F495458

General Info

Members Datasets Scaffolds Average Seq Length
1717 1175 911 266

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0057690|Ga0496104_0057690_108_905
Length 254
Sequence MKRGKFDITVLTLGFAYSFNASKLVTVWGGFSLQWYKSMWSNQGLMDAAWVTLRVGILSATIGTILGTLAALSLTRFARFPGRVLFSGMIYAPLVMPEVITGLSLLLLFVAVGVDRGFWTVVIAHTTFTMCYVAIVVQSRLLTFDRSLEEAALDLGCPPVKTFFRITLPLIFPAVIAFTLSLDDLVIASFATGPGATTLPIKIYSQVRLGVTPEINAICTILIGLVTIGVIVASVASKRTELQRMRDEHAAARN

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
8 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
9 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
10 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
11 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
12 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
13 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
14 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
15 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
16 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
17 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
18 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
19 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
20 2512875024 Mesorhizobium loti R88b Isolate Nodule
21 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
22 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
23 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
24 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
25 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
26 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
27 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
28 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
29 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
30 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
31 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
32 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
33 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
34 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
35 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
36 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
37 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
38 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
39 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
40 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
41 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
42 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
43 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
44 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
45 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
46 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
47 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
48 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
49 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
50 2516143018 Ensifer sp. BR816 Isolate Nodule
51 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
52 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
53 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
54 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
55 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
56 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
57 2519899620 Rhizobium sp. Pop5 Isolate Nodule
58 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
59 2534681786 Brucella suis 92/29 Isolate Unclassified
60 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
61 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
62 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
63 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
64 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
65 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
66 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
67 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
68 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
69 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
70 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
71 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
72 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
73 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
74 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
75 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
76 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
77 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
78 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
79 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
80 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
81 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
82 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
83 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
84 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
85 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
86 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
87 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
88 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
89 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
90 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
91 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
92 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
93 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
94 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
95 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
96 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
97 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
98 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
99 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
100 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
101 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
102 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
103 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
104 2643221557 Ensifer sp. Root558 Isolate Unclassified
105 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
106 2643221582 Rhizobium sp. Root651 Isolate Unclassified
107 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
108 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
109 2643221599 Rhizobium sp. Root708 Isolate Unclassified
110 2643221607 Rhizobium sp. Root73 Isolate Unclassified
111 2643221610 Ensifer sp. Root74 Isolate Unclassified
112 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
113 2643221618 Ensifer sp. Root231 Isolate Unclassified
114 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
115 2643221626 Ensifer sp. Root31 Isolate Unclassified
116 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
117 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
118 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
119 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
120 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
121 2643221655 Ensifer sp. Root1252 Isolate Unclassified
122 2643221659 Ensifer sp. Root127 Isolate Unclassified
123 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
124 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
125 2643221668 Ensifer sp. Root423 Isolate Unclassified
126 2643221675 Ensifer sp. Root1298 Isolate Unclassified
127 2643221680 Ensifer sp. Root1312 Isolate Unclassified
128 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
129 2643221688 Rhizobium sp. Root482 Isolate Unclassified
130 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
131 2643221693 Rhizobium sp. Root491 Isolate Unclassified
132 2643221698 Ensifer sp. Root142 Isolate Unclassified
133 2643221712 Ensifer sp. Root258 Isolate Unclassified
134 2643221718 Rhizobium sp. Root268 Isolate Unclassified
135 2643221723 Ensifer sp. Root278 Isolate Unclassified
136 2643221726 Ensifer sp. Root954 Isolate Unclassified
137 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
138 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
139 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
140 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
141 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
142 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
143 2718217882 Rhizobium sp. N741 Isolate Nodule
144 2718217927 Rhizobium sp. N324 Isolate Nodule
145 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
146 2718218009 Rhizobium sp. N561 Isolate Nodule
147 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
148 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
149 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
150 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
151 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
152 2718218363 Rhizobium sp. N113 Isolate Nodule
153 2718218365 Rhizobium sp. N731 Isolate Nodule
154 2718218366 Rhizobium sp. N621 Isolate Nodule
155 2718218423 Rhizobium sp. N941 Isolate Nodule
156 2721755514 Rhizobium sp. N6212 Isolate Nodule
157 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
158 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
159 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
160 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
161 2721755809 Rhizobium sp. N541 Isolate Nodule
162 2721755810 Rhizobium sp. N871 Isolate Nodule
163 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
164 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
165 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
166 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
167 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
168 2728369365 Rhizobium sp. N1341 Isolate Nodule
169 2728369397 Rhizobium sp. N1314 Isolate Nodule
170 2738541293 Rhizobium sp. GV031 Isolate Unclassified
171 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
172 2738543024 Aminobacter sp. AP02 Isolate Unclassified
173 2751185800 Brucella pituitosa AA2 Isolate Unclassified
174 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
175 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
176 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
177 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
178 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
179 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
180 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
181 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
182 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
183 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
184 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
185 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
186 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
187 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
188 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
189 2791355256 Rhizobium sp. M10 Isolate Nodule
190 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
191 2791355260 Rhizobium sp. L9 Isolate Nodule
192 2791355261 Rhizobium sp. J15 Isolate Nodule
193 2791355262 Rhizobium sp. M1 Isolate Nodule
194 2791355263 Rhizobium chutanense C5 Isolate Nodule
195 2791355264 Rhizobium sp. S9 Isolate Nodule
196 2791355265 Rhizobium sp. H4 Isolate Nodule
197 2791355266 Rhizobium sp. L43 Isolate Nodule
198 2791355267 Rhizobium sp. L18 Isolate Nodule
199 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
200 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
201 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
202 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
203 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
204 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
205 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
206 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
207 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
208 2802429633 Rhizobium anhuiense J3 Isolate Nodule
209 2802429634 Rhizobium anhuiense S10 Isolate Nodule
210 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
211 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
212 2802429637 Rhizobium anhuiense C15 Isolate Nodule
