Bacteria 961
830 nmdc:mga0sz30_2687_c1 3300050516 Bacteria 6338
831 nmdc:mga0sz30_27997_c1 3300050516 Bacteria 2317
832 nmdc:mga0sz30_91600_c1 3300050516 Bacteria 843
833 Ga0500610_0003559 3300053079 Bacteria 6012
834 Ga0500578_0028556 3300053086 Bacteria 3582
835 Ga0500644_0018125 3300053088 Bacteria 2056
836 Ga0500560_046258 3300053107 Bacteria 1383
837 Ga0500618_001904 3300053125 Bacteria 8623
838 Ga0500618_003626 3300053125 Bacteria 5228
839 Ga0500618_034879 3300053125 Bacteria 1169
840 Ga0500658_0003333 3300053134 Bacteria 6087
841 Ga0500559_0017630 3300053136 Bacteria 3016
842 Ga0500561_0000187 3300053137 Bacteria 11122
843 Ga0500568_0000010 3300053139 Bacteria 249043
844 Ga0500568_0004916 3300053139 Bacteria 7033
845 Ga0500573_0005445 3300053140 Bacteria 6816
846 Ga0500573_0011023 3300053140 Bacteria 5056
847 Ga0500590_007742 3300053148 Bacteria 5332
848 Ga0500616_0001192 3300053153 Bacteria 26410
849 Ga0500616_0001681 3300053153 Bacteria 20367
850 Ga0500616_0014879 3300053153 Bacteria 4458
851 Ga0500616_0085803 3300053153 Bacteria 1571
852 Ga0500622_0000517 3300053156 Bacteria 35871
853 Ga0500622_0000747 3300053156 Bacteria 28385
854 Ga0500622_0130585 3300053156 Bacteria 1208
855 Ga0500624_004235 3300053157 Bacteria 1882
856 Ga0500627_0204713 3300053158 Bacteria 884
857 Ga0500633_0044096 3300053160 Bacteria 1512
858 Ga0500634_0002218 3300053161 Bacteria 8090
859 Ga0500634_0068294 3300053161 Bacteria 1867
860 Ga0500636_0000030 3300053177 Bacteria 77501
861 Ga0500611_028047 3300053727 Bacteria 1140
862 Ga0501084_0305956 3300054114 Bacteria 1343
863 Ga0590075_028118 3300059424 Bacteria 1420
864 Ga0587090_001953 3300059510 Bacteria 2189
865 Ga0587072_000441 3300059643 Bacteria 4164
866 Ga0501082_0081439 3300060353 Bacteria 2793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0923943 Ga0496115_0923943_15_653 208
2 3300049589 Ga0501073_0421728 Ga0501073_0421728_147_791 211
3 iso_pu_bacteria 2978969890 2978972791 215
4 3300048911 Ga0496108_0085104 Ga0496108_0085104_456_1124 219
5 3300044901 Ga0466960_0255561 Ga0466960_0255561_153_896 220
6 3300049824 Ga0501045_0543002 Ga0501045_0543002_168_848 220
7 3300049568 Ga0501031_0563914 Ga0501031_0563914_37_720 223
8 3300048927 Ga0496124_0028249 Ga0496124_0028249_3777_4457 224
9 3300050516 nmdc:mga0sz30_91600_c1 nmdc:mga0sz30_91600_c1_11_691 224
10 3300046519 Ga0495632_0128994 Ga0495632_0128994_29_712 225
11 3300046694 Ga0495649_0082256 Ga0495649_0082256_29_712 225
12 3300025913 Ga0207695_10127042 Ga0207695_101270422 226
13 3300048903 Ga0496100_0717729 Ga0496100_0717729_74_754 226
14 3300048907 Ga0496104_0332839 Ga0496104_0332839_40_726 226
15 3300048925 Ga0496122_0345455 Ga0496122_0345455_48_734 226
16 3300048927 Ga0496124_0426912 Ga0496124_0426912_22_708 226
17 3300049570 Ga0501033_0427700 Ga0501033_0427700_11_700 226
18 3300048916 Ga0496113_0452964 Ga0496113_0452964_10_714 230
19 iso_pu_bacteria 2738543031 2739349665 235
20 iso_pu_bacteria 2513237351 2514586532 236
21 iso_pu_bacteria 2534681786 2535485528 236
22 iso_pu_bacteria 2757320392 2757570429 236
23 iso_pu_bacteria 2758568016 2758642956 236
24 iso_pu_bacteria 2854911287 2854913727 236
25 iso_pu_bacteria 2882632389 2882634566 236
26 iso_pu_bacteria 2932401849 2932405701 236
27 iso_pu_bacteria 2937843397 2937843720 236
28 iso_pu_bacteria 8005658619 8005661012 236
29 iso_pu_bacteria 2643221689 2644501302 237
30 iso_pu_bacteria 2837678835 2837679020 237
31 iso_pu_bacteria 2894817345 2894822238 237
32 3300028577 Ga0265318_10030352 Ga0265318_100303522 238
33 3300031240 Ga0265320_10004226 Ga0265320_100042266 238
34 3300031251 Ga0265327_10000324 Ga0265327_1000032493 238
35 3300031711 Ga0265314_10016118 Ga0265314_100161186 238
36 3300044712 Ga0453684_0011626 Ga0453684_0011626_4254_4973 238
37 iso_pu_bacteria 2510461069 2510839236 238
38 iso_pu_bacteria 2558860983 2561468596 238
39 iso_pu_bacteria 2643221568 2643854777 238
40 iso_pu_bacteria 2643221653 2644299642 238
41 iso_pu_bacteria 2643221719 2644657870 238
42 iso_pu_bacteria 2775507049 2776915708 238
43 iso_pu_bacteria 2818991272 2819244130 238
44 iso_pu_bacteria 2889914905 2889917795 238
45 iso_pu_bacteria 2919166419 2919170412 238
46 iso_pu_bacteria 2929138655 2929142049 238
47 iso_pu_bacteria 2984587000 2984591043 238
48 iso_pu_bacteria 2989776772 2989780297 238
49 iso_pu_bacteria 2995392953 2995394216 238
50 iso_pu_bacteria 8005246636 8005249458 238
51 iso_pu_bacteria 8054460903 8054463931 238
52 iso_pu_bacteria 8055431914 8055433006 238
53 3300031239 Ga0265328_10016684 Ga0265328_100166844 239
54 3300031250 Ga0265331_10000150 Ga0265331_1000015064 239
55 iso_pu_bacteria 2508501127 2509140736 239
56 iso_pu_bacteria 2516143018 2516205756 239
57 iso_pu_bacteria 2597489875 2597810411 239
58 iso_pu_bacteria 2599185352 2600194034 239
59 iso_pu_bacteria 2643221557 2643807712 239
60 iso_pu_bacteria 2643221610 2644068929 239
61 iso_pu_bacteria 2643221618 2644105702 239
62 iso_pu_bacteria 2643221626 2644146414 239
63 iso_pu_bacteria 2643221655 2644310315 239
64 iso_pu_bacteria 2643221659 2644334900 239
65 iso_pu_bacteria 2643221668 2644378305 239
66 iso_pu_bacteria 2643221675 2644420000 239
67 iso_pu_bacteria 2643221680 2644453356 239
68 iso_pu_bacteria 2643221698 2644544906 239
69 iso_pu_bacteria 2643221712 2644615444 239
70 iso_pu_bacteria 2643221723 2644675156 239
71 iso_pu_bacteria 2643221726 2644688617 239
72 iso_pu_bacteria 2690316117 2692319778 239
73 iso_pu_bacteria 2751185821 2753458419 239
74 iso_pu_bacteria 2791355091 2792621750 239
75 iso_pu_bacteria 2791355092 2792628993 239
76 iso_pu_bacteria 2791355094 2792640137 239
77 iso_pu_bacteria 2837651117 2837651410 239
78 iso_pu_bacteria 2838074704 2838078001 239
79 iso_pu_bacteria 2841734538 2841736205 239
80 iso_pu_bacteria 2844163670 2844167979 239
81 iso_pu_bacteria 2847417321 2847420997 239
82 iso_pu_bacteria 2848992105 2848995831 239
83 iso_pu_bacteria 2855872281 2855873692 239
84 iso_pu_bacteria 2856342000 2856342825 239
85 iso_pu_bacteria 2857349434 2857352846 239
86 iso_pu_bacteria 2869162929 2869165324 239
87 iso_pu_bacteria 2871474448 2871480376 239
88 iso_pu_bacteria 2876377896 2876380243 239
89 iso_pu_bacteria 2878788777 2878791353 239
90 iso_pu_bacteria 2885305155 2885306776 239
91 iso_pu_bacteria 2885312484 2885314340 239
92 iso_pu_bacteria 2885326080 2885327933 239
93 iso_pu_bacteria 2885334103 2885342247 239
94 iso_pu_bacteria 2888343758 2888344162 239
95 iso_pu_bacteria 2888350351 2888353076 239
96 iso_pu_bacteria 2889010040 2889014822 239
97 iso_pu_bacteria 2889016732 2889020095 239
98 iso_pu_bacteria 2896384573 2896391447 239
99 iso_pu_bacteria 2906354277 2906357629 239
100 iso_pu_bacteria 2920760137 2920760156 239
101 iso_pu_bacteria 2920822456 2920826117 239
102 iso_pu_bacteria 2922130491 2922135564 239
103 iso_pu_bacteria 2922185730 2922192027 239
104 iso_pu_bacteria 2924754689 2924759349 239
105 iso_pu_bacteria 2937836603 2937840576 239
106 iso_pu_bacteria 2938014810 2938017693 239
107 iso_pu_bacteria 2941499720 2941501541 239
108 iso_pu_bacteria 2958071322 2958077167 239
109 iso_pu_bacteria 2958100919 2958101946 239
110 iso_pu_bacteria 2958172287 2958173394 239
111 iso_pu_bacteria 2965119406 2965126888 239
112 iso_pu_bacteria 2968117919 2968122749 239
113 iso_pu_bacteria 2970524798 2970525874 239
114 iso_pu_bacteria 2970540015 2970546072 239
115 iso_pu_bacteria 2977942078 2977943433 239
116 iso_pu_bacteria 2977971508 2977974038 239
117 iso_pu_bacteria 2979710463 2979714301 239
118 iso_pu_bacteria 2979742915 2979747368 239
119 iso_pu_bacteria 2987636660 2987641438 239
120 iso_pu_bacteria 2987652177 2987656427 239
121 iso_pu_bacteria 3004203850 3004210247 239
122 iso_pu_bacteria 643692032 643827585 239
123 iso_pu_bacteria 8004395343 8004400647 239
124 iso_pu_bacteria 8004633249 8004639993 239
125 iso_pu_bacteria 8055617313 8055617690 239
126 3300003578 Ga0006562J51391_1044137 Ga0006562J51391_10441372 240
127 3300005336 Ga0070680_100043877 Ga0070680_1000438775 240
128 3300005347 Ga0070668_100009043 Ga0070668_10000904310 240
129 3300005356 Ga0070674_100174359 Ga0070674_1001743592 240
130 3300005455 Ga0070663_100091605 Ga0070663_1000916052 240
131 3300005539 Ga0068853_100022250 Ga0068853_1000222502 240
132 3300005539 Ga0068853_100303606 Ga0068853_1003036061 240
133 3300005578 Ga0068854_100120124 Ga0068854_1001201244 240
134 3300005614 Ga0068856_100080282 Ga0068856_1000802823 240
135 3300005616 Ga0068852_100008312 Ga0068852_1000083122 240
136 3300006038 Ga0075365_10150975 Ga0075365_101509752 240
137 3300006038 Ga0075365_10157444 Ga0075365_101574442 240
138 3300006051 Ga0075364_10084053 Ga0075364_100840534 240
139 3300006177 Ga0075362_10064135 Ga0075362_100641353 240
140 3300009093 Ga0105240_10190548 Ga0105240_101905483 240
141 3300009551 Ga0105238_10465432 Ga0105238_104654322 240
142 3300013102 Ga0157371_10006514 Ga0157371_100065146 240
143 3300013104 Ga0157370_10027388 Ga0157370_100273886 240
144 3300013104 Ga0157370_10072428 Ga0157370_100724285 240
145 3300013105 Ga0157369_10001671 Ga0157369_100016719 240
146 3300013105 Ga0157369_10228157 Ga0157369_102281571 240
147 3300013297 Ga0157378_10026218 Ga0157378_100262185 240
148 3300021384 Ga0213876_10141061 Ga0213876_101410611 240
149 3300025909 Ga0207705_10356539 Ga0207705_103565392 240
150 3300025912 Ga0207707_10052631 Ga0207707_100526315 240
151 3300025914 Ga0207671_10353340 Ga0207671_103533402 240
152 3300025919 Ga0207657_10047396 Ga0207657_100473964 240
153 3300025932 Ga0207690_10098289 Ga0207690_100982892 240
154 3300025942 Ga0207689_10576812 Ga0207689_105768121 240
155 3300025972 Ga0207668_10007293 Ga0207668_100072938 240
156 3300025981 Ga0207640_10064391 Ga0207640_100643911 240
157 3300026041 Ga0207639_10005199 Ga0207639_100051997 240
158 3300026067 Ga0207678_10045203 Ga0207678_100452034 240
159 3300026067 Ga0207678_10067252 Ga0207678_100672522 240
160 3300028794 Ga0307515_10004817 Ga0307515_100048175 240
161 3300028794 Ga0307515_10118494 Ga0307515_101184944 240
162 3300031649 Ga0307514_10187636 Ga0307514_101876362 240
163 3300031665 Ga0316575_10065357 Ga0316575_100653572 240
164 3300032004 Ga0307414_10010279 Ga0307414_100102792 240
165 3300032004 Ga0307414_10026741 Ga0307414_100267415 240
166 3300036647 Ga0316582_0299926 Ga0316582_0299926_115_876 240
167 3300037471 Ga0395905_0001904 Ga0395905_0001904_22620_23348 240
168 3300037471 Ga0395905_0209857 Ga0395905_0209857_894_1622 240
169 3300038443 Ga0395901_0030541 Ga0395901_0030541_1582_2325 240
170 3300039437 Ga0436365_1812542 Ga0436365_1812542_234_977 240
171 3300041413 Ga0439465_0055476 Ga0439465_0055476_453_1196 240
172 3300044673 Ga0453683_0007838 Ga0453683_0007838_3407_4132 240
173 3300045051 Ga0451576_0000203 Ga0451576_0000203_104822_105547 240
174 3300045051 Ga0451576_0006551 Ga0451576_0006551_10446_11171 240
175 3300046460 Ga0495638_0036678 Ga0495638_0036678_1410_2138 240
176 3300046460 Ga0495638_0059028 Ga0495638_0059028_152_880 240
177 3300046660 Ga0495625_0259920 Ga0495625_0259920_72_800 240
178 3300047320 Ga0495672_0188510 Ga0495672_0188510_275_1012 240
179 3300047472 Ga0495686_0256510 Ga0495686_0256510_220_963 240
180 3300048913 Ga0496110_0583200 Ga0496110_0583200_206_949 240
181 3300048918 Ga0496115_0129918 Ga0496115_0129918_1129_1851 240
182 3300048924 Ga0496121_0028678 Ga0496121_0028678_2199_2942 240
183 3300049568 Ga0501031_0003364 Ga0501031_0003364_5314_6054 240
184 3300049569 Ga0501032_0000001 Ga0501032_0000001_178715_179455 240
185 3300049569 Ga0501032_0141929 Ga0501032_0141929_797_1531 240
186 3300049570 Ga0501033_0000275 Ga0501033_0000275_48541_49281 240
187 3300049570 Ga0501033_0004330 Ga0501033_0004330_3622_4362 240
188 3300049570 Ga0501033_0085596 Ga0501033_0085596_162_896 240
189 3300049571 Ga0501034_0002200 Ga0501034_0002200_20879_21619 240
190 3300049571 Ga0501034_0009670 Ga0501034_0009670_6058_6801 240
191 3300049571 Ga0501034_0039528 Ga0501034_0039528_51_776 240
192 3300049571 Ga0501034_0062879 Ga0501034_0062879_1664_2395 240
193 3300049571 Ga0501034_0159948 Ga0501034_0159948_173_907 240
194 3300049571 Ga0501034_0301358 Ga0501034_0301358_673_1416 240
195 3300049571 Ga0501034_0314631 Ga0501034_0314631_324_1064 240
196 3300049571 Ga0501034_0365033 Ga0501034_0365033_470_1201 240
197 3300049571 Ga0501034_0705905 Ga0501034_0705905_10_741 240
198 3300049572 Ga0501036_0000358 Ga0501036_0000358_27438_28178 240