213 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
214 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
215 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
216 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
217 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
218 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
219 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
220 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
221 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
222 2838048938 Rhizobium pisi 27/80 Isolate Nodule
223 2838061910 Rhizobium phaseoli L15 Isolate Nodule
224 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
225 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
226 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
227 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
228 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
229 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
230 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
231 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
232 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
233 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
234 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
235 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
236 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
237 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
238 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
239 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
240 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
241 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
242 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
243 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
244 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
245 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
246 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
247 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
248 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
249 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
250 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
251 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
252 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
253 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
254 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
255 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
256 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
257 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
258 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
259 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
260 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
261 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
262 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
263 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
264 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
265 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
266 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
267 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
268 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
269 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
270 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
271 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
272 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
273 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
274 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
275 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
276 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
277 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
278 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
279 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
280 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
281 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
282 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
283 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
284 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
285 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
286 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
287 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
288 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
289 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
290 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
291 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
292 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
293 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
294 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
295 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
296 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
297 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
298 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
299 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
300 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
301 2844163670 Ensifer sp. 1H6 Isolate Unclassified
302 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
303 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
304 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
305 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
306 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
307 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
308 2854911287 Brucella lupini LUP21 Isolate Unclassified
309 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
310 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
311 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
312 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
313 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
314 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
315 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
316 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
317 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
318 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
319 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
320 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
321 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
322 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
323 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
324 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
325 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
326 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
327 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
328 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
329 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
330 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
331 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
332 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
333 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
334 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
335 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
336 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
337 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
338 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
339 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
340 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
341 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
342 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
343 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
344 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
345 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
346 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
347 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
348 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
349 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
350 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
351 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
352 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
353 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
354 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
355 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
356 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
357 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
358 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
359 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
360 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
361 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
362 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
363 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
364 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
365 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
366 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
367 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
368 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
369 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
370 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
371 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
372 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
373 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
374 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
375 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
376 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
377 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
378 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
379 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
380 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
381 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
382 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
383 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
384 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
385 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
386 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
387 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
388 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
389 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
390 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
391 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
392 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
393 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
394 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
395 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
396 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
397 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
398 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
399 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
400 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
401 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
402 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
403 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
404 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
405 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
406 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
407 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
408 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
409 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
410 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
411 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
412 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
413 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
414 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
415 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
416 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
417 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
418 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
419 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