199 3300049573 Ga0501037_0000091 Ga0501037_0000091_56699_57439 240
200 3300049574 Ga0501038_0003916 Ga0501038_0003916_410_1150 240
201 3300049575 Ga0501039_0000011 Ga0501039_0000011_244103_244843 240
202 3300049575 Ga0501039_0495622 Ga0501039_0495622_74_805 240
203 3300049579 Ga0501043_0000016 Ga0501043_0000016_164724_165464 240
204 3300049579 Ga0501043_0291242 Ga0501043_0291242_278_1018 240
205 3300049580 Ga0501046_0071668 Ga0501046_0071668_893_1633 240
206 3300049581 Ga0501047_0053862 Ga0501047_0053862_1292_2017 240
207 3300049581 Ga0501047_0463172 Ga0501047_0463172_83_823 240
208 3300049582 Ga0501048_0258695 Ga0501048_0258695_343_1083 240
209 3300049585 Ga0501069_0162240 Ga0501069_0162240_448_1188 240
210 3300049586 Ga0501070_0054195 Ga0501070_0054195_558_1298 240
211 3300049586 Ga0501070_0083485 Ga0501070_0083485_527_1258 240
212 3300049586 Ga0501070_0099928 Ga0501070_0099928_1084_1824 240
213 3300049589 Ga0501073_0095523 Ga0501073_0095523_1005_1745 240
214 3300049590 Ga0501074_0081602 Ga0501074_0081602_224_964 240
215 3300049742 Ga0501080_0007654 Ga0501080_0007654_7449_8189 240
216 3300049742 Ga0501080_0397136 Ga0501080_0397136_342_1082 240
217 3300049822 Ga0501035_0000806 Ga0501035_0000806_10270_11010 240
218 3300049822 Ga0501035_0021669 Ga0501035_0021669_4810_5541 240
219 3300049822 Ga0501035_0022781 Ga0501035_0022781_4603_5343 240
220 3300049822 Ga0501035_0328762 Ga0501035_0328762_420_1160 240
221 3300049823 Ga0501044_0005415 Ga0501044_0005415_820_1560 240
222 3300049823 Ga0501044_0066879 Ga0501044_0066879_162_902 240
223 3300049823 Ga0501044_0105957 Ga0501044_0105957_438_1172 240
224 3300049823 Ga0501044_0269363 Ga0501044_0269363_627_1358 240
225 3300049823 Ga0501044_0429770 Ga0501044_0429770_55_786 240
226 3300049823 Ga0501044_0560756 Ga0501044_0560756_203_943 240
227 3300050490 nmdc:mga03n38_93329_c1 nmdc:mga03n38_93329_c1_145_888 240
228 3300050492 nmdc:mga0yw44_152745_c1 nmdc:mga0yw44_152745_c1_214_945 240
229 3300050492 nmdc:mga0yw44_24199_c1 nmdc:mga0yw44_24199_c1_181_912 240
230 3300050493 nmdc:mga0k408_35003_c1 nmdc:mga0k408_35003_c1_106_849 240
231 3300050496 nmdc:mga07m45_31582_c1 nmdc:mga07m45_31582_c1_1703_2446 240
232 3300053088 Ga0500644_0018125 Ga0500644_0018125_1102_1830 240
233 3300053136 Ga0500559_0017630 Ga0500559_0017630_502_1230 240
234 3300053139 Ga0500568_0000010 Ga0500568_0000010_172785_173513 240
235 3300053156 Ga0500622_0000517 Ga0500622_0000517_23831_24559 240
236 3300053158 Ga0500627_0204713 Ga0500627_0204713_135_863 240
237 3300054114 Ga0501084_0305956 Ga0501084_0305956_436_1179 240
238 iso_pu_bacteria 2503198000 2503198463 240
239 iso_pu_bacteria 2508501123 2509114047 240
240 iso_pu_bacteria 2509276018 2509368529 240
241 iso_pu_bacteria 2509276022 2509393551 240
242 iso_pu_bacteria 2510065059 2510314810 240
243 iso_pu_bacteria 2512875016 2512934072 240
244 iso_pu_bacteria 2512875024 2512962361 240
245 iso_pu_bacteria 2513237090 2513610645 240
246 iso_pu_bacteria 2513237164 2514038678 240
247 iso_pu_bacteria 2513237305 2514418223 240
248 iso_pu_bacteria 2588253730 2588520211 240
249 iso_pu_bacteria 2599185301 2599935244 240
250 iso_pu_bacteria 2643221595 2643983790 240
251 iso_pu_bacteria 2643221623 2644133971 240
252 iso_pu_bacteria 2643221627 2644155923 240
253 iso_pu_bacteria 2687453392 2688595784 240
254 iso_pu_bacteria 2693429783 2694627960 240
255 iso_pu_bacteria 2693429784 2694636210 240
256 iso_pu_bacteria 2721755686 2723573068 240
257 iso_pu_bacteria 2738541317 2738947145 240
258 iso_pu_bacteria 2738543024 2739310293 240
259 iso_pu_bacteria 2756170246 2756674855 240
260 iso_pu_bacteria 2791355123 2792746972 240
261 iso_pu_bacteria 2844002411 2844003668 240
262 iso_pu_bacteria 2844009547 2844010589 240
263 iso_pu_bacteria 2847670302 2847673377 240
264 iso_pu_bacteria 2847686936 2847689887 240
265 iso_pu_bacteria 2856314179 2856319154 240
266 iso_pu_bacteria 2856320880 2856322211 240
267 iso_pu_bacteria 2856328259 2856332730 240
268 iso_pu_bacteria 2856334872 2856340717 240
269 iso_pu_bacteria 2856356410 2856361553 240
270 iso_pu_bacteria 2856364286 2856369956 240
271 iso_pu_bacteria 2857367948 2857369274 240
272 iso_pu_bacteria 2869169390 2869176210 240
273 iso_pu_bacteria 2869234852 2869235302 240
274 iso_pu_bacteria 2869242130 2869249341 240
275 iso_pu_bacteria 2869249662 2869251656 240
276 iso_pu_bacteria 2869256925 2869257079 240
277 iso_pu_bacteria 2869264136 2869269884 240
278 iso_pu_bacteria 2869271264 2869277336 240
279 iso_pu_bacteria 2869278585 2869284694 240
280 iso_pu_bacteria 2869285874 2869290763 240
281 iso_pu_bacteria 2871429161 2871433045 240
282 iso_pu_bacteria 2871435913 2871440698 240
283 iso_pu_bacteria 2871444079 2871444537 240
284 iso_pu_bacteria 2871451962 2871452950 240
285 iso_pu_bacteria 2871459585 2871465938 240
286 iso_pu_bacteria 2871481445 2871483989 240
287 iso_pu_bacteria 2871488783 2871489669 240
288 iso_pu_bacteria 2871495908 2871502314 240
289 iso_pu_bacteria 2874102143 2874104851 240
290 iso_pu_bacteria 2874109183 2874116484 240
291 iso_pu_bacteria 2874116593 2874122046 240
292 iso_pu_bacteria 2874123672 2874124250 240
293 iso_pu_bacteria 2874131515 2874133674 240
294 iso_pu_bacteria 2874139085 2874142986 240
295 iso_pu_bacteria 2874146452 2874153794 240
296 iso_pu_bacteria 2874155637 2874161059 240
297 iso_pu_bacteria 2874162495 2874168352 240
298 iso_pu_bacteria 2874168670 2874172196 240
299 iso_pu_bacteria 2876363079 2876363670 240
300 iso_pu_bacteria 2876386047 2876386533 240
301 iso_pu_bacteria 2876392853 2876397121 240
302 iso_pu_bacteria 2876399893 2876406084 240
303 iso_pu_bacteria 2876406927 2876408536 240
304 iso_pu_bacteria 2876413966 2876419099 240
305 iso_pu_bacteria 2876420981 2876424510 240
306 iso_pu_bacteria 2878035449 2878039543 240
307 iso_pu_bacteria 2878730984 2878731343 240
308 iso_pu_bacteria 2878745973 2878750658 240
309 iso_pu_bacteria 2878753008 2878754295 240
310 iso_pu_bacteria 2878760144 2878766205 240
311 iso_pu_bacteria 2878767105 2878773406 240
312 iso_pu_bacteria 2878774303 2878776600 240
313 iso_pu_bacteria 2878781027 2878781406 240
314 iso_pu_bacteria 2881147464 2881148212 240
315 iso_pu_bacteria 2881155292 2881159205 240
316 iso_pu_bacteria 2881161766 2881164901 240
317 iso_pu_bacteria 2881845957 2881851916 240
318 iso_pu_bacteria 2881861095 2881866000 240
319 iso_pu_bacteria 2882912400 2882913279 240
320 iso_pu_bacteria 2885318864 2885325027 240
321 iso_pu_bacteria 2885342637 2885349871 240
322 iso_pu_bacteria 2885350715 2885353831 240
323 iso_pu_bacteria 2888337043 2888343303 240
324 iso_pu_bacteria 2891048133 2891048606 240
325 iso_pu_bacteria 2903448605 2903454245 240
326 iso_pu_bacteria 2903492973 2903496265 240
327 iso_pu_bacteria 2903492973 2903497390 240
328 iso_pu_bacteria 2903513507 2903514833 240
329 iso_pu_bacteria 2903521522 2903523269 240
330 iso_pu_bacteria 2903528002 2903529308 240
331 iso_pu_bacteria 2903540706 2903547251 240
332 iso_pu_bacteria 2904659560 2904663875 240
333 iso_pu_bacteria 2906308376 2906313583 240
334 iso_pu_bacteria 2906321335 2906326292 240
335 iso_pu_bacteria 2906328253 2906334251 240
336 iso_pu_bacteria 2906363423 2906367224 240
337 iso_pu_bacteria 2906370794 2906372819 240
338 iso_pu_bacteria 2906378014 2906382089 240
339 iso_pu_bacteria 2906386501 2906392146 240
340 iso_pu_bacteria 2906393657 2906395046 240
341 iso_pu_bacteria 2906401398 2906407341 240
342 iso_pu_bacteria 2906408224 2906409443 240
343 iso_pu_bacteria 2906414383 2906419226 240
344 iso_pu_bacteria 2913308742 2913312026 240
345 iso_pu_bacteria 2922151315 2922151886 240
346 iso_pu_bacteria 2922158528 2922160884 240
347 iso_pu_bacteria 2922172374 2922174404 240
348 iso_pu_bacteria 2922178524 2922185402 240
349 iso_pu_bacteria 2924710171 2924716433 240
350 iso_pu_bacteria 2924718760 2924722706 240
351 iso_pu_bacteria 2924726620 2924731155 240
352 iso_pu_bacteria 2924733363 2924736527 240
353 iso_pu_bacteria 2924741084 2924741098 240
354 iso_pu_bacteria 2924748358 2924748648 240
355 iso_pu_bacteria 2924762789 2924765584 240
356 iso_pu_bacteria 2924784321 2924784983 240
357 iso_pu_bacteria 2937813078 2937820112 240
358 iso_pu_bacteria 2937822353 2937826516 240
359 iso_pu_bacteria 2937848649 2937849587 240
360 iso_pu_bacteria 2937861824 2937866126 240
361 iso_pu_bacteria 2937868953 2937876088 240
362 iso_pu_bacteria 2937877337 2937878820 240
363 iso_pu_bacteria 2937891427 2937897240 240
364 iso_pu_bacteria 2937972304 2937974399 240
365 iso_pu_bacteria 2937980651 2937982388 240
366 iso_pu_bacteria 2937994558 2938001114 240
367 iso_pu_bacteria 2958034702 2958041451 240
368 iso_pu_bacteria 2958041894 2958042425 240
369 iso_pu_bacteria 2958064165 2958065277 240
370 iso_pu_bacteria 2958084443 2958085971 240
371 iso_pu_bacteria 2958092219 2958097648 240
372 iso_pu_bacteria 2958108152 2958109030 240
373 iso_pu_bacteria 2958115193 2958119232 240
374 iso_pu_bacteria 2958122699 2958123268 240
375 iso_pu_bacteria 2958130278 2958135163 240
376 iso_pu_bacteria 2958137437 2958142206 240
377 iso_pu_bacteria 2958158011 2958160369 240
378 iso_pu_bacteria 2958165035 2958171380 240
379 iso_pu_bacteria 2958179912 2958184192 240
380 iso_pu_bacteria 2961077736 2961082247 240
381 iso_pu_bacteria 2961114664 2961118985 240
382 iso_pu_bacteria 2961127735 2961135600 240
383 iso_pu_bacteria 2961136820 2961140077 240
384 iso_pu_bacteria 2961163497 2961169821 240
385 iso_pu_bacteria 2961170736 2961176352 240
386 iso_pu_bacteria 2961183825 2961184406 240
387 iso_pu_bacteria 2963644680 2963645130 240
388 iso_pu_bacteria 2965018300 2965024581 240
389 iso_pu_bacteria 2965025482 2965030179 240
390 iso_pu_bacteria 2965032056 2965032771 240
391 iso_pu_bacteria 2965040258 2965040881 240
392 iso_pu_bacteria 2965047637 2965049007 240
393 iso_pu_bacteria 2965062239 2965062340 240
394 iso_pu_bacteria 2965089291 2965096619 240
395 iso_pu_bacteria 2965102966 2965107233 240
396 iso_pu_bacteria 2965110997 2965114545 240
397 iso_pu_bacteria 2967996073 2967996733 240
398 iso_pu_bacteria 2968003550 2968004795 240
399 iso_pu_bacteria 2968016561 2968022971 240
400 iso_pu_bacteria 2968083720 2968089971 240
401 iso_pu_bacteria 2968091066 2968093663 240
402 iso_pu_bacteria 2968097103 2968098493 240
403 iso_pu_bacteria 2968110612 2968115014 240
404 iso_pu_bacteria 2968128360 2968133904 240
405 iso_pu_bacteria 2968171901 2968178213 240
406 iso_pu_bacteria 2970469710 2970475556 240
407 iso_pu_bacteria 2970489779 2970490032 240
408 iso_pu_bacteria 2970503327 2970509023 240
409 iso_pu_bacteria 2970510686 2970517553 240
410 iso_pu_bacteria 2970532167 2970535530 240
411 iso_pu_bacteria 2970547951 2970554376 240
412 iso_pu_bacteria 2970554993 2970561059 240
413 iso_pu_bacteria 2970593180 2970599305 240
414 iso_pu_bacteria 2970619444 2970619878 240
415 iso_pu_bacteria 2970627176 2970630197 240
416 iso_pu_bacteria 2977821940 2977823509 240
417 iso_pu_bacteria 2977828996 2977834927 240
418 iso_pu_bacteria 2977843712 2977850344 240
419 iso_pu_bacteria 2977851361 2977855259 240
420 iso_pu_bacteria 2977858184 2977859837 240
421 iso_pu_bacteria 2977864932 2977870219 240
422 iso_pu_bacteria 2977872689 2977879658 240
423 iso_pu_bacteria 2977898635 2977903219 240
424 iso_pu_bacteria 2977907340 2977909171 240
425 iso_pu_bacteria 2977915119 2977921263 240
426 iso_pu_bacteria 2977922695 2977925741 240
427 iso_pu_bacteria 2977935797 2977940946 240
428 iso_pu_bacteria 2977950692 2977950908 240
429 iso_pu_bacteria 2977957713 2977960678 240
430 iso_pu_bacteria 2977986579 2977988135 240
431 iso_pu_bacteria 2979764755 2979770915 240
432 iso_pu_bacteria 2979772303 2979772723 240
433 iso_pu_bacteria 2979779861 2979781815 240
434 iso_pu_bacteria 2979793036 2979798081 240
435 iso_pu_bacteria 2979808191 2979813702 240
436 iso_pu_bacteria 2987645492 2987651455 240
437 iso_pu_bacteria 2987659509 2987666045 240
438 iso_pu_bacteria 2987666974 2987669329 240
439 iso_pu_bacteria 2987673487 2987675279 240
440 iso_pu_bacteria 2996310559 2996311603 240
441 iso_pu_bacteria 2996336353 2996341593 240
442 iso_pu_bacteria 2996341866 2996342414 240
443 iso_pu_bacteria 2996348954 2996355834 240
444 iso_pu_bacteria 2996386984 2996387529 240
445 iso_pu_bacteria 3000135777 3000137153 240
446 iso_pu_bacteria 3004167301 3004173014 240
447 iso_pu_bacteria 3004188549 3004195068 240
448 iso_pu_bacteria 3004195979 3004199896 240
449 iso_pu_bacteria 3004211236 3004217279 240
450 iso_pu_bacteria 3004218560 3004220455 240
451 iso_pu_bacteria 3004232784 3004233575 240
452 iso_pu_bacteria 3004239961 3004244503 240
453 iso_pu_bacteria 3004248173 3004252864 240
454 iso_pu_bacteria 3004268573 3004272419 240
455 iso_pu_bacteria 3004275668 3004282260 240
456 iso_pu_bacteria 3004289098 3004294636 240
457 iso_pu_bacteria 637000159 637077222 240
458 iso_pu_bacteria 649633066 649870351 240
459 iso_pu_bacteria 8002285264 8002286374 240
460 iso_pu_bacteria 8004300914 8004305816 240
461 iso_pu_bacteria 8004312739 8004316569 240
462 iso_pu_bacteria 8004361976 8004367505 240
463 iso_pu_bacteria 8004374579 8004375871 240
464 iso_pu_bacteria 8004387939 8004393052 240
465 iso_pu_bacteria 8004445564 8004450319 240
466 iso_pu_bacteria 8004640170 8004641540 240
467 iso_pu_bacteria 8004695233 8004703609 240
468 iso_pu_bacteria 8004703790 8004706816 240
469 iso_pu_bacteria 8004714634 8004719839 240
470 iso_pu_bacteria 8004727605 8004729854 240
471 3300006177 Ga0075362_10076286 Ga0075362_100762862 241
472 3300037312 Ga0395899_0226645 Ga0395899_0226645_134_871 241
473 3300037418 Ga0395900_0239920 Ga0395900_0239920_491_1228 241
474 3300037466 Ga0395898_0243897 Ga0395898_0243897_900_1637 241
475 3300038443 Ga0395901_0221777 Ga0395901_0221777_296_1033 241
476 3300049568 Ga0501031_0000002 Ga0501031_0000002_164179_164922 241
477 3300049568 Ga0501031_0009932 Ga0501031_0009932_4927_5655 241
478 3300049568 Ga0501031_0104767 Ga0501031_0104767_147_914 241
479 3300049569 Ga0501032_0000004 Ga0501032_0000004_52701_53444 241
480 3300049569 Ga0501032_0076687 Ga0501032_0076687_175_903 241
481 3300049569 Ga0501032_0399348 Ga0501032_0399348_89_856 241
482 3300049570 Ga0501033_0000016 Ga0501033_0000016_164015_164758 241
483 3300049571 Ga0501034_0000011 Ga0501034_0000011_52701_53444 241
484 3300049572 Ga0501036_0000001 Ga0501036_0000001_52701_53444 241
485 3300049573 Ga0501037_0000006 Ga0501037_0000006_164018_164761 241
486 3300049574 Ga0501038_0000003 Ga0501038_0000003_52701_53444 241
487 3300049574 Ga0501038_0048130 Ga0501038_0048130_2043_2771 241
488 3300049574 Ga0501038_0117117 Ga0501038_0117117_1417_2184 241
489 3300049575 Ga0501039_0000004 Ga0501039_0000004_52701_53444 241
490 3300049576 Ga0501040_0010669 Ga0501040_0010669_1366_2109 241
491 3300049579 Ga0501043_0000765 Ga0501043_0000765_22653_23396 241
492 3300049579 Ga0501043_0100150 Ga0501043_0100150_1178_1906 241
493 3300049581 Ga0501047_0000740 Ga0501047_0000740_30521_31288 241
494 3300049581 Ga0501047_0008050 Ga0501047_0008050_3923_4666 241
495 3300049581 Ga0501047_0088599 Ga0501047_0088599_1408_2136 241
496 3300049585 Ga0501069_0003825 Ga0501069_0003825_1970_2737 241
497 3300049586 Ga0501070_0000014 Ga0501070_0000014_163952_164680 241
498 3300049586 Ga0501070_0006268 Ga0501070_0006268_1602_2345 241
499 3300049586 Ga0501070_0013025 Ga0501070_0013025_2727_3494 241
500 3300049742 Ga0501080_0002117 Ga0501080_0002117_13725_14453 241
501 3300049742 Ga0501080_0368067 Ga0501080_0368067_373_1140 241
502 3300049822 Ga0501035_0000009 Ga0501035_0000009_257384_258127 241
503 3300049822 Ga0501035_0002615 Ga0501035_0002615_7722_8450 241
504 3300049822 Ga0501035_0004991 Ga0501035_0004991_1455_2222 241
505 3300049823 Ga0501044_0000005 Ga0501044_0000005_52701_53444 241
506 3300049823 Ga0501044_0003065 Ga0501044_0003065_2904_3632 241
507 3300049823 Ga0501044_0056156 Ga0501044_0056156_901_1668 241
508 3300050489 nmdc:mga03683_198984_c1 nmdc:mga03683_198984_c1_151_891 241
509 3300050495 nmdc:mga04h51_171540_c1 nmdc:mga04h51_171540_c1_22_753 241
510 iso_pu_bacteria 2510065057 2510308499 241
511 iso_pu_bacteria 2510917026 2511168582 241
512 iso_pu_bacteria 2511231027 2511391901 241
513 iso_pu_bacteria 2511231052 2511498645 241
514 iso_pu_bacteria 2513237086 2513587716 241
515 iso_pu_bacteria 2513237091 2513619923 241
516 iso_pu_bacteria 2513237140 2513886694 241
517 iso_pu_bacteria 2513237143 2513904713 241
518 iso_pu_bacteria 2513237159 2514001657 241
519 iso_pu_bacteria 2516653046 2516894922 241
520 iso_pu_bacteria 2537561587 2537874506 241
521 iso_pu_bacteria 2551306084 2551674314 241
522 iso_pu_bacteria 2551306084 2551677854 241
523 iso_pu_bacteria 2551306085 2551686194 241
524 iso_pu_bacteria 2551306086 2551694964 241
525 iso_pu_bacteria 2551306087 2551700344 241
526 iso_pu_bacteria 2551306089 2551710714 241
527 iso_pu_bacteria 2551306090 2551722905 241
528 iso_pu_bacteria 2551306091 2551731166 241
529 iso_pu_bacteria 2551306092 2551734666 241
530 iso_pu_bacteria 2551306093 2551746472 241
531 iso_pu_bacteria 2554235003 2554249036 241
532 iso_pu_bacteria 2558860242 2559296124 241
533 iso_pu_bacteria 2582581283 2585166441 241
534 iso_pu_bacteria 2582581306 2585267236 241
535 iso_pu_bacteria 2582581865 2585388287 241
536 iso_pu_bacteria 2582581866 2585396116 241
537 iso_pu_bacteria 2585427633 2585998125 241
538 iso_pu_bacteria 2585427634 2586002704 241
539 iso_pu_bacteria 2599185156 2599335702 241
540 iso_pu_bacteria 2599185210 2599603083 241
541 iso_pu_bacteria 2599185236 2599722685 241
542 iso_pu_bacteria 2600254933 2600377490 241
543 iso_pu_bacteria 2600255279 2601611011 241
544 iso_pu_bacteria 2600255308 2601747785 241
545 iso_pu_bacteria 2643221558 2643814931 241
546 iso_pu_bacteria 2643221582 2643921648 241
547 iso_pu_bacteria 2643221607 2644052503 241
548 iso_pu_bacteria 2643221636 2644201114 241
549 iso_pu_bacteria 2643221637 2644209724 241
550 iso_pu_bacteria 2643221686 2644484781 241
551 iso_pu_bacteria 2643221688 2644492496 241
552 iso_pu_bacteria 2643221693 2644521702 241
553 iso_pu_bacteria 2643221718 2644653252 241
554 iso_pu_bacteria 2765235802 2765465789 241
555 iso_pu_bacteria 2767802442 2770199095 241
556 iso_pu_bacteria 2775506902 2776269499 241
557 iso_pu_bacteria 2775506904 2776282429 241
558 iso_pu_bacteria 2791355253 2793281880 241
559 iso_pu_bacteria 2808606387 2808988050 241
560 iso_pu_bacteria 2818991439 2819561134 241
561 iso_pu_bacteria 2818991461 2819688410 241
562 iso_pu_bacteria 2821123053 2821129159 241
563 iso_pu_bacteria 2838675328 2838678495 241
564 iso_pu_bacteria 2838714209 2838718417 241
565 iso_pu_bacteria 2838719591 2838722791 241
566 iso_pu_bacteria 2838724970 2838728483 241
567 iso_pu_bacteria 2838736955 2838742175 241
568 iso_pu_bacteria 2839993093 2839993431 241
569 iso_pu_bacteria 2840764183 2840766441 241
570 iso_pu_bacteria 2841840854 2841846031 241
571 iso_pu_bacteria 2841846520 2841850347 241
572 iso_pu_bacteria 2841859092 2841863401 241
573 iso_pu_bacteria 2842124991 2842129143 241
574 iso_pu_bacteria 2842130223 2842133388 241
575 iso_pu_bacteria 2842140634 2842145735 241
576 iso_pu_bacteria 2842152218 2842155701 241
577 iso_pu_bacteria 2842170452 2842174341 241
578 iso_pu_bacteria 2842175837 2842179002 241
579 iso_pu_bacteria 2842187318 2842190841 241
580 iso_pu_bacteria 2842211629 2842214835 241
581 iso_pu_bacteria 2842224351 2842227556 241
582 iso_pu_bacteria 2842515876 2842519862 241
583 iso_pu_bacteria 2842521101 2842527120 241
584 iso_pu_bacteria 2842871566 2842874053 241
585 iso_pu_bacteria 2842922631 2842926510 241
586 iso_pu_bacteria 2854896431 2854897743 241
587 iso_pu_bacteria 2854916844 2854922362 241
588 iso_pu_bacteria 2855825444 2855827555 241
589 iso_pu_bacteria 2855839649 2855842930 241
590 iso_pu_bacteria 2857531043 2857536100 241
591 iso_pu_bacteria 2858800743 2858801347 241
592 iso_pu_bacteria 2889790730 2889795828 241
593 iso_pu_bacteria 2891373044 2891377732 241
594 iso_pu_bacteria 2894652903 2894653696 241
595 iso_pu_bacteria 2899792073 2899795503 241
596 iso_pu_bacteria 2899845264 2899849579 241
597 iso_pu_bacteria 2904578770 2904579918 241
598 iso_pu_bacteria 2915986958 2915989949 241
599 iso_pu_bacteria 2915993759 2916000683 241
600 iso_pu_bacteria 2916000859 2916007600 241
601 iso_pu_bacteria 2916007675 2916014262 241
602 iso_pu_bacteria 2916014648 2916021416 241
603 iso_pu_bacteria 2916021584 2916028037 241
604 iso_pu_bacteria 2916028427 2916034692 241
605 iso_pu_bacteria 2916035215 2916041078 241
606 iso_pu_bacteria 2916041962 2916048237 241
607 iso_pu_bacteria 2916048683 2916054411 241
608 iso_pu_bacteria 2916055098 2916061006 241
609 iso_pu_bacteria 2916076590 2916076816 241
610 iso_pu_bacteria 2919114240 2919118326 241
611 iso_pu_bacteria 2919119836 2919120410 241
612 iso_pu_bacteria 2919171160 2919176836 241
613 iso_pu_bacteria 2921201388 2921207770 241
614 iso_pu_bacteria 2921208531 2921208891 241
615 iso_pu_bacteria 2921237296 2921243624 241
616 iso_pu_bacteria 2921244191 2921248333 241
617 iso_pu_bacteria 2921257292 2921263107 241
618 iso_pu_bacteria 2921263974 2921270127 241
619 iso_pu_bacteria 2921282425 2921283658 241
620 iso_pu_bacteria 2921289301 2921292106 241
621 iso_pu_bacteria 2921296804 2921300334 241
622 iso_pu_bacteria 2924144063 2924147709 241
623 iso_pu_bacteria 2924150972 2924157817 241
624 iso_pu_bacteria 2924158325 2924158726 241
625 iso_pu_bacteria 2924165586 2924166023 241
626 iso_pu_bacteria 2924172951 2924178942 241
627 iso_pu_bacteria 2924179722 2924184407 241
628 iso_pu_bacteria 2924186466 2924193033 241
629 iso_pu_bacteria 2924193448 2924199615 241
630 iso_pu_bacteria 2924200457 2924206400 241
631 iso_pu_bacteria 2924207177 2924214014 241
632 iso_pu_bacteria 2924214083 2924220931 241
633 iso_pu_bacteria 2924221636 2924222017 241
634 iso_pu_bacteria 2924228884 2924234624 241
635 iso_pu_bacteria 2926754445 2926754855 241
636 iso_pu_bacteria 2926760298 2926762020 241
637 iso_pu_bacteria 2928521798 2928522685 241
638 iso_pu_bacteria 2933006813 2933010453 241
639 iso_pu_bacteria 2933011516 2933015875 241
640 iso_pu_bacteria 2933594066 2933597388 241
641 iso_pu_bacteria 2937002841 2937008975 241
642 iso_pu_bacteria 2937009748 2937015707 241
643 iso_pu_bacteria 2937016420 2937020948 241
644 iso_pu_bacteria 2937023124 2937028437 241
645 iso_pu_bacteria 2937042894 2937049546 241
646 iso_pu_bacteria 2937049772 2937056497 241
647 iso_pu_bacteria 2937056579 2937063829 241
648 iso_pu_bacteria 2937063883 2937070556 241
649 iso_pu_bacteria 2937071275 2937077958 241
650 iso_pu_bacteria 2937091812 2937098515 241
651 iso_pu_bacteria 2937098957 2937102897 241
652 iso_pu_bacteria 2937106411 2937109734 241
653 iso_pu_bacteria 2937113482 2937118597 241
654 iso_pu_bacteria 2937119839 2937124147 241
655 iso_pu_bacteria 2937126314 2937132259 241
656 iso_pu_bacteria 2954011201 2954013934 241
657 iso_pu_bacteria 2957382221 2957388492 241
658 iso_pu_bacteria 2957388812 2957395140 241
659 iso_pu_bacteria 2957395598 2957401874 241
660 iso_pu_bacteria 2957402308 2957408529 241
661 iso_pu_bacteria 2957408893 2957414265 241
662 iso_pu_bacteria 2957415311 2957422103 241
663 iso_pu_bacteria 2957422303 2957429267 241
664 iso_pu_bacteria 2957430029 2957436754 241
665 iso_pu_bacteria 2957443900 2957448332 241
666 iso_pu_bacteria 2957450854 2957457048 241
667 iso_pu_bacteria 2957457609 2957464506 241
668 iso_pu_bacteria 2957464669 2957470414 241
669 iso_pu_bacteria 2957471148 2957477870 241
670 iso_pu_bacteria 2957478035 2957479982 241
671 iso_pu_bacteria 2957484790 2957491332 241
672 iso_pu_bacteria 2957491536 2957497590 241
673 iso_pu_bacteria 2957498199 2957504964 241
674 iso_pu_bacteria 2957505466 2957512957 241
675 iso_pu_bacteria 2960584000 2960584284 241
676 iso_pu_bacteria 2960597568 2960602707 241
677 iso_pu_bacteria 2960603979 2960610641 241
678 iso_pu_bacteria 2960610863 2960616823 241
679 iso_pu_bacteria 2960617483 2960619035 241
680 iso_pu_bacteria 2960624210 2960631090 241
681 iso_pu_bacteria 2960637947 2960638888 241
682 iso_pu_bacteria 2960645483 2960646182 241
683 iso_pu_bacteria 2960652885 2960660193 241
684 iso_pu_bacteria 2960660292 2960664869 241
685 iso_pu_bacteria 2960667422 2960673134 241
686 iso_pu_bacteria 2960674078 2960675234 241
687 iso_pu_bacteria 2960687367 2960693553 241
688 iso_pu_bacteria 2964607997 2964608246 241
689 iso_pu_bacteria 2964615318 2964621511 241
690 iso_pu_bacteria 2964621998 2964624407 241
691 iso_pu_bacteria 2964628898 2964635632 241
692 iso_pu_bacteria 2964636051 2964642954 241
693 iso_pu_bacteria 2964643177 2964649056 241
694 iso_pu_bacteria 2964649959 2964655156 241
695 iso_pu_bacteria 2964656573 2964660035 241
696 iso_pu_bacteria 2964663802 2964670830 241
697 iso_pu_bacteria 2964670856 2964671648 241
698 iso_pu_bacteria 2964678106 2964678357 241
699 iso_pu_bacteria 2964685014 2964685761 241