420 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
421 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
422 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
423 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
424 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
425 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
426 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
427 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
428 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
429 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
430 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
431 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
432 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
433 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
434 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
435 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
436 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
437 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
438 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
439 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
440 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
441 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
442 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
443 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
444 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
445 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
446 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
447 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
448 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
449 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
450 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
451 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
452 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
453 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
454 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
455 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
456 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
457 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
458 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
459 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
460 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
461 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
462 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
463 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
464 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
465 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
466 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
467 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
468 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
469 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
470 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
471 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
472 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
473 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
474 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
475 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
476 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
477 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
478 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
479 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
480 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
481 2933599457 Rhizobium phaseoli M3 Isolate Nodule
482 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
483 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
484 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
485 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
486 2936381700 Rhizobium chutanense C16 Isolate Unclassified
487 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
488 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
489 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
490 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
491 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
492 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
493 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
494 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
495 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
496 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
497 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
498 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
499 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
500 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
501 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
502 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
503 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
504 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
505 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
506 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
507 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
508 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
509 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
510 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
511 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
512 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
513 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
514 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
515 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
516 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
517 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
518 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
519 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
520 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
521 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
522 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
523 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
524 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
525 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
526 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
527 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
528 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
529 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
530 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
531 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
532 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
533 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
534 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
535 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
536 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
537 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
538 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
539 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
540 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
541 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
542 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
543 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
544 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
545 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
546 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
547 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
548 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
549 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
550 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
551 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
552 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
553 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
554 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
555 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
556 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
557 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
558 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
559 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
560 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
561 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
562 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
563 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
564 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
565 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
566 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
567 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
568 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
569 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
570 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
571 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
572 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
573 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
574 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
575 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
576 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
577 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
578 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
579 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
580 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
581 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
582 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
583 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
584 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
585 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
586 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
587 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
588 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
589 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
590 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
591 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
592 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
593 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
594 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
595 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
596 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
597 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
598 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
599 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
600 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
601 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
602 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
603 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
604 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
605 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
606 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
607 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
608 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
609 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
610 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
611 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
612 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
613 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
614 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
615 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
616 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
617 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
618 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
619 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
620 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
621 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
622 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
623 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
624 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
625 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
626 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
627 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