700 iso_pu_bacteria 2964691889 2964698573 241
701 iso_pu_bacteria 2964698721 2964705045 241
702 iso_pu_bacteria 2964705432 2964712238 241
703 iso_pu_bacteria 2964712639 2964714495 241
704 iso_pu_bacteria 2964719344 2964726770 241
705 iso_pu_bacteria 2967664464 2967670430 241
706 iso_pu_bacteria 2967671571 2967673828 241
707 iso_pu_bacteria 2967678726 2967681304 241
708 iso_pu_bacteria 2967693043 2967696521 241
709 iso_pu_bacteria 2967699805 2967700599 241
710 iso_pu_bacteria 2967706974 2967707723 241
711 iso_pu_bacteria 2967714385 2967721252 241
712 iso_pu_bacteria 2967721400 2967728431 241
713 iso_pu_bacteria 2967735183 2967738519 241
714 iso_pu_bacteria 2967742019 2967748545 241
715 iso_pu_bacteria 2967748971 2967754021 241
716 iso_pu_bacteria 2967755722 2967757803 241
717 iso_pu_bacteria 2967762386 2967765740 241
718 iso_pu_bacteria 2967769361 2967775237 241
719 iso_pu_bacteria 2967775926 2967782673 241
720 iso_pu_bacteria 2970019648 2970022045 241
721 iso_pu_bacteria 2970033650 2970040602 241
722 iso_pu_bacteria 2970040964 2970046655 241
723 iso_pu_bacteria 2970047711 2970048267 241
724 iso_pu_bacteria 2970054988 2970060575 241
725 iso_pu_bacteria 2970061556 2970068686 241
726 iso_pu_bacteria 2970068827 2970075895 241
727 iso_pu_bacteria 2970076120 2970082043 241
728 iso_pu_bacteria 2970082768 2970087869 241
729 iso_pu_bacteria 2970088815 2970095026 241
730 iso_pu_bacteria 2970095765 2970097271 241
731 iso_pu_bacteria 2970102677 2970104555 241
732 iso_pu_bacteria 2970109326 2970114457 241
733 iso_pu_bacteria 2970116247 2970120897 241
734 iso_pu_bacteria 2970129317 2970133466 241
735 iso_pu_bacteria 2970136068 2970138603 241
736 iso_pu_bacteria 2970149975 2970156358 241
737 iso_pu_bacteria 2970156795 2970163456 241
738 iso_pu_bacteria 2970164137 2970169951 241
739 iso_pu_bacteria 2970170962 2970177040 241
740 iso_pu_bacteria 2970177841 2970184197 241
741 iso_pu_bacteria 2970184632 2970189705 241
742 iso_pu_bacteria 2970191845 2970198239 241
743 iso_pu_bacteria 2977516862 2977523787 241
744 iso_pu_bacteria 2977523885 2977530247 241
745 iso_pu_bacteria 2977537788 2977543010 241
746 iso_pu_bacteria 2977551784 2977557956 241
747 iso_pu_bacteria 2977558990 2977560030 241
748 iso_pu_bacteria 2977565890 2977570545 241
749 iso_pu_bacteria 2977572785 2977579089 241
750 iso_pu_bacteria 2977579622 2977583011 241
751 iso_pu_bacteria 2979089926 2979092711 241
752 iso_pu_bacteria 2979095461 2979099898 241
753 iso_pu_bacteria 2979100975 2979104683 241
754 iso_pu_bacteria 2984509177 2984513518 241
755 iso_pu_bacteria 2984518228 2984522901 241
756 iso_pu_bacteria 2984537506 2984542208 241
757 iso_pu_bacteria 2984601300 2984601636 241
758 iso_pu_bacteria 2989349275 2989355132 241
759 iso_pu_bacteria 2989771324 2989771821 241
760 iso_pu_bacteria 3002141150 3002141773 241
761 iso_pu_bacteria 3003930520 3003931203 241
762 iso_pu_bacteria 648276728 648740770 241
763 iso_pu_bacteria 650716007 650738542 241
764 iso_pu_bacteria 8003570095 8003573598 241
765 iso_pu_bacteria 8003992118 8003995512 241
766 iso_pu_bacteria 8018150411 8018152133 241
767 iso_pu_bacteria 8054558443 8054563138 241
768 iso_pu_bacteria 8056875544 8056878408 241
769 3300006051 Ga0075364_10244059 Ga0075364_102440591 242
770 3300006844 Ga0075428_100142461 Ga0075428_1001424613 242
771 3300013102 Ga0157371_10004987 Ga0157371_100049879 242
772 3300025294 Ga0209025_1098907 Ga0209025_10989072 242
773 3300048919 Ga0496116_0000057 Ga0496116_0000057_14571_15305 242
774 3300048919 Ga0496116_0139606 Ga0496116_0139606_42_776 242
775 3300048920 Ga0496117_0015342 Ga0496117_0015342_979_1713 242
776 3300048920 Ga0496117_0121772 Ga0496117_0121772_766_1500 242
777 3300048921 Ga0496118_0099098 Ga0496118_0099098_1144_1878 242
778 3300048922 Ga0496119_0017605 Ga0496119_0017605_2873_3607 242
779 3300048923 Ga0496120_0046132 Ga0496120_0046132_486_1220 242
780 3300048924 Ga0496121_0000034 Ga0496121_0000034_15490_16224 242
781 3300048925 Ga0496122_0077336 Ga0496122_0077336_1153_1887 242
782 3300048925 Ga0496122_0229247 Ga0496122_0229247_282_1016 242
783 3300048925 Ga0496122_0330470 Ga0496122_0330470_37_771 242
784 3300048926 Ga0496123_0020739 Ga0496123_0020739_1450_2184 242
785 3300048926 Ga0496123_0088457 Ga0496123_0088457_811_1545 242
786 3300048926 Ga0496123_0171357 Ga0496123_0171357_35_769 242
787 3300048927 Ga0496124_0048971 Ga0496124_0048971_292_1026 242
788 3300048927 Ga0496124_0329088 Ga0496124_0329088_292_1026 242
789 3300048928 Ga0496125_0000030 Ga0496125_0000030_358709_359443 242
790 3300048929 Ga0496126_0000115 Ga0496126_0000115_14552_15286 242
791 3300048929 Ga0496126_0069410 Ga0496126_0069410_1652_2386 242
792 3300048929 Ga0496126_0434930 Ga0496126_0434930_33_767 242
793 3300049568 Ga0501031_0032716 Ga0501031_0032716_2007_2750 242
794 3300049568 Ga0501031_0066231 Ga0501031_0066231_837_1571 242
795 3300049569 Ga0501032_0219494 Ga0501032_0219494_94_828 242
796 3300049570 Ga0501033_0133806 Ga0501033_0133806_967_1701 242
797 3300049571 Ga0501034_0431453 Ga0501034_0431453_94_828 242
798 3300049571 Ga0501034_0577846 Ga0501034_0577846_182_925 242
799 3300049572 Ga0501036_0216068 Ga0501036_0216068_783_1517 242
800 3300049573 Ga0501037_0012627 Ga0501037_0012627_4707_5441 242
801 3300049574 Ga0501038_0104528 Ga0501038_0104528_1526_2260 242
802 3300049576 Ga0501040_0080669 Ga0501040_0080669_939_1673 242
803 3300049578 Ga0501042_0020648 Ga0501042_0020648_3015_3749 242
804 3300049580 Ga0501046_0165886 Ga0501046_0165886_36_770 242
805 3300049581 Ga0501047_0252833 Ga0501047_0252833_94_828 242
806 3300049584 Ga0501068_0037501 Ga0501068_0037501_1314_2048 242
807 3300049586 Ga0501070_0021805 Ga0501070_0021805_3114_3854 242
808 3300049586 Ga0501070_0025476 Ga0501070_0025476_2272_3006 242
809 3300049587 Ga0501071_0067377 Ga0501071_0067377_309_1043 242
810 3300049588 Ga0501072_0041000 Ga0501072_0041000_1206_1940 242
811 3300049589 Ga0501073_0076590 Ga0501073_0076590_636_1370 242
812 3300049590 Ga0501074_0016429 Ga0501074_0016429_3805_4539 242
813 3300049776 Ga0501280_001213 Ga0501280_001213_516_1250 242
814 3300049822 Ga0501035_0222590 Ga0501035_0222590_94_828 242
815 3300049823 Ga0501044_0040258 Ga0501044_0040258_94_828 242
816 3300049823 Ga0501044_0058724 Ga0501044_0058724_2326_3069 242
817 3300049824 Ga0501045_0046413 Ga0501045_0046413_2209_2943 242
818 3300050492 nmdc:mga0yw44_398738_c1 nmdc:mga0yw44_398738_c1_42_776 242
819 3300053177 Ga0500636_0000030 Ga0500636_0000030_62206_62940 242
820 iso_pu_bacteria 2508501122 2509108805 242
821 iso_pu_bacteria 2509276019 2509377936 242
822 iso_pu_bacteria 2509276021 2509389186 242
823 iso_pu_bacteria 2509276033 2509444745 242
824 iso_pu_bacteria 2510065019 2510135470 242
825 iso_pu_bacteria 2510461076 2510896929 242
826 iso_pu_bacteria 2510917030 2511194207 242
827 iso_pu_bacteria 2512047086 2512534793 242
828 iso_pu_bacteria 2512875026 2512973393 242
829 iso_pu_bacteria 2513237084 2513572831 242
830 iso_pu_bacteria 2513237085 2513580364 242
831 iso_pu_bacteria 2513237089 2513602089 242
832 iso_pu_bacteria 2513237093 2513634865 242
833 iso_pu_bacteria 2513237103 2513711573 242
834 iso_pu_bacteria 2513237156 2513983543 242
835 iso_pu_bacteria 2513237160 2514003312 242
836 iso_pu_bacteria 2513237162 2514023133 242
837 iso_pu_bacteria 2515075009 2515114643 242
838 iso_pu_bacteria 2515154107 2515612376 242
839 iso_pu_bacteria 2515154113 2515634938 242
840 iso_pu_bacteria 2515154114 2515644498 242
841 iso_pu_bacteria 2515154116 2515660925 242
842 iso_pu_bacteria 2515154134 2515741825 242
843 iso_pu_bacteria 2516653077 2517038287 242
844 iso_pu_bacteria 2516653085 2517078563 242
845 iso_pu_bacteria 2517093000 2517097302 242
846 iso_pu_bacteria 2517287029 2517408309 242
847 iso_pu_bacteria 2517487022 2517571604 242
848 iso_pu_bacteria 2519899620 2520379826 242
849 iso_pu_bacteria 2524023207 2524450261 242
850 iso_pu_bacteria 2529292951 2530647133 242
851 iso_pu_bacteria 2558860100 2558867569 242
852 iso_pu_bacteria 2582581298 2585224157 242
853 iso_pu_bacteria 2585427526 2585529138 242
854 iso_pu_bacteria 2585427528 2585542955 242
855 iso_pu_bacteria 2585427529 2585549857 242
856 iso_pu_bacteria 2585427593 2585839276 242
857 iso_pu_bacteria 2615840624 2616297499 242
858 iso_pu_bacteria 2657244999 2657682252 242
859 iso_pu_bacteria 2718217882 2719183181 242
860 iso_pu_bacteria 2718217927 2719387900 242
861 iso_pu_bacteria 2718217997 2719667523 242
862 iso_pu_bacteria 2718218009 2719733898 242
863 iso_pu_bacteria 2718218199 2720493943 242
864 iso_pu_bacteria 2718218232 2720615406 242
865 iso_pu_bacteria 2718218233 2720622190 242
866 iso_pu_bacteria 2718218235 2720633544 242
867 iso_pu_bacteria 2718218269 2720777244 242
868 iso_pu_bacteria 2718218363 2721149293 242
869 iso_pu_bacteria 2718218365 2721160695 242
870 iso_pu_bacteria 2718218366 2721166106 242
871 iso_pu_bacteria 2718218423 2721401533 242
872 iso_pu_bacteria 2721755514 2722842276 242
873 iso_pu_bacteria 2721755556 2723028842 242
874 iso_pu_bacteria 2721755684 2723562457 242
875 iso_pu_bacteria 2721755685 2723569151 242
876 iso_pu_bacteria 2721755809 2724040347 242
877 iso_pu_bacteria 2721755810 2724046654 242
878 iso_pu_bacteria 2721755819 2724091851 242
879 iso_pu_bacteria 2721755822 2724106416 242
880 iso_pu_bacteria 2721755823 2724112221 242
881 iso_pu_bacteria 2724679232 2725945832 242
882 iso_pu_bacteria 2728369352 2730109778 242
883 iso_pu_bacteria 2728369365 2730166416 242
884 iso_pu_bacteria 2728369397 2730300327 242
885 iso_pu_bacteria 2738541293 2738800974 242
886 iso_pu_bacteria 2738541333 2739037650 242
887 iso_pu_bacteria 2765235942 2766064033 242
888 iso_pu_bacteria 2791355082 2792582396 242
889 iso_pu_bacteria 2791355256 2793295412 242
890 iso_pu_bacteria 2791355259 2793317911 242
891 iso_pu_bacteria 2791355260 2793324614 242
892 iso_pu_bacteria 2791355261 2793329657 242
893 iso_pu_bacteria 2791355262 2793332453 242
894 iso_pu_bacteria 2791355263 2793339047 242
895 iso_pu_bacteria 2791355264 2793346817 242
896 iso_pu_bacteria 2791355265 2793356832 242
897 iso_pu_bacteria 2791355266 2793359155 242
898 iso_pu_bacteria 2791355267 2793366120 242
899 iso_pu_bacteria 2802428858 2802717031 242
900 iso_pu_bacteria 2802428859 2802724981 242
901 iso_pu_bacteria 2802428860 2802729731 242
902 iso_pu_bacteria 2802428861 2802737077 242
903 iso_pu_bacteria 2802428862 2802743482 242
904 iso_pu_bacteria 2802428863 2802749392 242
905 iso_pu_bacteria 2802429268 2804753853 242
906 iso_pu_bacteria 2802429605 2805930959 242
907 iso_pu_bacteria 2802429606 2805936808 242
908 iso_pu_bacteria 2802429633 2806047805 242
909 iso_pu_bacteria 2802429634 2806055381 242
910 iso_pu_bacteria 2802429635 2806062262 242
911 iso_pu_bacteria 2802429636 2806069979 242
912 iso_pu_bacteria 2802429637 2806076721 242
913 iso_pu_bacteria 2838016132 2838018105 242
914 iso_pu_bacteria 2838022645 2838023785 242
915 iso_pu_bacteria 2838042994 2838046808 242
916 iso_pu_bacteria 2838048938 2838051036 242
917 iso_pu_bacteria 2838061910 2838062802 242
918 iso_pu_bacteria 2838068647 2838072347 242
919 iso_pu_bacteria 2838668709 2838674282 242
920 iso_pu_bacteria 2838680041 2838683657 242
921 iso_pu_bacteria 2838686498 2838693396 242
922 iso_pu_bacteria 2838694306 2838698185 242
923 iso_pu_bacteria 2838701080 2838706685 242
924 iso_pu_bacteria 2838707686 2838711300 242
925 iso_pu_bacteria 2838729681 2838735390 242
926 iso_pu_bacteria 2838742623 2838748061 242
927 iso_pu_bacteria 2841851746 2841857462 242
928 iso_pu_bacteria 2841864319 2841867535 242
929 iso_pu_bacteria 2842077413 2842081101 242
930 iso_pu_bacteria 2842110456 2842116647 242
931 iso_pu_bacteria 2842118031 2842122122 242
932 iso_pu_bacteria 2842146304 2842149014 242
933 iso_pu_bacteria 2842156927 2842162363 242
934 iso_pu_bacteria 2842163707 2842166936 242
935 iso_pu_bacteria 2842180545 2842186003 242
936 iso_pu_bacteria 2842192696 2842194666 242
937 iso_pu_bacteria 2842198810 2842201140 242
938 iso_pu_bacteria 2842205361 2842207634 242
939 iso_pu_bacteria 2842217011 2842222008 242
940 iso_pu_bacteria 2842229732 2842235462 242
941 iso_pu_bacteria 2842237096 2842241136 242
942 iso_pu_bacteria 2842243621 2842249255 242
943 iso_pu_bacteria 2842250916 2842256476 242
944 iso_pu_bacteria 2842257432 2842263210 242
945 iso_pu_bacteria 2842264693 2842270423 242
946 iso_pu_bacteria 2842271015 2842277864 242
947 iso_pu_bacteria 2842278818 2842280655 242