628 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
629 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
630 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
631 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
632 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
633 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
634 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
635 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
636 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
637 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
638 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
639 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
640 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
641 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
642 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
643 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
644 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
645 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
646 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
647 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
648 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
649 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
650 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
651 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
652 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
653 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
654 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
655 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
656 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
657 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
658 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
659 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
660 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
661 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
662 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
663 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
664 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
665 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
666 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
667 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
668 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
669 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
670 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
671 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
672 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
673 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
674 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
675 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
676 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
677 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
678 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
679 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
680 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
681 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
682 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
683 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
684 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
685 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
686 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
687 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
688 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
689 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
690 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
691 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
692 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
693 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
694 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
695 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
696 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
697 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
698 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
699 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
700 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
701 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
702 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
703 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
704 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
705 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
706 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
707 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
708 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
709 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
710 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
711 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
712 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
713 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
714 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
715 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
716 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
717 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
718 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
719 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
720 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
721 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
722 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
723 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
724 2996887358 Rhizobium sp. R711 Isolate Nodule
725 2996893221 Rhizobium sp. R635 Isolate Nodule
726 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
727 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
728 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
729 3004167301 Mesorhizobium loti 582 Isolate Unclassified
730 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
731 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
732 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
733 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
734 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
735 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
736 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
737 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
738 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
739 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
740 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
741 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
742 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
743 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
744 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
745 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
746 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
747 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
748 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
749 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
750 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
751 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
752 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
753 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
754 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
755 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
756 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
757 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
758 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
759 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
760 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
761 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
762 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
763 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
764 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
765 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
766 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
767 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
768 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
769 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
770 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
771 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
772 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
773 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
774 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
775 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
776 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
777 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
778 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
779 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
780 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
781 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
782 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
783 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
784 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
785 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
786 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
787 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
788 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
789 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
790 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
791 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
792 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
793 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
794 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
795 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
796 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
797 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
798 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
799 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
800 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
801 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
802 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
803 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
804 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
805 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
806 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
807 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
808 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
809 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
810 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
811 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
812 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
813 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
814 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
815 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
816 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
817 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
818 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
819 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
820 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
821 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
822 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
823 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
824 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
825 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
826 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
827 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
828 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
829 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
830 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
831 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
832 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
833 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
834 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