948 iso_pu_bacteria 2842285085 2842290399 242
949 iso_pu_bacteria 2842291075 2842294758 242
950 iso_pu_bacteria 2842304105 2842305593 242
951 iso_pu_bacteria 2842311132 2842311639 242
952 iso_pu_bacteria 2842317721 2842323701 242
953 iso_pu_bacteria 2842341865 2842346920 242
954 iso_pu_bacteria 2842363717 2842366049 242
955 iso_pu_bacteria 2842370503 2842375224 242
956 iso_pu_bacteria 2842377471 2842381156 242
957 iso_pu_bacteria 2842384541 2842388227 242
958 iso_pu_bacteria 2842395702 2842395717 242
959 iso_pu_bacteria 2842402390 2842408233 242
960 iso_pu_bacteria 2842409023 2842414995 242
961 iso_pu_bacteria 2842415677 2842421496 242
962 iso_pu_bacteria 2842422224 2842425979 242
963 iso_pu_bacteria 2842428310 2842434244 242
964 iso_pu_bacteria 2842434925 2842440577 242
965 iso_pu_bacteria 2842441272 2842447229 242
966 iso_pu_bacteria 2842447887 2842448523 242
967 iso_pu_bacteria 2842462802 2842468663 242
968 iso_pu_bacteria 2842469257 2842475182 242
969 iso_pu_bacteria 2842489311 2842491392 242
970 iso_pu_bacteria 2842495871 2842501873 242
971 iso_pu_bacteria 2844454524 2844456755 242
972 iso_pu_bacteria 2850079185 2850082808 242
973 iso_pu_bacteria 2857516855 2857519813 242
974 iso_pu_bacteria 2913295892 2913300343 242
975 iso_pu_bacteria 2915980308 2915981656 242
976 iso_pu_bacteria 2916061851 2916066427 242
977 iso_pu_bacteria 2919100787 2919107993 242
978 iso_pu_bacteria 2921250672 2921252744 242
979 iso_pu_bacteria 2933570622 2933572100 242
980 iso_pu_bacteria 2933586486 2933592747 242
981 iso_pu_bacteria 2933599457 2933602801 242
982 iso_pu_bacteria 2935894831 2935898161 242
983 iso_pu_bacteria 2935901341 2935903397 242
984 iso_pu_bacteria 2936367885 2936370129 242
985 iso_pu_bacteria 2936375103 2936379305 242
986 iso_pu_bacteria 2936381700 2936381717 242
987 iso_pu_bacteria 2936996657 2936997492 242
988 iso_pu_bacteria 2937029754 2937031668 242
989 iso_pu_bacteria 2937036028 2937041398 242
990 iso_pu_bacteria 2937078374 2937081547 242
991 iso_pu_bacteria 2937084907 2937090821 242
992 iso_pu_bacteria 2957375807 2957376735 242
993 iso_pu_bacteria 2957437181 2957441728 242
994 iso_pu_bacteria 2960591022 2960592857 242
995 iso_pu_bacteria 2960631154 2960635534 242
996 iso_pu_bacteria 2960680706 2960681782 242
997 iso_pu_bacteria 2960693952 2960700708 242
998 iso_pu_bacteria 2967686174 2967692370 242
999 iso_pu_bacteria 2967728569 2967732218 242
1000 iso_pu_bacteria 2970026789 2970028621 242
1001 iso_pu_bacteria 2970122695 2970127920 242
1002 iso_pu_bacteria 2970143518 2970147392 242
1003 iso_pu_bacteria 2977530762 2977531257 242
1004 iso_pu_bacteria 2977544691 2977547435 242
1005 iso_pu_bacteria 2996893221 2996896159 242
1006 iso_pu_bacteria 3005445848 3005449894 242
1007 iso_pu_bacteria 639633055 639645901 242
1008 iso_pu_bacteria 8003999396 8004003271 242
1009 iso_pu_bacteria 8005275841 8005278100 242
1010 iso_pu_bacteria 8005282627 8005286438 242
1011 iso_pu_bacteria 8005289223 8005292036 242
1012 iso_pu_bacteria 8005301065 8005306174 242
1013 iso_pu_bacteria 8005307578 8005309749 242
1014 iso_pu_bacteria 8005376324 8005381341 242
1015 iso_pu_bacteria 8005382845 8005387552 242
1016 iso_pu_bacteria 8005395548 8005398387 242
1017 iso_pu_bacteria 8005430974 8005432012 242
1018 iso_pu_bacteria 8005460587 8005465338 242
1019 iso_pu_bacteria 8005497431 8005497915 242
1020 iso_pu_bacteria 8005556819 8005561402 242
1021 iso_pu_bacteria 8005563573 8005566024 242
1022 iso_pu_bacteria 8005570704 8005572074 242
1023 iso_pu_bacteria 8005619151 8005623649 242
1024 iso_pu_bacteria 8005626139 8005630790 242
1025 iso_pu_bacteria 8005668836 8005669322 242
1026 iso_pu_bacteria 8005688590 8005694129 242
1027 iso_pu_bacteria 8005695170 8005695774 242
1028 iso_pu_bacteria 8018127388 8018128620 242
1029 iso_pu_bacteria 8018163183 8018164860 242
1030 iso_pu_bacteria 8018176218 8018177698 242
1031 iso_pu_bacteria 8023680758 8023686780 242
1032 iso_pu_bacteria 8024479707 8024484600 242
1033 iso_pu_bacteria 8024501048 8024504072 242
1034 iso_pu_bacteria 8049293176 8049296453 242
1035 iso_pu_bacteria 8056375014 8056380633 242
1036 iso_pu_bacteria 8056382006 8056383308 242
1037 iso_pu_bacteria 8057874678 8057880524 242
1038 3300002987 JGI25159J45721_1000022 JGI25159J45721_100002283 243
1039 3300003187 JGI25151J46595_10011026 JGI25151J46595_100110264 243
1040 3300003354 JGI25160J50197_1000056 JGI25160J50197_100005618 243
1041 3300003374 JGI25161J50226_1000192 JGI25161J50226_100019219 243
1042 3300003771 Ga0055526_1003086 Ga0055526_10030866 243
1043 3300003775 Ga0055524_1003145 Ga0055524_10031459 243
1044 3300003781 Ga0055536_1036349 Ga0055536_10363492 243
1045 3300003791 Ga0055530_10047995 Ga0055530_100479952 243
1046 3300003794 Ga0055531_10027636 Ga0055531_100276363 243
1047 3300004625 Ga0055543_1000180 Ga0055543_100018018 243
1048 3300005262 Ga0065165_1000155 Ga0065165_100015519 243
1049 3300013249 Ga0171463_1004 Ga0171463_1004375 243
1050 3300015690 Ga0183363_1113 Ga0183363_111312 243
1051 3300025208 Ga0209436_101962 Ga0209436_1019629 243
1052 3300025230 Ga0209563_101894 Ga0209563_1018947 243
1053 3300025284 Ga0209130_1000133 Ga0209130_100013318 243
1054 3300025292 Ga0209676_1005439 Ga0209676_10054392 243
1055 3300025294 Ga0209025_1000914 Ga0209025_100091420 243
1056 3300025295 Ga0209564_1000738 Ga0209564_100073819 243
1057 3300025298 Ga0209050_1006819 Ga0209050_10068197 243
1058 3300025299 Ga0209256_1002893 Ga0209256_10028934 243
1059 3300025299 Ga0209256_1004937 Ga0209256_10049379 243
1060 3300025302 Ga0207426_1000248 Ga0207426_100024818 243
1061 3300025304 Ga0209257_1006301 Ga0209257_10063017 243
1062 3300037471 Ga0395905_0836368 Ga0395905_0836368_10_753 243
1063 3300049570 Ga0501033_0000281 Ga0501033_0000281_10437_11174 243
1064 3300049822 Ga0501035_0000607 Ga0501035_0000607_18665_19402 243
1065 iso_pu_bacteria 2510917022 2511135794 243
1066 iso_pu_bacteria 2510917028 2511185176 243
1067 iso_pu_bacteria 2513237088 2513600145 243
1068 iso_pu_bacteria 2513237138 2513865078 243
1069 iso_pu_bacteria 2513237144 2513914305 243
1070 iso_pu_bacteria 2513237146 2513929543 243
1071 iso_pu_bacteria 2524023209 2524461238 243
1072 iso_pu_bacteria 2534681796 2535519262 243
1073 iso_pu_bacteria 2582581294 2585201501 243
1074 iso_pu_bacteria 2582581299 2585231822 243
1075 iso_pu_bacteria 2582581304 2585257124 243
1076 iso_pu_bacteria 2582581307 2585272116 243
1077 iso_pu_bacteria 2582581308 2585279577 243
1078 iso_pu_bacteria 2582581315 2585327415 243
1079 iso_pu_bacteria 2582581316 2585334046 243
1080 iso_pu_bacteria 2582581867 2585399990 243
1081 iso_pu_bacteria 2585427527 2585535656 243
1082 iso_pu_bacteria 2585427530 2585551034 243
1083 iso_pu_bacteria 2585427531 2585563339 243
1084 iso_pu_bacteria 2585427590 2585821079 243
1085 iso_pu_bacteria 2585427594 2585845110 243
1086 iso_pu_bacteria 2585427608 2585897239 243
1087 iso_pu_bacteria 2585427609 2585909154 243
1088 iso_pu_bacteria 2585428125 2587984568 243
1089 iso_pu_bacteria 2599185170 2599419915 243
1090 iso_pu_bacteria 2615840626 2616306364 243
1091 iso_pu_bacteria 2615840698 2616551149 243
1092 iso_pu_bacteria 2617270742 2617382380 243
1093 iso_pu_bacteria 2643221550 2643773382 243
1094 iso_pu_bacteria 2643221564 2643839486 243
1095 iso_pu_bacteria 2643221599 2644002693 243
1096 iso_pu_bacteria 2643221634 2644194601 243
1097 iso_pu_bacteria 2643221643 2644240266 243
1098 iso_pu_bacteria 2643221674 2644412253 243
1099 iso_pu_bacteria 2667528174 2671115972 243
1100 iso_pu_bacteria 2671180139 2671693541 243
1101 iso_pu_bacteria 2751185800 2753360516 243
1102 iso_pu_bacteria 2775507266 2778179273 243
1103 iso_pu_bacteria 2818991448 2819612025 243
1104 iso_pu_bacteria 2818991453 2819638432 243
1105 iso_pu_bacteria 2838029111 2838034175 243
1106 iso_pu_bacteria 2838035591 2838041965 243
1107 iso_pu_bacteria 2838661181 2838668187 243
1108 iso_pu_bacteria 2842298080 2842302682 243
1109 iso_pu_bacteria 2842357229 2842358816 243
1110 iso_pu_bacteria 2842475841 2842480857 243
1111 iso_pu_bacteria 2842482326 2842485338 243
1112 iso_pu_bacteria 2842502639 2842507532 243
1113 iso_pu_bacteria 2842509118 2842514635 243
1114 iso_pu_bacteria 2852387548 2852387595 243
1115 iso_pu_bacteria 2899803654 2899805055 243
1116 iso_pu_bacteria 2915650412 2915650615 243
1117 iso_pu_bacteria 2919408235 2919411509 243
1118 iso_pu_bacteria 2923556063 2923559919 243
1119 iso_pu_bacteria 2933016740 2933016795 243
1120 iso_pu_bacteria 2996887358 2996890508 243
1121 iso_pu_bacteria 3005416602 3005416833 243
1122 iso_pu_bacteria 3005452660 3005456185 243
1123 iso_pu_bacteria 8005258706 8005262695 243
1124 iso_pu_bacteria 8005314921 8005315963 243
1125 iso_pu_bacteria 8005321885 8005325035 243
1126 iso_pu_bacteria 8005484373 8005487053 243
1127 iso_pu_bacteria 8005542996 8005546918 243
1128 iso_pu_bacteria 8005645114 8005645245 243
1129 iso_pu_bacteria 8005682033 8005687308 243
1130 iso_pu_bacteria 8024486573 8024491062 243
1131 iso_pu_bacteria 8046767195 8046768319 243
1132 iso_pu_bacteria 8057575449 8057582012 243
1133 3300001979 JGI24740J21852_10038669 JGI24740J21852_100386692 244
1134 3300001979 JGI24740J21852_10062525 JGI24740J21852_100625252 244
1135 3300001989 JGI24739J22299_10024983 JGI24739J22299_100249833 244
1136 3300001989 JGI24739J22299_10060935 JGI24739J22299_100609352 244
1137 3300002067 JGI24735J21928_10022063 JGI24735J21928_100220633 244
1138 3300002705 JGI25156J39149_1003248 JGI25156J39149_10032483 244
1139 3300002741 JGI25157J39369_1001109 JGI25157J39369_100110912 244
1140 3300003214 JGI25165J46597_1000078 JGI25165J46597_1000078146 244
1141 3300003762 Ga0055542_1001659 Ga0055542_10016594 244
1142 3300005327 Ga0070658_10036715 Ga0070658_100367152 244
1143 3300005339 Ga0070660_100108479 Ga0070660_1001084793 244
1144 3300005459 Ga0068867_100464038 Ga0068867_1004640381 244
1145 3300005539 Ga0068853_100013757 Ga0068853_1000137573 244
1146 3300005548 Ga0070665_100060919 Ga0070665_1000609193 244
1147 3300005577 Ga0068857_100335529 Ga0068857_1003355293 244
1148 3300005614 Ga0068856_100183254 Ga0068856_1001832542 244
1149 3300005937 Ga0081455_10123737 Ga0081455_101237373 244
1150 3300006038 Ga0075365_10042272 Ga0075365_100422725 244
1151 3300006038 Ga0075365_10043478 Ga0075365_100434783 244
1152 3300006038 Ga0075365_10049634 Ga0075365_100496343 244
1153 3300006038 Ga0075365_10052274 Ga0075365_100522743 244
1154 3300006042 Ga0075368_10137886 Ga0075368_101378862 244
1155 3300006048 Ga0075363_100007089 Ga0075363_1000070892 244
1156 3300006048 Ga0075363_100041815 Ga0075363_1000418154 244
1157 3300006051 Ga0075364_10086681 Ga0075364_100866812 244
1158 3300006177 Ga0075362_10014363 Ga0075362_100143636 244
1159 3300006178 Ga0075367_10073208 Ga0075367_100732083 244
1160 3300006186 Ga0075369_10041825 Ga0075369_100418252 244
1161 3300006186 Ga0075369_10065239 Ga0075369_100652393 244
1162 3300006195 Ga0075366_10190134 Ga0075366_101901342 244
1163 3300009093 Ga0105240_10142647 Ga0105240_101426474 244
1164 3300009093 Ga0105240_10164299 Ga0105240_101642993 244
1165 3300009093 Ga0105240_10265159 Ga0105240_102651592 244
1166 3300009174 Ga0105241_10052607 Ga0105241_100526072 244
1167 3300009545 Ga0105237_10059716 Ga0105237_100597162 244
1168 3300009545 Ga0105237_10150709 Ga0105237_101507093 244
1169 3300009545 Ga0105237_10292551 Ga0105237_102925511 244
1170 3300009551 Ga0105238_10013898 Ga0105238_100138986 244
1171 3300009551 Ga0105238_10261933 Ga0105238_102619332 244
1172 3300010375 Ga0105239_10091672 Ga0105239_100916723 244
1173 3300010375 Ga0105239_10180103 Ga0105239_101801033 244
1174 3300014325 Ga0163163_10616890 Ga0163163_106168902 244
1175 3300025246 Ga0209646_1010873 Ga0209646_10108732 244
1176 3300025250 Ga0209026_1000151 Ga0209026_100015195 244
1177 3300025254 Ga0209148_1000032 Ga0209148_1000032473 244
1178 3300025256 Ga0209759_1000076 Ga0209759_100007625 244
1179 3300025261 Ga0209233_1000150 Ga0209233_100015035 244
1180 3300025272 Ga0209455_1000085 Ga0209455_1000085199 244
1181 3300025297 Ga0209758_1018922 Ga0209758_10189224 244
1182 3300025904 Ga0207647_10018216 Ga0207647_100182165 244
1183 3300025904 Ga0207647_10136981 Ga0207647_101369812 244
1184 3300025913 Ga0207695_10083691 Ga0207695_100836913 244
1185 3300025913 Ga0207695_10314958 Ga0207695_103149582 244
1186 3300025913 Ga0207695_10391282 Ga0207695_103912822 244
1187 3300025914 Ga0207671_10049593 Ga0207671_100495934 244
1188 3300025919 Ga0207657_10073077 Ga0207657_100730772 244
1189 3300025924 Ga0207694_10023324 Ga0207694_100233243 244
1190 3300025924 Ga0207694_10191584 Ga0207694_101915842 244
1191 3300025961 Ga0207712_10666634 Ga0207712_106666341 244
1192 3300026041 Ga0207639_10236414 Ga0207639_102364142 244
1193 3300026089 Ga0207648_10182303 Ga0207648_101823032 244
1194 3300026116 Ga0207674_10301753 Ga0207674_103017532 244
1195 3300028379 Ga0268266_10110288 Ga0268266_101102883 244
1196 3300028379 Ga0268266_10143967 Ga0268266_101439672 244
1197 3300035692 Ga0373935_0379905 Ga0373935_0379905_155_895 244
1198 3300035695 Ga0373927_0000068 Ga0373927_0000068_59868_60608 244
1199 3300037068 Ga0373925_0001851 Ga0373925_0001851_13480_14220 244
1200 3300037312 Ga0395899_0447721 Ga0395899_0447721_26_772 244
1201 3300037418 Ga0395900_0061014 Ga0395900_0061014_2943_3689 244
1202 3300037471 Ga0395905_0040527 Ga0395905_0040527_1085_1831 244
1203 3300037471 Ga0395905_0104032 Ga0395905_0104032_1578_2324 244
1204 3300037471 Ga0395905_0110361 Ga0395905_0110361_1795_2541 244
1205 3300038443 Ga0395901_0013412 Ga0395901_0013412_3337_4083 244
1206 3300044658 Ga0466972_0021064 Ga0466972_0021064_662_1408 244
1207 3300044658 Ga0466972_0027854 Ga0466972_0027854_1738_2484 244
1208 3300044901 Ga0466960_0021901 Ga0466960_0021901_1133_1879 244
1209 3300046515 Ga0495620_0047666 Ga0495620_0047666_303_1049 244
1210 3300046660 Ga0495625_0014886 Ga0495625_0014886_1337_2083 244
1211 3300048091 Ga0495626_0098278 Ga0495626_0098278_219_965 244
1212 3300048915 Ga0496112_0107439 Ga0496112_0107439_1709_2455 244
1213 3300048920 Ga0496117_0272989 Ga0496117_0272989_121_867 244
1214 3300048921 Ga0496118_0107472 Ga0496118_0107472_602_1351 244
1215 3300048922 Ga0496119_0047632 Ga0496119_0047632_1214_1960 244
1216 3300048922 Ga0496119_0136602 Ga0496119_0136602_30_779 244
1217 3300048923 Ga0496120_0002559 Ga0496120_0002559_3242_3988 244
1218 3300048924 Ga0496121_0102487 Ga0496121_0102487_372_1121 244
1219 3300048929 Ga0496126_0066960 Ga0496126_0066960_1841_2587 244
1220 3300049569 Ga0501032_0227460 Ga0501032_0227460_438_1172 244
1221 3300049570 Ga0501033_0007579 Ga0501033_0007579_2601_3347 244
1222 3300049571 Ga0501034_0373264 Ga0501034_0373264_309_1043 244
1223 3300049573 Ga0501037_0020694 Ga0501037_0020694_3638_4372 244
1224 3300049574 Ga0501038_0045603 Ga0501038_0045603_2658_3392 244
1225 3300049574 Ga0501038_0137595 Ga0501038_0137595_992_1738 244
1226 3300049579 Ga0501043_0189009 Ga0501043_0189009_784_1530 244
1227 3300049822 Ga0501035_0041727 Ga0501035_0041727_2438_3184 244
1228 3300049823 Ga0501044_0016850 Ga0501044_0016850_4283_5029 244
1229 3300049823 Ga0501044_0281841 Ga0501044_0281841_617_1351 244
1230 3300050490 nmdc:mga03n38_14125_c1 nmdc:mga03n38_14125_c1_1531_2280 244
1231 3300050492 nmdc:mga0yw44_43274_c1 nmdc:mga0yw44_43274_c1_1330_2079 244
1232 3300050492 nmdc:mga0yw44_76912_c1 nmdc:mga0yw44_76912_c1_1057_1803 244
1233 3300050494 nmdc:mga06z11_26345_c1 nmdc:mga06z11_26345_c1_1178_1924 244
1234 3300050494 nmdc:mga06z11_29277_c1 nmdc:mga06z11_29277_c1_369_1115 244
1235 3300050494 nmdc:mga06z11_64483_c1 nmdc:mga06z11_64483_c1_978_1727 244
1236 3300050496 nmdc:mga07m45_79519_c1 nmdc:mga07m45_79519_c1_746_1495 244
1237 3300053079 Ga0500610_0003559 Ga0500610_0003559_1930_2676 244
1238 3300053153 Ga0500616_0085803 Ga0500616_0085803_304_1053 244
1239 3300053727 Ga0500611_028047 Ga0500611_028047_343_1089 244
1240 iso_pu_bacteria 3005409236 3005416009 244
1241 3300003187 JGI25151J46595_10019122 JGI25151J46595_100191223 245
1242 3300003215 JGI25153J46596_10011306 JGI25153J46596_100113061 245
1243 3300003792 Ga0055540_1004541 Ga0055540_10045414 245
1244 3300003794 Ga0055531_10001474 Ga0055531_100014749 245
1245 3300005289 Ga0065704_10241189 Ga0065704_102411892 245
1246 3300005353 Ga0070669_100018736 Ga0070669_1000187364 245
1247 3300005548 Ga0070665_100010257 Ga0070665_1000102579 245
1248 3300005548 Ga0070665_100453414 Ga0070665_1004534142 245
1249 3300005548 Ga0070665_100699333 Ga0070665_1006993332 245
1250 3300006038 Ga0075365_10006590 Ga0075365_100065904 245
1251 3300006038 Ga0075365_10309110 Ga0075365_103091101 245
1252 3300006042 Ga0075368_10001546 Ga0075368_100015462 245
1253 3300006051 Ga0075364_10025945 Ga0075364_100259454 245
1254 3300006186 Ga0075369_10100141 Ga0075369_101001412 245
1255 3300006946 Ga0079104_1000534 Ga0079104_100053421 245
1256 3300006948 Ga0099826_10000099 Ga0099826_100000997 245
1257 3300006948 Ga0099826_10011043 Ga0099826_100110438 245
1258 3300009553 Ga0105249_10345157 Ga0105249_103451572 245
1259 3300013100 Ga0157373_10001304 Ga0157373_1000130416 245
1260 3300013102 Ga0157371_10000071 Ga0157371_10000071138 245
1261 3300013104 Ga0157370_10000079 Ga0157370_1000007986 245
1262 3300017792 Ga0163161_10358795 Ga0163161_103587951 245
1263 3300025245 Ga0207425_1031285 Ga0207425_10312852 245
1264 3300025292 Ga0209676_1007720 Ga0209676_10077204 245
1265 3300025294 Ga0209025_1000042 Ga0209025_100004235 245
1266 3300025294 Ga0209025_1002260 Ga0209025_100226013 245
1267 3300025297 Ga0209758_1000811 Ga0209758_100081124 245
1268 3300025298 Ga0209050_1002378 Ga0209050_100237815 245
1269 3300025303 Ga0209051_1003191 Ga0209051_100319110 245
1270 3300025935 Ga0207709_10075638 Ga0207709_100756382 245
1271 3300025986 Ga0207658_10807822 Ga0207658_108078221 245
1272 3300027111 Ga0209281_1000610 Ga0209281_100061014 245
1273 3300027111 Ga0209281_1000893 Ga0209281_100089320 245
1274 3300027312 Ga0209371_1000037 Ga0209371_1000037315 245
1275 3300027312 Ga0209371_1005245 Ga0209371_10052453 245
1276 3300027666 Ga0209282_1014246 Ga0209282_10142463 245
1277 3300027666 Ga0209282_1043440 Ga0209282_10434404 245
1278 3300028379 Ga0268266_10013752 Ga0268266_100137527 245
1279 3300028379 Ga0268266_10537775 Ga0268266_105377752 245
1280 3300028794 Ga0307515_10001115 Ga0307515_1000111518 245
1281 3300028794 Ga0307515_10001473 Ga0307515_1000147326 245
1282 3300028794 Ga0307515_10273428 Ga0307515_102734282 245
1283 3300030500 Ga0268256_1000832 Ga0268256_100083213 245
1284 3300030500 Ga0268256_1014584 Ga0268256_10145843 245
1285 3300031456 Ga0307513_10000926 Ga0307513_1000092623 245
1286 3300031548 Ga0307408_100049137 Ga0307408_1000491372 245
1287 3300031548 Ga0307408_100665589 Ga0307408_1006655892 245
1288 3300031824 Ga0307413_10280098 Ga0307413_102800982 245
1289 3300031824 Ga0307413_10398460 Ga0307413_103984601 245
1290 3300041413 Ga0439465_0001905 Ga0439465_0001905_3790_4533 245
1291 3300042015 Ga0439462_0002202 Ga0439462_0002202_2806_3549 245
1292 3300042122 Ga0450920_004809 Ga0450920_004809_438_1181 245
1293 3300042156 Ga0439446_0041797 Ga0439446_0041797_108_851 245
1294 3300042531 Ga0450918_002772 Ga0450918_002772_1262_2005 245
1295 3300046530 Ga0495654_0000839 Ga0495654_0000839_5114_5857 245
1296 3300046674 Ga0495588_0005928 Ga0495588_0005928_1659_2408 245
1297 3300047443 Ga0495687_033553 Ga0495687_033553_18_764 245
1298 3300047470 Ga0495681_0009775 Ga0495681_0009775_4492_5241 245
1299 3300048919 Ga0496116_0016473 Ga0496116_0016473_3411_4154 245
1300 3300048920 Ga0496117_0000031 Ga0496117_0000031_366560_367303 245
1301 3300048920 Ga0496117_0005441 Ga0496117_0005441_2073_2816 245
1302 3300048920 Ga0496117_0168096 Ga0496117_0168096_207_950 245
1303 3300048921 Ga0496118_0003703 Ga0496118_0003703_4470_5213 245
1304 3300048922 Ga0496119_0013035 Ga0496119_0013035_3242_3985 245
1305 3300048923 Ga0496120_0000387 Ga0496120_0000387_6532_7275 245
1306 3300048924 Ga0496121_0000660 Ga0496121_0000660_55783_56538 245
1307 3300048925 Ga0496122_0000023 Ga0496122_0000023_366547_367290 245
1308 3300048925 Ga0496122_0000082 Ga0496122_0000082_191418_192161 245
1309 3300048925 Ga0496122_0000308 Ga0496122_0000308_12412_13155 245
1310 3300048926 Ga0496123_0000027 Ga0496123_0000027_13746_14489 245
1311 3300048926 Ga0496123_0000066 Ga0496123_0000066_12179_12922 245
1312 3300048926 Ga0496123_0000067 Ga0496123_0000067_16999_17742 245
1313 3300048926 Ga0496123_0020487 Ga0496123_0020487_3713_4456 245
1314 3300048927 Ga0496124_0000917 Ga0496124_0000917_1534_2277 245
1315 3300048927 Ga0496124_0035328 Ga0496124_0035328_1709_2452 245
1316 3300048927 Ga0496124_0056206 Ga0496124_0056206_2552_3295 245
1317 3300048928 Ga0496125_0001030 Ga0496125_0001030_30195_30938 245
1318 3300048928 Ga0496125_0031676 Ga0496125_0031676_2698_3441 245
1319 3300048928 Ga0496125_0081252 Ga0496125_0081252_349_1092 245
1320 3300048929 Ga0496126_0000258 Ga0496126_0000258_11374_12117 245
1321 3300048929 Ga0496126_0015454 Ga0496126_0015454_2254_2997 245
1322 3300050490 nmdc:mga03n38_6378_c1 nmdc:mga03n38_6378_c1_903_1646 245
1323 3300050491 nmdc:mga00v17_1099_c1 nmdc:mga00v17_1099_c1_372_1127 245
1324 3300050491 nmdc:mga00v17_15_c1 nmdc:mga00v17_15_c1_114630_115373 245
1325 3300050492 nmdc:mga0yw44_469367_c1 nmdc:mga0yw44_469367_c1_90_842 245
1326 3300050492 nmdc:mga0yw44_839_c1 nmdc:mga0yw44_839_c1_7664_8407 245
1327 3300050494 nmdc:mga06z11_232340_c1 nmdc:mga06z11_232340_c1_93_836 245
1328 3300050516 nmdc:mga0sz30_171917_c1 nmdc:mga0sz30_171917_c1_48_791 245
1329 3300050516 nmdc:mga0sz30_2687_c1 nmdc:mga0sz30_2687_c1_944_1687 245
1330 3300053107 Ga0500560_046258 Ga0500560_046258_587_1330 245
1331 3300053125 Ga0500618_001904 Ga0500618_001904_2899_3642 245
1332 3300053125 Ga0500618_003626 Ga0500618_003626_3516_4259 245
1333 3300053137 Ga0500561_0000187 Ga0500561_0000187_10211_10954 245
1334 3300053140 Ga0500573_0005445 Ga0500573_0005445_3124_3876 245
1335 3300053140 Ga0500573_0011023 Ga0500573_0011023_1068_1820 245
1336 3300053153 Ga0500616_0001681 Ga0500616_0001681_19507_20250 245
1337 3300053157 Ga0500624_004235 Ga0500624_004235_346_1089 245
1338 3300053161 Ga0500634_0068294 Ga0500634_0068294_184_933 245
1339 3300059424 Ga0590075_028118 Ga0590075_028118_89_832 245
1340 3300059510 Ga0587090_001953 Ga0587090_001953_901_1644 245
1341 3300059643 Ga0587072_000441 Ga0587072_000441_1774_2517 245
1342 3300002739 JGI25158J39367_1000055 JGI25158J39367_10000559 246
1343 3300002773 JGI25152J39213_1000648 JGI25152J39213_100064812 246
1344 3300002773 JGI25152J39213_1014405 JGI25152J39213_10144052 246
1345 3300002773 JGI25152J39213_1014413 JGI25152J39213_10144132 246
1346 3300002774 JGI25150J39212_1004906 JGI25150J39212_10049064 246
1347 3300002774 JGI25150J39212_1008805 JGI25150J39212_10088051 246
1348 3300002987 JGI25159J45721_1002837 JGI25159J45721_10028378 246
1349 3300003187 JGI25151J46595_10000554 JGI25151J46595_1000055419 246
1350 3300003215 JGI25153J46596_10024895 JGI25153J46596_100248954 246
1351 3300003215 JGI25153J46596_10027599 JGI25153J46596_100275991 246
1352 3300003215 JGI25153J46596_10030991 JGI25153J46596_100309912 246
1353 3300003215 JGI25153J46596_10030993 JGI25153J46596_100309932 246
1354 3300003354 JGI25160J50197_1000329 JGI25160J50197_100032918 246
1355 3300003354 JGI25160J50197_1014944 JGI25160J50197_10149444 246
1356 3300003374 JGI25161J50226_1000328 JGI25161J50226_10003289 246
1357 3300003374 JGI25161J50226_1004069 JGI25161J50226_10040693 246
1358 3300003771 Ga0055526_1011560 Ga0055526_10115602 246
1359 3300003771 Ga0055526_1023503 Ga0055526_10235032 246
1360 3300003771 Ga0055526_1023826 Ga0055526_10238261 246
1361 3300003775 Ga0055524_1005310 Ga0055524_10053103 246
1362 3300003775 Ga0055524_1018007 Ga0055524_10180072 246
1363 3300003775 Ga0055524_1023743 Ga0055524_10237433 246
1364 3300003790 Ga0055528_1006719 Ga0055528_10067197 246
1365 3300003790 Ga0055528_1013061 Ga0055528_10130614 246
1366 3300003790 Ga0055528_1022347 Ga0055528_10223471 246
1367 3300003790 Ga0055528_1050015 Ga0055528_10500151 246
1368 3300003792 Ga0055540_1000886 Ga0055540_100088611 246
1369 3300003792 Ga0055540_1003139 Ga0055540_10031399 246
1370 3300003792 Ga0055540_1011350 Ga0055540_10113505 246
1371 3300004625 Ga0055543_1000205 Ga0055543_100020527 246
1372 3300004625 Ga0055543_1000322 Ga0055543_100032224 246
1373 3300005262 Ga0065165_1008578 Ga0065165_10085784 246
1374 3300005262 Ga0065165_1009018 Ga0065165_10090187 246
1375 3300005353 Ga0070669_100079363 Ga0070669_1000793634 246
1376 3300005546 Ga0070696_100292561 Ga0070696_1002925612 246
1377 3300005548 Ga0070665_100091369 Ga0070665_1000913694 246
1378 3300006038 Ga0075365_10012733 Ga0075365_100127335 246
1379 3300006048 Ga0075363_100228598 Ga0075363_1002285982 246
1380 3300006048 Ga0075363_100234736 Ga0075363_1002347362 246