835 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
836 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
837 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
838 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
839 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
840 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
841 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
842 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
843 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
844 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
845 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
846 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
847 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
848 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
849 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
850 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
851 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
852 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
853 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
854 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
855 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
856 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
857 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
858 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
859 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
860 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
861 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
862 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
863 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
864 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
865 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
866 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
867 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
868 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
869 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
870 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
871 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
872 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
873 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
874 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
875 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
876 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
877 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
878 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
879 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
880 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
881 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
882 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
883 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
884 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
885 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
886 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
887 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
888 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
889 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
890 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
891 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
892 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
893 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
894 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
895 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
896 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
897 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
898 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
899 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
900 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
901 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
902 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
903 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
904 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
905 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
906 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
907 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
908 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
909 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
910 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
911 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
912 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
913 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
914 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
915 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
916 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
917 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
918 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
919 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
920 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
921 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
922 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
923 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
924 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
925 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
926 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
927 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
928 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
929 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
930 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
931 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
932 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
933 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
934 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
935 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
936 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
937 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
938 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
939 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
940 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
941 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
942 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
943 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
944 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
945 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
946 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
947 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
948 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
949 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
950 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
951 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
952 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
953 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
954 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
955 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
956 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
957 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
958 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
959 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
960 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
961 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
962 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
963 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
964 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
965 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
966 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
967 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
968 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
969 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
970 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
971 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
972 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
973 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
974 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
975 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
976 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
977 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
978 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
979 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
980 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
981 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
982 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
983 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
984 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
985 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
986 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
987 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
988 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
989 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
990 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
991 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
992 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
993 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
994 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
995 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
996 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
997 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
998 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
999 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1000 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1001 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
1002 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1003 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
1004 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1005 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1006 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1007 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1008 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1009 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1010 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1011 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
1012 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1013 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1014 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1015 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
1016 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
1017 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1018 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1019 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1020 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1021 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1022 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1023 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1024 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1025 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1026 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1027 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1028 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1029 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1030 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1031 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1032 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1033 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1034 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1035 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1036 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1037 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1038 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1039 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1040 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1041 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1042 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1043 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1044 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1045 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1046 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1047 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1048 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1049 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1050 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1051 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1052 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1053 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1054 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
1055 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1056 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1057 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1058 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1059 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1060 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1061 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1062 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1063 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1064 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1065 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1066 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1067 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1068 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1069 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1070 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1071 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1072 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1073 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1074 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1075 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
1076 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1077 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1078 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1079 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1080 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1081 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1082 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1083 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1084 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1085 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1086 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1087 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1088 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1089 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1090 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1091 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1092 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1093 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1094 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1095 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
1096 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1097 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1098 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1099 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1100 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1101 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1102 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1103 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1104 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1105 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1106 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1107 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1108 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1109 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1110 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
1111 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1112 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1114 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1115 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1116 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1117 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1118 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1119 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1120 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1121 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
1122 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1123 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1124 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1125 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1126 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1127 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1128 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1129 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1130 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1131 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1132 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1133 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1134 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1135 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1136 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1137 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1138 8005258706 Rhizobium sp. R693 Isolate Nodule
1139 8005275841 Rhizobium sp. N4311 Isolate Nodule
1140 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1141 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1142 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1143 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1144 8005321885 Rhizobium sp. R72 Isolate Nodule
1145 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1146 8005382845 Rhizobium sp. R634 Isolate Nodule
1147 8005395548 Rhizobium sp. R339 Isolate Nodule
1148 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1149 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1150 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1151 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1152 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1153 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1154 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1155 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1156 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1157 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1158 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1159 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1160 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1161 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1162 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1163 8018176218 Rhizobium sp. N122 Isolate Nodule
1164 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1165 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1166 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1167 8024501048 Rhizobium sp. H4 Isolate Nodule
1168 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1169 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1170 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1171 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1172 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1173 8056382006 Rhizobium croatiense 13T Isolate Nodule
1174 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1175 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.94
Metatranscriptomes 0.12
Isolates 46.94

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 12.81
Nodule 37.45
Rhizoplane 2.74
Rhizosphere 34.36
Stem 0
Stem Tuber 0
Unclassified 12.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003648 3300001979 Bacteria 6710
2 JGI25156J39149_1011633 3300002705 Bacteria 1979
3 JGI25158J39367_1002742 3300002739 Bacteria 2807
4 JGI25157J39369_1002049 3300002741 Bacteria 5765
5 JGI25152J39213_1001989 3300002773 Bacteria 8067
6 JGI25152J39213_1003655 3300002773 Bacteria 5173
7 JGI25152J39213_1003941 3300002773 Bacteria 4858
8 JGI25152J39213_1005371 3300002773 Bacteria 3755
9 JGI25152J39213_1006110 3300002773 Bacteria 3353
10 JGI25152J39213_1006231 3300002773 Bacteria 3302
11 JGI25150J39212_1000012 3300002774 Bacteria 182468
12 JGI25150J39212_1000635 3300002774 Bacteria 13309
13 JGI25150J39212_1004118 3300002774 Bacteria 3279
14 JGI25150J39212_1013033 3300002774 Bacteria 1452
15 JGI25159J45721_1000016 3300002987 Bacteria 139656
16 JGI25159J45721_1000903 3300002987 Bacteria 12921
17 JGI25151J46595_10000025 3300003187 Bacteria 213302
18 JGI25151J46595_10000346 3300003187 Bacteria 49745
19 JGI25151J46595_10005451 3300003187 Bacteria 6570
20 JGI25151J46595_10005499 3300003187 Bacteria 6531
21 JGI25151J46595_10017127 3300003187 Bacteria 3152
22 JGI25406J46586_10003471 3300003203 Bacteria 7412
23 JGI25406J46586_10004531 3300003203 Bacteria 6469
24 JGI25406J46586_10051175 3300003203 Bacteria 1383
25 JGI25406J46586_10064206 3300003203 Bacteria 1174
26 JGI25153J46596_10001067 3300003215 Bacteria 16714
27 JGI25153J46596_10001672 3300003215 Bacteria 13149
28 JGI25153J46596_10003250 3300003215 Bacteria 9136
29 JGI25153J46596_10007980 3300003215 Bacteria 5122
30 JGI25153J46596_10014039 3300003215 Bacteria 3353
31 JGI25153J46596_10014326 3300003215 Bacteria 3302
32 JGI25160J50197_1000002 3300003354 Bacteria 561707
33 JGI25161J50226_1000074 3300003374 Bacteria 85547
34 JGI25161J50226_1000397 3300003374 Bacteria 21635
35 JGI25161J50226_1006024 3300003374 Bacteria 2251
36 Ga0055529_1003391 3300003763 Bacteria 2654
37 Ga0055526_1001675 3300003771 Bacteria 15546
38 Ga0055526_1003529 3300003771 Bacteria 9876
39 Ga0055526_1003766 3300003771 Bacteria 9463
40 Ga0055526_1015038 3300003771 Bacteria 3134
41 Ga0055526_1016134 3300003771 Bacteria 2945
42 Ga0055524_1000384 3300003775 Bacteria 38108
43 Ga0055524_1005796 3300003775 Bacteria 5457
44 Ga0055524_1006985 3300003775 Bacteria 4850
45 Ga0055524_1011084 3300003775 Bacteria 3544
46 Ga0055524_1029125 3300003775 Bacteria 1640
47 Ga0055524_1038230 3300003775 Bacteria 1259
48 Ga0055524_1050089 3300003775 Bacteria 956
49 Ga0055528_1000642 3300003790 Bacteria 25591
50 Ga0055528_1000866 3300003790 Bacteria 20524
51 Ga0055528_1001522 3300003790 Bacteria 13999
52 Ga0055528_1031997 3300003790 Bacteria 1355
53 Ga0055540_1000471 3300003792 Bacteria 31092
54 Ga0055540_1002010 3300003792 Bacteria 11314
55 Ga0055540_1016068 3300003792 Bacteria 2147
56 Ga0055540_1018350 3300003792 Bacteria 1919
57 Ga0055543_1000022 3300004625 Bacteria 140745
58 Ga0055543_1000141 3300004625 Bacteria 60055
59 Ga0055543_1001242 3300004625 Bacteria 10604
60 Ga0065165_1000058 3300005262 Bacteria 184784
61 Ga0070690_100004984 3300005330 Bacteria 7433
62 Ga0070670_100135511 3300005331 Bacteria 2128
63 Ga0070670_100305429 3300005331 Bacteria 1392
64 Ga0070680_100036295 3300005336 Bacteria 3982
65 Ga0070682_100040460 3300005337 Bacteria 2868
66 Ga0070682_100164415 3300005337 Bacteria 1536
67 Ga0070660_100218298 3300005339 Bacteria 1549
68 Ga0070689_100001622 3300005340 Bacteria 14368
69 Ga0070689_100445583 3300005340 Bacteria 1101
70 Ga0070691_10158127 3300005341 Bacteria 1167
71 Ga0070668_100006623 3300005347 Bacteria 8584
72 Ga0070668_100008269 3300005347 Bacteria 7723
73 Ga0070668_100014191 3300005347 Bacteria 5952
74 Ga0070668_100023623 3300005347 Bacteria 4651
75 Ga0070668_100074040 3300005347 Bacteria 2656
76 Ga0070668_100084250 3300005347 Bacteria 2496
77 Ga0070669_100113247 3300005353 Bacteria 2061
78 Ga0070675_100162214 3300005354 Bacteria 1923
79 Ga0070675_100635039 3300005354 Bacteria 970
80 Ga0070671_100005795 3300005355 Bacteria 9839
81 Ga0070671_100130128 3300005355 Bacteria 2120
82 Ga0070688_100003117 3300005365 Bacteria 8477
83 Ga0070659_100032393 3300005366 Bacteria 4054
84 Ga0070667_100016097 3300005367 Bacteria 6186
85 Ga0070667_100393777 3300005367 Bacteria 1260