1381 3300006048 Ga0075363_100417597 Ga0075363_1004175971 246
1382 3300006178 Ga0075367_10002288 Ga0075367_100022885 246
1383 3300006178 Ga0075367_10188953 Ga0075367_101889532 246
1384 3300006186 Ga0075369_10040815 Ga0075369_100408153 246
1385 3300006195 Ga0075366_10004165 Ga0075366_100041657 246
1386 3300006353 Ga0075370_10013312 Ga0075370_100133127 246
1387 3300009765 Ga0123341_1001285 Ga0123341_100128510 246
1388 3300014326 Ga0157380_10117978 Ga0157380_101179784 246
1389 3300021320 Ga0214544_1000079 Ga0214544_100007913 246
1390 3300021321 Ga0214542_1000064 Ga0214542_100006418 246
1391 3300021321 Ga0214542_1016102 Ga0214542_10161029 246
1392 3300021327 Ga0214543_1000015 Ga0214543_1000015246 246
1393 3300021327 Ga0214543_1000063 Ga0214543_100006394 246
1394 3300022739 Ga0228711_1000030 Ga0228711_100003064 246
1395 3300022740 Ga0228710_1000002 Ga0228710_1000002238 246
1396 3300025208 Ga0209436_100013 Ga0209436_100013104 246
1397 3300025245 Ga0207425_1001786 Ga0207425_10017867 246
1398 3300025258 Ga0209129_1000409 Ga0209129_100040917 246
1399 3300025258 Ga0209129_1005837 Ga0209129_10058376 246
1400 3300025258 Ga0209129_1005977 Ga0209129_10059772 246
1401 3300025258 Ga0209129_1006612 Ga0209129_10066125 246
1402 3300025258 Ga0209129_1006873 Ga0209129_10068734 246
1403 3300025273 Ga0209673_1000050 Ga0209673_1000050244 246
1404 3300025273 Ga0209673_1000370 Ga0209673_100037060 246
1405 3300025273 Ga0209673_1002748 Ga0209673_10027488 246
1406 3300025273 Ga0209673_1010254 Ga0209673_10102544 246
1407 3300025284 Ga0209130_1000009 Ga0209130_100000919 246
1408 3300025292 Ga0209676_1033688 Ga0209676_10336882 246
1409 3300025294 Ga0209025_1001178 Ga0209025_100117819 246
1410 3300025294 Ga0209025_1008765 Ga0209025_10087658 246
1411 3300025294 Ga0209025_1053342 Ga0209025_10533422 246
1412 3300025295 Ga0209564_1000227 Ga0209564_1000227110 246
1413 3300025295 Ga0209564_1000700 Ga0209564_10007007 246
1414 3300025297 Ga0209758_1001061 Ga0209758_100106117 246
1415 3300025297 Ga0209758_1001207 Ga0209758_100120715 246
1416 3300025297 Ga0209758_1001208 Ga0209758_100120815 246
1417 3300025297 Ga0209758_1001810 Ga0209758_100181017 246
1418 3300025298 Ga0209050_1007445 Ga0209050_10074454 246
1419 3300025299 Ga0209256_1000459 Ga0209256_100045917 246
1420 3300025299 Ga0209256_1000737 Ga0209256_100073740 246
1421 3300025299 Ga0209256_1004467 Ga0209256_100446710 246
1422 3300025299 Ga0209256_1011551 Ga0209256_10115513 246
1423 3300025302 Ga0207426_1000214 Ga0207426_100021418 246
1424 3300025302 Ga0207426_1000450 Ga0207426_100045045 246
1425 3300025303 Ga0209051_1001765 Ga0209051_100176512 246
1426 3300025303 Ga0209051_1002754 Ga0209051_10027543 246
1427 3300025303 Ga0209051_1009264 Ga0209051_10092646 246
1428 3300025304 Ga0209257_1006186 Ga0209257_10061864 246
1429 3300025304 Ga0209257_1041666 Ga0209257_10416662 246
1430 3300025923 Ga0207681_10034296 Ga0207681_100342965 246
1431 3300025972 Ga0207668_10066406 Ga0207668_100664065 246
1432 3300027111 Ga0209281_1000030 Ga0209281_100003020 246
1433 3300027666 Ga0209282_1000004 Ga0209282_100000420 246
1434 3300028379 Ga0268266_10307850 Ga0268266_103078502 246
1435 3300028379 Ga0268266_10626506 Ga0268266_106265062 246
1436 3300028794 Ga0307515_10037447 Ga0307515_100374478 246
1437 3300031456 Ga0307513_10014966 Ga0307513_100149664 246
1438 3300031727 Ga0316576_10423888 Ga0316576_104238881 246
1439 3300031728 Ga0316578_10296788 Ga0316578_102967882 246
1440 3300031901 Ga0307406_10004456 Ga0307406_100044565 246
1441 3300031967 Ga0315914_1000001 Ga0315914_1000001362 246
1442 3300032002 Ga0307416_100376244 Ga0307416_1003762442 246
1443 3300032133 Ga0316583_10019692 Ga0316583_100196922 246
1444 3300032139 Ga0316580_10040971 Ga0316580_100409712 246
1445 3300033430 Ga0315913_1000022 Ga0315913_100002264 246
1446 3300033464 Ga0315915_1000002 Ga0315915_100000221 246
1447 3300035398 Ga0316574_0216033 Ga0316574_0216033_64_822 246
1448 3300041413 Ga0439465_0015529 Ga0439465_0015529_1420_2166 246
1449 3300041441 Ga0451787_478853 Ga0451787_478853_922_1668 246
1450 3300041443 Ga0451789_1023080 Ga0451789_1023080_179_931 246
1451 3300041458 Ga0451798_0082093 Ga0451798_0082093_1882_2628 246
1452 3300041491 Ga0451833_1412313 Ga0451833_1412313_86_832 246
1453 3300041492 Ga0451835_0739892 Ga0451835_0739892_243_989 246
1454 3300041494 Ga0451837_1550804 Ga0451837_1550804_88_834 246
1455 3300041496 Ga0451839_1184936 Ga0451839_1184936_87_833 246
1456 3300041497 Ga0451840_11301 Ga0451840_11301_49_795 246
1457 3300041498 Ga0451841_0045710 Ga0451841_0045710_677_1423 246
1458 3300041498 Ga0451841_1238617 Ga0451841_1238617_33_779 246
1459 3300041502 Ga0451846_33480 Ga0451846_33480_1682_2428 246
1460 3300041503 Ga0451847_0004229 Ga0451847_0004229_871_1617 246
1461 3300041504 Ga0451848_16121 Ga0451848_16121_30_776 246
1462 3300041507 Ga0451851_0286109 Ga0451851_0286109_1520_2266 246
1463 3300041511 Ga0451855_1229833 Ga0451855_1229833_243_989 246
1464 3300041907 Ga0452268_46788 Ga0452268_46788_30_776 246
1465 3300042007 Ga0439449_0012067 Ga0439449_0012067_2109_2855 246
1466 3300046460 Ga0495638_0038669 Ga0495638_0038669_2259_3005 246
1467 3300046471 Ga0495650_0025541 Ga0495650_0025541_742_1488 246
1468 3300046474 Ga0495605_0024669 Ga0495605_0024669_2292_3038 246
1469 3300046492 Ga0495585_0191116 Ga0495585_0191116_28_774 246
1470 3300046501 Ga0495607_0007380 Ga0495607_0007380_6811_7557 246
1471 3300046512 Ga0495610_0011163 Ga0495610_0011163_3026_3772 246
1472 3300046512 Ga0495610_0049896 Ga0495610_0049896_316_1062 246
1473 3300046512 Ga0495610_0151607 Ga0495610_0151607_71_817 246
1474 3300046515 Ga0495620_0037814 Ga0495620_0037814_611_1357 246
1475 3300046518 Ga0495631_0024379 Ga0495631_0024379_999_1745 246
1476 3300046522 Ga0495643_0033152 Ga0495643_0033152_1512_2258 246
1477 3300046522 Ga0495643_0053561 Ga0495643_0053561_252_998 246
1478 3300046524 Ga0495648_0066678 Ga0495648_0066678_596_1342 246
1479 3300046530 Ga0495654_0051094 Ga0495654_0051094_583_1329 246
1480 3300046538 Ga0495609_0068433 Ga0495609_0068433_557_1303 246
1481 3300046558 Ga0495633_0020417 Ga0495633_0020417_446_1192 246
1482 3300046616 Ga0495668_0028990 Ga0495668_0028990_2338_3084 246
1483 3300046616 Ga0495668_0054955 Ga0495668_0054955_1192_1938 246
1484 3300046648 Ga0495611_0171912 Ga0495611_0171912_78_824 246
1485 3300046660 Ga0495625_0030641 Ga0495625_0030641_1484_2230 246
1486 3300046660 Ga0495625_0389670 Ga0495625_0389670_94_840 246
1487 3300046664 Ga0495659_0165960 Ga0495659_0165960_115_861 246
1488 3300046665 Ga0495661_0040697 Ga0495661_0040697_246_992 246
1489 3300046692 Ga0495671_0043186 Ga0495671_0043186_95_841 246
1490 3300046692 Ga0495671_0103682 Ga0495671_0103682_377_1123 246
1491 3300046694 Ga0495649_0096939 Ga0495649_0096939_78_824 246
1492 3300047472 Ga0495686_0006107 Ga0495686_0006107_443_1189 246
1493 3300048909 Ga0496106_0082803 Ga0496106_0082803_767_1513 246
1494 3300048919 Ga0496116_0031401 Ga0496116_0031401_1766_2512 246
1495 3300048919 Ga0496116_0074157 Ga0496116_0074157_1234_1977 246
1496 3300048920 Ga0496117_0045019 Ga0496117_0045019_396_1142 246
1497 3300048921 Ga0496118_0026334 Ga0496118_0026334_4120_4866 246
1498 3300048921 Ga0496118_0049784 Ga0496118_0049784_283_1029 246
1499 3300048924 Ga0496121_0122001 Ga0496121_0122001_173_919 246
1500 3300048924 Ga0496121_0154635 Ga0496121_0154635_104_850 246
1501 3300048925 Ga0496122_0010979 Ga0496122_0010979_8341_9087 246
1502 3300048926 Ga0496123_0030745 Ga0496123_0030745_2165_2911 246
1503 3300048927 Ga0496124_0000294 Ga0496124_0000294_78039_78785 246
1504 3300048927 Ga0496124_0015593 Ga0496124_0015593_5279_6022 246
1505 3300048928 Ga0496125_0007286 Ga0496125_0007286_894_1640 246
1506 3300049568 Ga0501031_0042827 Ga0501031_0042827_403_1158 246
1507 3300049569 Ga0501032_0001391 Ga0501032_0001391_16304_17059 246
1508 3300049570 Ga0501033_0000304 Ga0501033_0000304_20242_20997 246
1509 3300049570 Ga0501033_0219931 Ga0501033_0219931_412_1158 246
1510 3300049571 Ga0501034_0027699 Ga0501034_0027699_2732_3487 246
1511 3300049571 Ga0501034_0058388 Ga0501034_0058388_838_1590 246
1512 3300049571 Ga0501034_0235450 Ga0501034_0235450_344_1099 246
1513 3300049573 Ga0501037_0000154 Ga0501037_0000154_50833_51588 246
1514 3300049573 Ga0501037_0189625 Ga0501037_0189625_691_1437 246
1515 3300049574 Ga0501038_0182506 Ga0501038_0182506_643_1398 246
1516 3300049579 Ga0501043_0000007 Ga0501043_0000007_30916_31671 246
1517 3300049580 Ga0501046_0239072 Ga0501046_0239072_20_766 246
1518 3300049583 Ga0501067_0123421 Ga0501067_0123421_75_830 246
1519 3300049584 Ga0501068_0005949 Ga0501068_0005949_426_1181 246
1520 3300049585 Ga0501069_0000027 Ga0501069_0000027_74542_75297 246
1521 3300049586 Ga0501070_0000650 Ga0501070_0000650_21621_22376 246
1522 3300049587 Ga0501071_0004099 Ga0501071_0004099_5032_5787 246
1523 3300049589 Ga0501073_0148438 Ga0501073_0148438_584_1330 246
1524 3300049589 Ga0501073_0199602 Ga0501073_0199602_145_900 246
1525 3300049590 Ga0501074_0000066 Ga0501074_0000066_24843_25598 246
1526 3300049741 Ga0501079_0460124 Ga0501079_0460124_19_774 246
1527 3300049742 Ga0501080_0003548 Ga0501080_0003548_12797_13552 246
1528 3300049744 Ga0501083_0000012 Ga0501083_0000012_146841_147596 246
1529 3300049744 Ga0501083_0113881 Ga0501083_0113881_853_1599 246
1530 3300049822 Ga0501035_0000073 Ga0501035_0000073_58415_59170 246
1531 3300049823 Ga0501044_0000118 Ga0501044_0000118_63520_64275 246
1532 3300049823 Ga0501044_0108418 Ga0501044_0108418_252_998 246
1533 3300050490 nmdc:mga03n38_169900_c1 nmdc:mga03n38_169900_c1_298_1044 246
1534 3300050490 nmdc:mga03n38_268437_c1 nmdc:mga03n38_268437_c1_142_888 246
1535 3300050492 nmdc:mga0yw44_174991_c1 nmdc:mga0yw44_174991_c1_377_1123 246
1536 3300050493 nmdc:mga0k408_90217_c1 nmdc:mga0k408_90217_c1_542_1288 246
1537 3300050494 nmdc:mga06z11_111287_c1 nmdc:mga06z11_111287_c1_359_1105 246
1538 3300050496 nmdc:mga07m45_6295_c1 nmdc:mga07m45_6295_c1_3489_4235 246
1539 3300050516 nmdc:mga0sz30_27997_c1 nmdc:mga0sz30_27997_c1_298_1044 246
1540 3300053086 Ga0500578_0028556 Ga0500578_0028556_2003_2749 246
1541 3300053134 Ga0500658_0003333 Ga0500658_0003333_4982_5728 246
1542 3300053139 Ga0500568_0004916 Ga0500568_0004916_4225_4971 246
1543 3300053153 Ga0500616_0014879 Ga0500616_0014879_1437_2183 246
1544 3300053156 Ga0500622_0000747 Ga0500622_0000747_17204_17950 246
1545 3300053156 Ga0500622_0130585 Ga0500622_0130585_177_923 246
1546 3300053160 Ga0500633_0044096 Ga0500633_0044096_139_885 246
1547 3300060353 Ga0501082_0081439 Ga0501082_0081439_1285_2040 246
1548 3300001979 JGI24740J21852_10006155 JGI24740J21852_100061552 247
1549 3300001979 JGI24740J21852_10042192 JGI24740J21852_100421922 247
1550 3300002704 JGI25155J39150_1000018 JGI25155J39150_1000018131 247
1551 3300002705 JGI25156J39149_1000055 JGI25156J39149_100005510 247
1552 3300002737 JGI25162J39368_1000947 JGI25162J39368_100094716 247
1553 3300002737 JGI25162J39368_1003062 JGI25162J39368_10030624 247
1554 3300002738 JGI25154J39366_1000384 JGI25154J39366_10003847 247
1555 3300002741 JGI25157J39369_1000076 JGI25157J39369_100007610 247
1556 3300002773 JGI25152J39213_1000309 JGI25152J39213_100030911 247
1557 3300002773 JGI25152J39213_1001491 JGI25152J39213_10014918 247
1558 3300002773 JGI25152J39213_1002000 JGI25152J39213_10020009 247
1559 3300002774 JGI25150J39212_1000018 JGI25150J39212_100001811 247
1560 3300002987 JGI25159J45721_1001234 JGI25159J45721_10012346 247
1561 3300003187 JGI25151J46595_10000034 JGI25151J46595_10000034167 247
1562 3300003187 JGI25151J46595_10022565 JGI25151J46595_100225652 247
1563 3300003203 JGI25406J46586_10008175 JGI25406J46586_100081751 247
1564 3300003214 JGI25165J46597_1001060 JGI25165J46597_10010604 247
1565 3300003214 JGI25165J46597_1001760 JGI25165J46597_10017604 247
1566 3300003215 JGI25153J46596_10016620 JGI25153J46596_100166204 247
1567 3300003354 JGI25160J50197_1000051 JGI25160J50197_100005116 247
1568 3300003354 JGI25160J50197_1018030 JGI25160J50197_10180302 247
1569 3300003374 JGI25161J50226_1000011 JGI25161J50226_1000011178 247
1570 3300003771 Ga0055526_1016525 Ga0055526_10165252 247
1571 3300003775 Ga0055524_1002222 Ga0055524_10022225 247
1572 3300003775 Ga0055524_1009053 Ga0055524_10090532 247
1573 3300003790 Ga0055528_1000840 Ga0055528_100084013 247
1574 3300003790 Ga0055528_1005904 Ga0055528_10059046 247