86 Ga0070709_10052912 3300005434 Bacteria 2554
87 Ga0070713_100385128 3300005436 Bacteria 1307
88 Ga0070705_100012932 3300005440 Bacteria 4258
89 Ga0070700_100267034 3300005441 Bacteria 1235
90 Ga0070708_100764056 3300005445 Bacteria 909
91 Ga0070663_100071387 3300005455 Bacteria 2526
92 Ga0070678_100098451 3300005456 Bacteria 2261
93 Ga0070681_10006028 3300005458 Bacteria 11744
94 Ga0070679_100014502 3300005530 Bacteria 7570
95 Ga0070684_100134267 3300005535 Bacteria 2234
96 Ga0068853_100015631 3300005539 Bacteria 6235
97 Ga0070696_100032028 3300005546 Bacteria 3606
98 Ga0070665_100003769 3300005548 Bacteria 16042
99 Ga0070665_100004421 3300005548 Bacteria 14769
100 Ga0070665_100025086 3300005548 Bacteria 6009
101 Ga0070665_100781846 3300005548 Bacteria 968
102 Ga0068855_100288527 3300005563 Bacteria 1820
103 Ga0070664_100156462 3300005564 Bacteria 2014
104 Ga0070664_100173555 3300005564 Bacteria 1913
105 Ga0068856_100246320 3300005614 Bacteria 1802
106 Ga0068856_100479612 3300005614 Bacteria 1264
107 Ga0070702_100062629 3300005615 Bacteria 2169
108 Ga0070702_100066993 3300005615 Bacteria 2108
109 Ga0068859_100021694 3300005617 Bacteria 6445
110 Ga0068859_100071069 3300005617 Bacteria 3516
111 Ga0068859_100348761 3300005617 Bacteria 1575
112 Ga0068859_100383314 3300005617 Bacteria 1501
113 Ga0068864_100025873 3300005618 Bacteria 4945
114 Ga0068864_100025900 3300005618 Bacteria 4943
115 Ga0068866_10163645 3300005718 Bacteria 1300
116 Ga0068861_100032017 3300005719 Bacteria 3869
117 Ga0068860_100000083 3300005843 Bacteria 168189
118 Ga0068860_100087672 3300005843 Bacteria 2963
119 Ga0068860_100138148 3300005843 Bacteria 2341
120 Ga0068860_100461223 3300005843 Bacteria 1264
121 Ga0068860_100783811 3300005843 Bacteria 966
122 Ga0068862_100050812 3300005844 Bacteria 3544
123 Ga0068862_100070545 3300005844 Bacteria 3016
124 Ga0068862_100155563 3300005844 Bacteria 2038
125 Ga0068862_100204986 3300005844 Bacteria 1779
126 Ga0068862_100222386 3300005844 Bacteria 1710
127 Ga0068862_100307554 3300005844 Bacteria 1460
128 Ga0081455_10107875 3300005937 Bacteria 2219
129 Ga0081539_10000881 3300005985 Bacteria 57379
130 Ga0081539_10016778 3300005985 Bacteria 5198
131 Ga0070717_10173981 3300006028 Bacteria 1874
132 Ga0075365_10003968 3300006038 Bacteria 7748
133 Ga0075365_10015283 3300006038 Bacteria 4639
134 Ga0075365_10058029 3300006038 Bacteria 2576
135 Ga0075365_10138288 3300006038 Bacteria 1689
136 Ga0075365_10174103 3300006038 Bacteria 1503
137 Ga0075368_10000355 3300006042 Bacteria 13436
138 Ga0075368_10024940 3300006042 Bacteria 2292
139 Ga0075368_10074969 3300006042 Bacteria 1371
140 Ga0075363_100022130 3300006048 Bacteria 3211
141 Ga0075363_100112488 3300006048 Bacteria 1514
142 Ga0075364_10022542 3300006051 Bacteria 3978
143 Ga0075364_10152227 3300006051 Bacteria 1559
144 Ga0075364_10162493 3300006051 Bacteria 1508
145 Ga0075364_10273369 3300006051 Bacteria 1149
146 Ga0070716_100072389 3300006173 Bacteria 2029
147 Ga0075362_10049994 3300006177 Bacteria 1869
148 Ga0075362_10051585 3300006177 Bacteria 1842
149 Ga0075362_10090892 3300006177 Bacteria 1417
150 Ga0075362_10162958 3300006177 Bacteria 1074
151 Ga0075367_10000124 3300006178 Bacteria 22440
152 Ga0075367_10002714 3300006178 Bacteria 8171
153 Ga0075367_10010369 3300006178 Bacteria 4894
154 Ga0075367_10045731 3300006178 Bacteria 2569
155 Ga0075369_10001413 3300006186 Bacteria 8182
156 Ga0075369_10007695 3300006186 Bacteria 4117
157 Ga0075369_10025016 3300006186 Bacteria 2479
158 Ga0075369_10043510 3300006186 Bacteria 1927
159 Ga0075366_10021892 3300006195 Bacteria 3716
160 Ga0075366_10085442 3300006195 Bacteria 1887
161 Ga0075366_10115249 3300006195 Bacteria 1618
162 Ga0097621_100436463 3300006237 Bacteria 1178
163 Ga0075370_10025169 3300006353 Bacteria 3290
164 Ga0075370_10188242 3300006353 Bacteria 1216
165 Ga0097620_100021695 3300006931 Bacteria 6445
166 Ga0097620_100071067 3300006931 Bacteria 3516
167 Ga0097620_100348769 3300006931 Bacteria 1575
168 Ga0097620_100383329 3300006931 Bacteria 1501
169 Ga0099826_10000423 3300006948 Bacteria 20100
170 Ga0099826_10006813 3300006948 Bacteria 8363
171 Ga0099826_10101545 3300006948 Bacteria 1734
172 Ga0099795_10055087 3300007788 Bacteria 1460
173 Ga0105251_10010361 3300009011 Bacteria 5415
174 Ga0105240_10712829 3300009093 Bacteria 1094
175 Ga0111539_10309258 3300009094 Bacteria 1839
176 Ga0105245_10445948 3300009098 Bacteria 1302
177 Ga0105247_10056622 3300009101 Bacteria 2422
178 Ga0105247_10347259 3300009101 Bacteria 1042
179 Ga0114129_10675954 3300009147 Bacteria 1330
180 Ga0105243_10012317 3300009148 Bacteria 6468
181 Ga0105243_10067473 3300009148 Bacteria 2879
182 Ga0105241_10050610 3300009174 Bacteria 3167
183 Ga0105241_10088427 3300009174 Bacteria 2439
184 Ga0105241_10293398 3300009174 Bacteria 1393
185 Ga0105248_10014988 3300009177 Bacteria 8533
186 Ga0105248_10020676 3300009177 Bacteria 7294
187 Ga0105237_10034925 3300009545 Bacteria 5088
188 Ga0105237_10041352 3300009545 Bacteria 4649
189 Ga0105237_10563059 3300009545 Bacteria 1146
190 Ga0105237_10882249 3300009545 Bacteria 901
191 Ga0105249_10438761 3300009553 Bacteria 1343
192 Ga0123340_1051759 3300009763 Bacteria 1460
193 Ga0123342_1014771 3300009766 Bacteria 7342
194 Ga0123342_1029482 3300009766 Bacteria 2847
195 Ga0105239_10028240 3300010375 Bacteria 6172
196 Ga0105239_10073717 3300010375 Bacteria 3753
197 Ga0105239_10124983 3300010375 Bacteria 2858
198 Ga0105239_10143028 3300010375 Bacteria 2667
199 Ga0105246_10467859 3300011119 Bacteria 1063
200 Ga0157373_10001801 3300013100 Bacteria 16297
201 Ga0157371_10000058 3300013102 Bacteria 171756
202 Ga0157370_10000792 3300013104 Bacteria 39754
203 Ga0157369_10083884 3300013105 Bacteria 3407
204 Ga0171463_1001 3300013249 Bacteria 1406070
205 Ga0157374_10535891 3300013296 Bacteria 1178
206 Ga0157378_10071978 3300013297 Bacteria 3105
207 Ga0163162_10254260 3300013306 Bacteria 1889
208 Ga0163162_10964457 3300013306 Bacteria 963
209 Ga0157372_10451691 3300013307 Bacteria 1498
210 Ga0157375_10195734 3300013308 Bacteria 2176
211 Ga0163163_10009574 3300014325 Bacteria 8659
212 Ga0163163_10128427 3300014325 Bacteria 2574
213 Ga0157376_10177241 3300014969 Bacteria 1945
214 Ga0157376_10679045 3300014969 Bacteria 1033
215 Ga0182006_1022618 3300015261 Bacteria 2612
216 Ga0182007_10016195 3300015262 Bacteria 2757
217 Ga0183363_1012 3300015690 Bacteria 90054
218 Ga0163161_10388757 3300017792 Bacteria 1116
219 Ga0214544_1000012 3300021320 Bacteria 229808
220 Ga0214542_1000011 3300021321 Bacteria 238260
221 Ga0214542_1017282 3300021321 Bacteria 6588
222 Ga0214543_1000004 3300021327 Bacteria 527190
223 Ga0214543_1000256 3300021327 Bacteria 82084
224 Ga0213875_10000030 3300021388 Bacteria 178500
225 Ga0228711_1000019 3300022739 Bacteria 111795
226 Ga0228710_1000022 3300022740 Bacteria 111795
227 Ga0209436_100429 3300025208 Bacteria 18855
228 Ga0209436_100737 3300025208 Bacteria 13643
229 Ga0207425_1000012 3300025245 Bacteria 528324
230 Ga0207425_1001525 3300025245 Bacteria 9512
231 Ga0207425_1003710 3300025245 Bacteria 4794
232 Ga0207425_1006553 3300025245 Bacteria 3171
233 Ga0209646_1009151 3300025246 Bacteria 1576
234 Ga0209026_1000116 3300025250 Bacteria 133228
235 Ga0209148_1000256 3300025254 Bacteria 83479
236 Ga0209759_1000153 3300025256 Bacteria 119494
237 Ga0209129_1000081 3300025258 Bacteria 183694
238 Ga0209129_1000123 3300025258 Bacteria 133661
239 Ga0209129_1000726 3300025258 Bacteria 21238
240 Ga0209129_1001366 3300025258 Bacteria 13698
241 Ga0209129_1002322 3300025258 Bacteria 9429
242 Ga0209129_1010413 3300025258 Bacteria 2321
243 Ga0209129_1019425 3300025258 Bacteria 1284
244 Ga0209233_1000047 3300025261 Bacteria 459614
245 Ga0209233_1006535 3300025261 Bacteria 3749
246 Ga0209455_1000409 3300025272 Bacteria 34679
247 Ga0209673_1000015 3300025273 Bacteria 530618
248 Ga0209673_1000967 3300025273 Bacteria 35634
249 Ga0209673_1001074 3300025273 Bacteria 30901
250 Ga0209673_1001964 3300025273 Bacteria 16078
251 Ga0209673_1003197 3300025273 Bacteria 9937
252 Ga0209673_1005594 3300025273 Bacteria 6279
253 Ga0209130_1000002 3300025284 Bacteria 722648
254 Ga0209130_1000008 3300025284 Bacteria 581232
255 Ga0209130_1011836 3300025284 Bacteria 2314
256 Ga0209676_1012908 3300025292 Bacteria 3246
257 Ga0209025_1000024 3300025294 Bacteria 528324
258 Ga0209025_1000441 3300025294 Bacteria 81951
259 Ga0209025_1000528 3300025294 Bacteria 72802
260 Ga0209025_1000631 3300025294 Bacteria 62429
261 Ga0209025_1000970 3300025294 Bacteria 43006
262 Ga0209025_1003049 3300025294 Bacteria 16508
263 Ga0209025_1003063 3300025294 Bacteria 16420
264 Ga0209025_1003580 3300025294 Bacteria 14522
265 Ga0209025_1007670 3300025294 Bacteria 7971
266 Ga0209025_1014304 3300025294 Bacteria 4894
267 Ga0209025_1022843 3300025294 Bacteria 3298
268 Ga0209025_1052054 3300025294 Bacteria 1620
269 Ga0209564_1000091 3300025295 Bacteria 249103
270 Ga0209564_1000382 3300025295 Bacteria 81070
271 Ga0209564_1000830 3300025295 Bacteria 41868
272 Ga0209564_1001931 3300025295 Bacteria 18509
273 Ga0209564_1005067 3300025295 Bacteria 7691
274 Ga0209564_1016131 3300025295 Bacteria 2994
275 Ga0209564_1025178 3300025295 Bacteria 2011
276 Ga0209564_1051984 3300025295 Bacteria 989
277 Ga0209758_1000046 3300025297 Bacteria 364931
278 Ga0209758_1001048 3300025297 Bacteria 36241
279 Ga0209758_1001507 3300025297 Bacteria 27061
280 Ga0209758_1001962 3300025297 Bacteria 22243
281 Ga0209758_1002450 3300025297 Bacteria 18942
282 Ga0209758_1002458 3300025297 Bacteria 18888
283 Ga0209758_1002490 3300025297 Bacteria 18719
284 Ga0209758_1033320 3300025297 Bacteria 2072
285 Ga0209256_1000180 3300025299 Bacteria 123687
286 Ga0209256_1000541 3300025299 Bacteria 54431
287 Ga0209256_1000874 3300025299 Bacteria 37312
288 Ga0209256_1001340 3300025299 Bacteria 26171
289 Ga0209256_1005494 3300025299 Bacteria 7255
290 Ga0209256_1005579 3300025299 Bacteria 7162
291 Ga0209256_1014814 3300025299 Bacteria 2772
292 Ga0209256_1018807 3300025299 Bacteria 2226
293 Ga0209256_1018895 3300025299 Bacteria 2218
294 Ga0207426_1000013 3300025302 Bacteria 721897
295 Ga0207426_1000016 3300025302 Bacteria 581232
296 Ga0207426_1000063 3300025302 Bacteria 358920
297 Ga0207426_1000172 3300025302 Bacteria 163690
298 Ga0207426_1001124 3300025302 Bacteria 24372
299 Ga0209051_1000084 3300025303 Bacteria 190324
300 Ga0209051_1002801 3300025303 Bacteria 12034
301 Ga0209051_1023790 3300025303 Bacteria 2538
302 Ga0209051_1028922 3300025303 Bacteria 2179
303 Ga0209257_1002194 3300025304 Bacteria 20197
304 Ga0209257_1007835 3300025304 Bacteria 6315
305 Ga0209257_1021726 3300025304 Bacteria 2319
306 Ga0207710_10119331 3300025900 Bacteria 1258
307 Ga0207647_10009890 3300025904 Bacteria 6755
308 Ga0207647_10015550 3300025904 Bacteria 5214
309 Ga0207647_10149812 3300025904 Bacteria 1364
310 Ga0207699_10007510 3300025906 Bacteria 5333
311 Ga0207645_10019613 3300025907 Bacteria 4432
312 Ga0207705_10138964 3300025909 Bacteria 1813
313 Ga0207654_10075474 3300025911 Bacteria 2015
314 Ga0207695_10147766 3300025913 Bacteria 2292
315 Ga0207671_10032373 3300025914 Bacteria 3893
316 Ga0207671_10118463 3300025914 Bacteria 2022
317 Ga0207671_10187119 3300025914 Bacteria 1613
318 Ga0207671_10334587 3300025914 Bacteria 1199
319 Ga0207693_10162802 3300025915 Bacteria 1756
320 Ga0207660_10118213 3300025917 Bacteria 2005
321 Ga0207657_10105467 3300025919 Bacteria 2333
322 Ga0207657_10135462 3300025919 Bacteria 2016
323 Ga0207652_10515267 3300025921 Bacteria 1076
324 Ga0207650_10255069 3300025925 Bacteria 1421
325 Ga0207690_10259193 3300025932 Bacteria 1346
326 Ga0207670_10001231 3300025936 Bacteria 13520
327 Ga0207670_10460986 3300025936 Bacteria 1026
328 Ga0207669_10141686 3300025937 Bacteria 1670
329 Ga0207704_10086021 3300025938 Bacteria 2049
330 Ga0207711_10116001 3300025941 Bacteria 2387
331 Ga0207711_10153095 3300025941 Bacteria 2082
332 Ga0207679_10109678 3300025945 Bacteria 2175
333 Ga0207668_10004893 3300025972 Bacteria 7880
334 Ga0207668_10023824 3300025972 Bacteria 3941
335 Ga0207668_10096720 3300025972 Bacteria 2183