1575 3300004625 Ga0055543_1000041 Ga0055543_100004189 247
1576 3300005262 Ga0065165_1000303 Ga0065165_100030358 247
1577 3300005262 Ga0065165_1017999 Ga0065165_10179992 247
1578 3300005331 Ga0070670_100000217 Ga0070670_10000021737 247
1579 3300005331 Ga0070670_100345398 Ga0070670_1003453981 247
1580 3300005353 Ga0070669_100109115 Ga0070669_1001091152 247
1581 3300005353 Ga0070669_100220952 Ga0070669_1002209522 247
1582 3300005355 Ga0070671_100013359 Ga0070671_1000133597 247
1583 3300005455 Ga0070663_100786271 Ga0070663_1007862711 247
1584 3300005457 Ga0070662_100296050 Ga0070662_1002960502 247
1585 3300005548 Ga0070665_100141205 Ga0070665_1001412054 247
1586 3300005563 Ga0068855_100197680 Ga0068855_1001976802 247
1587 3300005578 Ga0068854_100028161 Ga0068854_1000281615 247
1588 3300005614 Ga0068856_100051454 Ga0068856_1000514542 247
1589 3300005985 Ga0081539_10000690 Ga0081539_1000069057 247
1590 3300006038 Ga0075365_10000540 Ga0075365_1000054010 247
1591 3300006038 Ga0075365_10431060 Ga0075365_104310602 247
1592 3300006178 Ga0075367_10012889 Ga0075367_100128896 247
1593 3300006178 Ga0075367_10172603 Ga0075367_101726032 247
1594 3300006186 Ga0075369_10001016 Ga0075369_1000101610 247
1595 3300006353 Ga0075370_10098820 Ga0075370_100988202 247
1596 3300009011 Ga0105251_10069616 Ga0105251_100696162 247
1597 3300009093 Ga0105240_10000142 Ga0105240_10000142125 247
1598 3300009101 Ga0105247_10287551 Ga0105247_102875512 247
1599 3300009177 Ga0105248_10171324 Ga0105248_101713244 247
1600 3300009545 Ga0105237_10003956 Ga0105237_1000395614 247
1601 3300009553 Ga0105249_10085746 Ga0105249_100857462 247
1602 3300009763 Ga0123340_1060560 Ga0123340_10605602 247
1603 3300009765 Ga0123341_1088342 Ga0123341_10883422 247
1604 3300009766 Ga0123342_1005926 Ga0123342_10059269 247
1605 3300010375 Ga0105239_10923850 Ga0105239_109238501 247
1606 3300013104 Ga0157370_10016534 Ga0157370_100165347 247
1607 3300014497 Ga0182008_10017526 Ga0182008_100175263 247
1608 3300015262 Ga0182007_10004894 Ga0182007_100048945 247
1609 3300015265 Ga0182005_1004876 Ga0182005_10048762 247
1610 3300025206 Ga0209435_100031 Ga0209435_100031133 247
1611 3300025233 Ga0209437_100179 Ga0209437_10017916 247
1612 3300025233 Ga0209437_100181 Ga0209437_10018114 247
1613 3300025233 Ga0209437_102732 Ga0209437_1027325 247
1614 3300025245 Ga0207425_1000035 Ga0207425_1000035191 247
1615 3300025246 Ga0209646_1000102 Ga0209646_1000102133 247
1616 3300025246 Ga0209646_1006416 Ga0209646_10064162 247
1617 3300025250 Ga0209026_1000096 Ga0209026_1000096133 247
1618 3300025253 Ga0209677_101381 Ga0209677_1013817 247
1619 3300025256 Ga0209759_1000090 Ga0209759_1000090133 247
1620 3300025258 Ga0209129_1000029 Ga0209129_1000029191 247
1621 3300025258 Ga0209129_1000050 Ga0209129_100005017 247
1622 3300025258 Ga0209129_1000988 Ga0209129_10009889 247
1623 3300025261 Ga0209233_1000185 Ga0209233_100018515 247
1624 3300025261 Ga0209233_1000475 Ga0209233_10004758 247
1625 3300025261 Ga0209233_1000514 Ga0209233_100051414 247
1626 3300025272 Ga0209455_1028817 Ga0209455_10288172 247
1627 3300025273 Ga0209673_1000033 Ga0209673_100003316 247
1628 3300025273 Ga0209673_1004458 Ga0209673_10044584 247
1629 3300025273 Ga0209673_1015711 Ga0209673_10157112 247
1630 3300025284 Ga0209130_1000058 Ga0209130_100005816 247
1631 3300025284 Ga0209130_1017428 Ga0209130_10174282 247
1632 3300025292 Ga0209676_1040724 Ga0209676_10407242 247
1633 3300025294 Ga0209025_1000132 Ga0209025_100013215 247
1634 3300025294 Ga0209025_1001839 Ga0209025_10018394 247
1635 3300025294 Ga0209025_1027301 Ga0209025_10273014 247
1636 3300025295 Ga0209564_1006217 Ga0209564_10062177 247
1637 3300025295 Ga0209564_1011757 Ga0209564_10117572 247
1638 3300025295 Ga0209564_1015455 Ga0209564_10154554 247
1639 3300025295 Ga0209564_1015526 Ga0209564_10155264 247
1640 3300025297 Ga0209758_1002888 Ga0209758_10028888 247
1641 3300025297 Ga0209758_1023147 Ga0209758_10231474 247
1642 3300025297 Ga0209758_1039237 Ga0209758_10392372 247
1643 3300025299 Ga0209256_1001010 Ga0209256_100101016 247
1644 3300025299 Ga0209256_1009461 Ga0209256_10094614 247
1645 3300025299 Ga0209256_1012371 Ga0209256_10123713 247
1646 3300025299 Ga0209256_1024892 Ga0209256_10248923 247
1647 3300025302 Ga0207426_1000131 Ga0207426_100013116 247
1648 3300025302 Ga0207426_1000747 Ga0207426_100074714 247
1649 3300025303 Ga0209051_1008080 Ga0209051_10080802 247
1650 3300025913 Ga0207695_10000234 Ga0207695_10000234126 247
1651 3300025914 Ga0207671_10000234 Ga0207671_1000023461 247
1652 3300025923 Ga0207681_10135657 Ga0207681_101356572 247
1653 3300025925 Ga0207650_10001202 Ga0207650_1000120214 247
1654 3300025925 Ga0207650_10207121 Ga0207650_102071212 247
1655 3300025931 Ga0207644_10162582 Ga0207644_101625822 247
1656 3300025949 Ga0207667_10054345 Ga0207667_100543456 247
1657 3300025972 Ga0207668_10635011 Ga0207668_106350111 247
1658 3300025981 Ga0207640_10168833 Ga0207640_101688332 247
1659 3300026078 Ga0207702_10135205 Ga0207702_101352052 247
1660 3300027312 Ga0209371_1002161 Ga0209371_10021617 247
1661 3300028379 Ga0268266_10483602 Ga0268266_104836022 247
1662 3300028380 Ga0268265_10165971 Ga0268265_101659713 247
1663 3300030500 Ga0268256_1007723 Ga0268256_10077234 247
1664 3300031731 Ga0307405_10018137 Ga0307405_100181372 247
1665 3300031911 Ga0307412_10000806 Ga0307412_1000080610 247
1666 3300037312 Ga0395899_0000107 Ga0395899_0000107_49171_49935 247
1667 3300037418 Ga0395900_0000101 Ga0395900_0000101_94153_94917 247
1668 3300037466 Ga0395898_0000043 Ga0395898_0000043_49199_49963 247
1669 3300037471 Ga0395905_0000101 Ga0395905_0000101_49199_49963 247
1670 3300038443 Ga0395901_0000068 Ga0395901_0000068_49199_49963 247
1671 3300041413 Ga0439465_0001581 Ga0439465_0001581_3814_4563 247
1672 3300041997 Ga0439431_0014674 Ga0439431_0014674_260_1009 247
1673 3300044765 Ga0466970_0047732 Ga0466970_0047732_113_856 247
1674 3300046459 Ga0495629_0028295 Ga0495629_0028295_2192_2941 247
1675 3300046460 Ga0495638_0000110 Ga0495638_0000110_114699_115448 247
1676 3300046463 Ga0495653_0312548 Ga0495653_0312548_63_812 247
1677 3300046506 Ga0495583_0009254 Ga0495583_0009254_1334_2083 247
1678 3300046507 Ga0495606_0009386 Ga0495606_0009386_415_1164 247
1679 3300046507 Ga0495606_0010590 Ga0495606_0010590_4433_5182 247
1680 3300046507 Ga0495606_0066858 Ga0495606_0066858_1352_2101 247
1681 3300046512 Ga0495610_0017922 Ga0495610_0017922_1793_2542 247
1682 3300046515 Ga0495620_0055192 Ga0495620_0055192_313_1062 247
1683 3300046519 Ga0495632_0044741 Ga0495632_0044741_1391_2140 247
1684 3300046519 Ga0495632_0062139 Ga0495632_0062139_135_884 247
1685 3300046529 Ga0495652_0152861 Ga0495652_0152861_110_859 247
1686 3300046536 Ga0495587_0207858 Ga0495587_0207858_121_870 247
1687 3300046557 Ga0495622_0008505 Ga0495622_0008505_1330_2079 247
1688 3300046558 Ga0495633_0047216 Ga0495633_0047216_1163_1912 247
1689 3300046660 Ga0495625_0351613 Ga0495625_0351613_51_800 247
1690 3300046674 Ga0495588_0160944 Ga0495588_0160944_341_1090 247
1691 3300046675 Ga0495657_0055740 Ga0495657_0055740_390_1139 247
1692 3300046683 Ga0495658_0168180 Ga0495658_0168180_564_1313 247
1693 3300046809 Ga0495600_0108649 Ga0495600_0108649_65_814 247
1694 3300047317 Ga0495604_0077159 Ga0495604_0077159_1317_2066 247
1695 3300047472 Ga0495686_0000972 Ga0495686_0000972_32094_32843 247
1696 3300047472 Ga0495686_0006562 Ga0495686_0006562_2886_3635 247
1697 3300048908 Ga0496105_0102145 Ga0496105_0102145_534_1283 247
1698 3300048911 Ga0496108_0453122 Ga0496108_0453122_172_921 247
1699 3300048913 Ga0496110_0277368 Ga0496110_0277368_752_1501 247
1700 3300048917 Ga0496114_0375345 Ga0496114_0375345_410_1159 247
1701 3300048919 Ga0496116_0011521 Ga0496116_0011521_5304_6053 247
1702 3300048919 Ga0496116_0061396 Ga0496116_0061396_772_1521 247
1703 3300048919 Ga0496116_0083393 Ga0496116_0083393_93_842 247
1704 3300048919 Ga0496116_0098852 Ga0496116_0098852_386_1135 247
1705 3300048919 Ga0496116_0258592 Ga0496116_0258592_31_780 247
1706 3300048920 Ga0496117_0035542 Ga0496117_0035542_1770_2519 247
1707 3300048920 Ga0496117_0040154 Ga0496117_0040154_2034_2777 247
1708 3300048921 Ga0496118_0061514 Ga0496118_0061514_670_1413 247
1709 3300048922 Ga0496119_0002950 Ga0496119_0002950_9394_10170 247
1710 3300048922 Ga0496119_0069220 Ga0496119_0069220_76_819 247
1711 3300048922 Ga0496119_0163992 Ga0496119_0163992_341_1090 247
1712 3300048923 Ga0496120_0033056 Ga0496120_0033056_1232_1975 247
1713 3300048924 Ga0496121_0032220 Ga0496121_0032220_440_1189 247
1714 3300048924 Ga0496121_0043889 Ga0496121_0043889_1506_2255 247
1715 3300048924 Ga0496121_0057142 Ga0496121_0057142_1137_1880 247
1716 3300048924 Ga0496121_0060057 Ga0496121_0060057_805_1554 247
1717 3300048924 Ga0496121_0076315 Ga0496121_0076315_1119_1868 247
1718 3300048925 Ga0496122_0007305 Ga0496122_0007305_10339_11088 247
1719 3300048925 Ga0496122_0034508 Ga0496122_0034508_1144_1887 247
1720 3300048925 Ga0496122_0110872 Ga0496122_0110872_289_1038 247
1721 3300048926 Ga0496123_0033011 Ga0496123_0033011_1888_2637 247
1722 3300048926 Ga0496123_0083501 Ga0496123_0083501_677_1420 247
1723 3300048926 Ga0496123_0087085 Ga0496123_0087085_952_1701 247
1724 3300048926 Ga0496123_0137133 Ga0496123_0137133_149_898 247
1725 3300048927 Ga0496124_0003003 Ga0496124_0003003_15386_16135 247
1726 3300048927 Ga0496124_0062382 Ga0496124_0062382_624_1373 247
1727 3300048927 Ga0496124_0186896 Ga0496124_0186896_688_1437 247
1728 3300048927 Ga0496124_0214479 Ga0496124_0214479_291_1034 247
1729 3300048927 Ga0496124_0248225 Ga0496124_0248225_19_768 247
1730 3300048928 Ga0496125_0020980 Ga0496125_0020980_4058_4807 247
1731 3300048928 Ga0496125_0123716 Ga0496125_0123716_551_1300 247
1732 3300048929 Ga0496126_0057927 Ga0496126_0057927_1499_2242 247
1733 3300048929 Ga0496126_0080075 Ga0496126_0080075_2125_2874 247
1734 3300048929 Ga0496126_0250151 Ga0496126_0250151_348_1097 247
1735 3300049569 Ga0501032_0148347 Ga0501032_0148347_720_1469 247
1736 3300049571 Ga0501034_0023386 Ga0501034_0023386_1486_2250 247
1737 3300049579 Ga0501043_0167806 Ga0501043_0167806_728_1477 247
1738 3300049581 Ga0501047_0068774 Ga0501047_0068774_2206_2955 247
1739 3300049583 Ga0501067_0176964 Ga0501067_0176964_39_797 247
1740 3300049589 Ga0501073_0273153 Ga0501073_0273153_105_854 247
1741 3300049744 Ga0501083_0270475 Ga0501083_0270475_327_1076 247
1742 3300050492 nmdc:mga0yw44_469592_c1 nmdc:mga0yw44_469592_c1_39_803 247
1743 3300053125 Ga0500618_034879 Ga0500618_034879_59_808 247
1744 3300053148 Ga0500590_007742 Ga0500590_007742_1356_2105 247
1745 3300053153 Ga0500616_0001192 Ga0500616_0001192_3559_4308 247
1746 3300053161 Ga0500634_0002218 Ga0500634_0002218_6686_7438 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

2

231

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tx9-assembly1.cif.gz_A crystal structure of hisap from streptomyces sviceus with degraded profar 0.9431 1 240
4x2r-assembly1.cif.gz_A crystal structure of pria from actinomyces urogenitalis 0.9378 1 240
4u28-assembly1.cif.gz_A crystal structure of apo phosphoribosyl isomerase a from streptomyces sviceus atcc 29083 0.9352 1 239
2vep-assembly1.cif.gz_A crystal structure of the full length bifunctional enzyme pria 0.9307 1 238
5abt-assembly1.cif.gz_A s.enterica hisa mutant d7n, g102a, v106m, d176a 0.9299 2 242
ID Description Score Start End Superfamily
af_Q2FUU2_4_232_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9452 4 229 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9452 1 240 3.20.20.70
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9377 1 240 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9375 1 240 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9368 2 241 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A159Z6K8-F1-model_v4 1--5-[methylideneamino] imidazole-4-carboxamide isomerase 0.9944 1 126 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A257XKY7-F1-model_v4 deleted 0.9931 1 115
AF-A0A0Q4TRZ4-F1-model_v4 deleted 0.9898 1 244
AF-A0A532EBK1-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamideisomerase (EC 5.3.1.16) 0.9898 62 241 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A1I4MBE8-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9897 2 245 GO:0000105
GO:0000162
GO:0003949
GO:0005737

Feature Viewer

pLDDT pTM Quality
93.32 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map