336 Ga0207668_10146336 3300025972 Bacteria 1823
337 Ga0207658_10208395 3300025986 Bacteria 1637
338 Ga0207658_10329177 3300025986 Bacteria 1324
339 Ga0207678_10000100 3300026067 Bacteria 70537
340 Ga0207702_10446584 3300026078 Bacteria 1254
341 Ga0207702_10863996 3300026078 Bacteria 896
342 Ga0207648_10216168 3300026089 Bacteria 1702
343 Ga0207676_10007593 3300026095 Bacteria 7698
344 Ga0207674_10106290 3300026116 Bacteria 2784
345 Ga0207675_100031839 3300026118 Bacteria 4913
346 Ga0207675_100305961 3300026118 Bacteria 1549
347 Ga0207683_10025771 3300026121 Bacteria 5072
348 Ga0207683_10111605 3300026121 Bacteria 2448
349 Ga0207698_10630914 3300026142 Bacteria 1059
350 Ga0207698_10678705 3300026142 Bacteria 1023
351 Ga0209281_1000227 3300027111 Bacteria 119329
352 Ga0209281_1000519 3300027111 Bacteria 50062
353 Ga0209371_1000009 3300027312 Bacteria 963030
354 Ga0209371_1000547 3300027312 Bacteria 35249
355 Ga0209282_1000042 3300027666 Bacteria 119329
356 Ga0209282_1000224 3300027666 Bacteria 29523
357 Ga0209282_1003866 3300027666 Bacteria 8997
358 Ga0209813_10000358 3300027866 Bacteria 11644
359 Ga0209813_10012420 3300027866 Bacteria 2251
360 Ga0209813_10021450 3300027866 Bacteria 1816
361 Ga0268266_10003101 3300028379 Bacteria 16931
362 Ga0268266_10006291 3300028379 Bacteria 10886
363 Ga0268266_10015355 3300028379 Bacteria 6572
364 Ga0268266_10515040 3300028379 Bacteria 1143
365 Ga0268266_10801064 3300028379 Bacteria 910
366 Ga0268265_10002598 3300028380 Bacteria 13459
367 Ga0268265_10039627 3300028380 Bacteria 3474
368 Ga0268265_10272616 3300028380 Bacteria 1510
369 Ga0268264_10000055 3300028381 Bacteria 314947
370 Ga0268264_10033405 3300028381 Bacteria 4226
371 Ga0268264_10051148 3300028381 Bacteria 3442
372 Ga0268264_10462787 3300028381 Bacteria 1231
373 Ga0265318_10143745 3300028577 Bacteria 875
374 Ga0307515_10000023 3300028794 Bacteria 400846
375 Ga0307515_10004227 3300028794 Bacteria 29832
376 Ga0268256_1000010 3300030500 Bacteria 963034
377 Ga0268256_1016656 3300030500 Bacteria 2096
378 Ga0265770_1017861 3300030878 Bacteria 1100
379 Ga0265330_10083083 3300031235 Bacteria 1379
380 Ga0265328_10010982 3300031239 Bacteria 3630
381 Ga0265328_10016074 3300031239 Bacteria 2918
382 Ga0265325_10002414 3300031241 Bacteria 12620
383 Ga0265325_10003327 3300031241 Bacteria 10569
384 Ga0265329_10062820 3300031242 Bacteria 1175
385 Ga0265340_10012328 3300031247 Bacteria 4516
386 Ga0265340_10044194 3300031247 Bacteria 2180
387 Ga0265340_10045406 3300031247 Bacteria 2146
388 Ga0265340_10064914 3300031247 Bacteria 1739
389 Ga0265339_10040311 3300031249 Bacteria 2596
390 Ga0265331_10003656 3300031250 Bacteria 9815
391 Ga0265327_10001660 3300031251 Bacteria 26802
392 Ga0265327_10015085 3300031251 Bacteria 5012
393 Ga0265316_10031264 3300031344 Bacteria 4355
394 Ga0265316_10040084 3300031344 Bacteria 3757
395 Ga0265316_10057891 3300031344 Bacteria 3020
396 Ga0265316_10059448 3300031344 Bacteria 2972
397 Ga0307513_10006014 3300031456 Bacteria 15931
398 Ga0307513_10016341 3300031456 Bacteria 8958
399 Ga0307513_10192335 3300031456 Bacteria 1890
400 Ga0265313_10003820 3300031595 Bacteria 11894
401 Ga0265313_10029972 3300031595 Bacteria 2807
402 Ga0265314_10010850 3300031711 Bacteria 7572
403 Ga0265314_10036703 3300031711 Bacteria 3558
404 Ga0265342_10018121 3300031712 Bacteria 4568
405 Ga0265342_10084702 3300031712 Bacteria 1825
406 Ga0265342_10207728 3300031712 Bacteria 1060
407 Ga0307405_10015383 3300031731 Bacteria 4144
408 Ga0307413_10183526 3300031824 Bacteria 1494
409 Ga0307406_10046275 3300031901 Bacteria 2737
410 Ga0307412_10027331 3300031911 Bacteria 3556
411 Ga0307412_10078925 3300031911 Bacteria 2269
412 Ga0307412_10150819 3300031911 Bacteria 1715
413 Ga0315914_1000009 3300031967 Bacteria 182444
414 Ga0307409_100529568 3300031995 Bacteria 1153
415 Ga0307416_100603293 3300032002 Bacteria 1178
416 Ga0307414_10287044 3300032004 Bacteria 1385
417 Ga0307415_100510670 3300032126 Bacteria 1053
418 Ga0315913_1000015 3300033430 Bacteria 119325
419 Ga0315915_1000013 3300033464 Bacteria 182438
420 Ga0373930_0011195 3300034816 Bacteria 1617
421 Ga0373928_0032115 3300035084 Bacteria 1169
422 Ga0373951_0007101 3300035091 Bacteria 2548
423 Ga0373941_0147295 3300035115 Bacteria 861
424 Ga0373943_0000613 3300035170 Bacteria 15479
425 Ga0373931_0070810 3300035691 Bacteria 1903
426 Ga0373935_0005946 3300035692 Bacteria 7237
427 Ga0373927_0000806 3300035695 Bacteria 23954
428 Ga0373947_0000256 3300035725 Bacteria 29989
429 Ga0373947_0346379 3300035725 Bacteria 996
430 Ga0373925_0013258 3300037068 Bacteria 5965
431 Ga0395899_0000014 3300037312 Bacteria 488813
432 Ga0395900_0000007 3300037418 Bacteria 488860
433 Ga0395898_0000011 3300037466 Bacteria 488860
434 Ga0395905_0000008 3300037471 Bacteria 488860
435 Ga0395905_0011842 3300037471 Bacteria 8419
436 Ga0395905_0464233 3300037471 Bacteria 1165
437 Ga0436364_0053004 3300037853 Bacteria 3170
438 Ga0436364_0207431 3300037853 Bacteria 52858
439 Ga0436364_0563011 3300037853 Bacteria 1123
440 Ga0436364_0628381 3300037853 Bacteria 2046
441 Ga0395901_0000020 3300038443 Bacteria 314918
442 Ga0395901_0027330 3300038443 Bacteria 5861
443 Ga0395901_0027701 3300038443 Bacteria 5826
444 Ga0436365_0289217 3300039437 Bacteria 4910
445 Ga0439438_036258 3300041405 Bacteria 1294
446 Ga0439465_0001471 3300041413 Bacteria 7635
447 Ga0439465_0004192 3300041413 Bacteria 4690
448 Ga0439465_0031347 3300041413 Bacteria 1693
449 Ga0439465_0053697 3300041413 Bacteria 1324
450 Ga0451787_397122 3300041441 Bacteria 1529
451 Ga0451807_0622738 3300041486 Bacteria 1282
452 Ga0451837_1340741 3300041494 Bacteria 1512
453 Ga0451839_1498607 3300041496 Bacteria 1125
454 Ga0451841_1101904 3300041498 Bacteria 886
455 Ga0451845_0022414 3300041501 Bacteria 2111
456 Ga0451851_0106610 3300041507 Bacteria 1084
457 Ga0451843_0615050 3300041509 Bacteria 1756
458 Ga0451843_1153044 3300041509 Bacteria 889
459 Ga0451853_4116506 3300041512 Bacteria 1047
460 Ga0439432_022899 3300042006 Bacteria 2062
461 Ga0439432_034204 3300042006 Bacteria 1633
462 Ga0439449_0100599 3300042007 Bacteria 1069
463 Ga0439457_020608 3300042014 Bacteria 1463
464 Ga0450920_028507 3300042122 Bacteria 1094
465 Ga0450906_029462 3300042145 Bacteria 970
466 Ga0439434_0073404 3300042435 Bacteria 1079
467 Ga0450918_001536 3300042531 Bacteria 4555
468 Ga0451577_0048226 3300042876 Bacteria 3806
469 Ga0466965_0240164 3300044683 Bacteria 970
470 Ga0466960_0003639 3300044901 Bacteria 5950
471 Ga0451576_0000457 3300045051 Bacteria 92619
472 Ga0451576_0639612 3300045051 Bacteria 1118
473 Ga0495627_083255 3300046453 Bacteria 925
474 Ga0495638_0022249 3300046460 Bacteria 4163
475 Ga0495638_0023748 3300046460 Bacteria 4005
476 Ga0495638_0099707 3300046460 Bacteria 1738
477 Ga0495638_0131159 3300046460 Bacteria 1472
478 Ga0495650_0034324 3300046471 Bacteria 2247
479 Ga0495580_0044198 3300046472 Bacteria 3170
480 Ga0495605_0128815 3300046474 Bacteria 1142
481 Ga0495585_0004077 3300046492 Bacteria 9595
482 Ga0495585_0025667 3300046492 Bacteria 3372
483 Ga0495585_0151849 3300046492 Bacteria 1207
484 Ga0495596_0059795 3300046500 Bacteria 1485
485 Ga0495607_0033186 3300046501 Bacteria 3142
486 Ga0495583_0001709 3300046506 Bacteria 21089
487 Ga0495583_0015869 3300046506 Bacteria 4076
488 Ga0495583_0039945 3300046506 Bacteria 2207
489 Ga0495610_0001297 3300046512 Bacteria 22270
490 Ga0495610_0013489 3300046512 Bacteria 4854
491 Ga0495616_0016614 3300046513 Bacteria 4070
492 Ga0495616_0046111 3300046513 Bacteria 2202
493 Ga0495616_0123801 3300046513 Bacteria 1191
494 Ga0495618_0181186 3300046514 Bacteria 1338
495 Ga0495620_0016232 3300046515 Bacteria 3743
496 Ga0495620_0019139 3300046515 Bacteria 3375
497 Ga0495630_0004618 3300046517 Bacteria 9656
498 Ga0495631_0000651 3300046518 Bacteria 22509
499 Ga0495631_0103618 3300046518 Bacteria 1224
500 Ga0495632_0015871 3300046519 Bacteria 4206
501 Ga0495632_0028828 3300046519 Bacteria 2896
502 Ga0495643_0053111 3300046522 Bacteria 2173
503 Ga0495648_0027504 3300046524 Bacteria 3805
504 Ga0495648_0047779 3300046524 Bacteria 2642
505 Ga0495666_0012120 3300046526 Bacteria 4304
506 Ga0495654_0001032 3300046530 Bacteria 20404
507 Ga0495654_0079010 3300046530 Bacteria 1546
508 Ga0495654_0113723 3300046530 Bacteria 1232
509 Ga0495665_0042485 3300046531 Bacteria 2419
510 Ga0495640_0123195 3300046533 Bacteria 1683
511 Ga0495609_0058088 3300046538 Bacteria 1711
512 Ga0495597_0031888 3300046542 Bacteria 2394
513 Ga0495633_0060660 3300046558 Bacteria 1772
514 Ga0495668_0003018 3300046616 Bacteria 13127
515 Ga0495668_0017367 3300046616 Bacteria 4174
516 Ga0495668_0031652 3300046616 Bacteria 2981
517 Ga0495611_0095065 3300046648 Bacteria 1379
518 Ga0495625_0001384 3300046660 Bacteria 29779
519 Ga0495625_0017986 3300046660 Bacteria 5524
520 Ga0495625_0064023 3300046660 Bacteria 2595
521 Ga0495625_0113690 3300046660 Bacteria 1848
522 Ga0495625_0243837 3300046660 Bacteria 1169
523 Ga0495661_0216745 3300046665 Bacteria 994
524 Ga0495588_0002043 3300046674 Bacteria 8626
525 Ga0495588_0137928 3300046674 Bacteria 1288
526 Ga0495658_0047318 3300046683 Bacteria 2422
527 Ga0495624_0007453 3300046690 Bacteria 7678
528 Ga0495671_0041827 3300046692 Bacteria 2306
529 Ga0495660_0023466 3300046810 Bacteria 3517
530 Ga0495660_0029351 3300046810 Bacteria 3104
531 Ga0495672_0024115 3300047320 Bacteria 3926
532 Ga0495687_019134 3300047443 Bacteria 3367
533 Ga0495673_0033885 3300047469 Bacteria 2365
534 Ga0495681_0017611 3300047470 Bacteria 3959
535 Ga0495684_0005376 3300047471 Bacteria 9971
536 Ga0495684_0007110 3300047471 Bacteria 8688
537 Ga0495686_0005372 3300047472 Bacteria 10128
538 Ga0495686_0031564 3300047472 Bacteria 3435
539 Ga0495686_0035111 3300047472 Bacteria 3225
540 Ga0495686_0213673 3300047472 Bacteria 1101
541 Ga0495593_0031816 3300047673 Bacteria 2879
542 Ga0495615_0042369 3300048090 Bacteria 1142
543 Ga0496100_0011359 3300048903 Bacteria 5067
544 Ga0496101_0013345 3300048904 Bacteria 5500
545 Ga0496101_0036946 3300048904 Bacteria 3462
546 Ga0496101_0051851 3300048904 Bacteria 2957
547 Ga0496101_0215314 3300048904 Bacteria 1489
548 Ga0496102_0007685 3300048905 Bacteria 9209
549 Ga0496102_0152186 3300048905 Bacteria 2174
550 Ga0496102_0191113 3300048905 Bacteria 1929
551 Ga0496103_0025599 3300048906 Bacteria 3567
552 Ga0496103_0209709 3300048906 Bacteria 1253
553 Ga0496104_0057690 3300048907 Bacteria 3674
554 Ga0496104_0445266 3300048907 Bacteria 1207
555 Ga0496105_0000392 3300048908 Bacteria 28815
556 Ga0496106_0021532 3300048909 Bacteria 4787
557 Ga0496106_0070794 3300048909 Bacteria 2664
558 Ga0496106_0214127 3300048909 Bacteria 1535
559 Ga0496106_0409951 3300048909 Bacteria 1089
560 Ga0496107_0032993 3300048910 Bacteria 3703
561 Ga0496108_0001992 3300048911 Bacteria 16351
562 Ga0496109_0012017 3300048912 Bacteria 7456
563 Ga0496110_0122735 3300048913 Bacteria 2342
564 Ga0496111_0001116 3300048914 Bacteria 14864
565 Ga0496111_0022364 3300048914 Bacteria 4426
566 Ga0496112_0002870 3300048915 Bacteria 14007
567 Ga0496112_0025119 3300048915 Bacteria 5717
568 Ga0496112_0042420 3300048915 Bacteria 4451
569 Ga0496113_0004045 3300048916 Bacteria 8930
570 Ga0496113_0080376 3300048916 Bacteria 2497
571 Ga0496113_0149293 3300048916 Bacteria 1843
572 Ga0496113_0280657 3300048916 Bacteria 1332
573 Ga0496114_0084239 3300048917 Bacteria 2691
574 Ga0496114_0152441 3300048917 Bacteria 2006
575 Ga0496115_0006960 3300048918 Bacteria 8305
576 Ga0496115_0050412 3300048918 Bacteria 3335
577 Ga0496115_0120401 3300048918 Bacteria 2160
578 Ga0496116_0001443 3300048919 Bacteria 26678
579 Ga0496116_0002283 3300048919 Bacteria 20327
580 Ga0496116_0018419 3300048919 Bacteria 5385
581 Ga0496116_0050161 3300048919 Bacteria 2783
582 Ga0496116_0055920 3300048919 Bacteria 2589
583 Ga0496116_0188455 3300048919 Bacteria 1095
584 Ga0496117_0000002 3300048920 Bacteria 2483758
585 Ga0496117_0004761 3300048920 Bacteria 14728
586 Ga0496117_0005892 3300048920 Bacteria 12664
587 Ga0496117_0047517 3300048920 Bacteria 3076
588 Ga0496117_0052840 3300048920 Bacteria 2859
589 Ga0496117_0104866 3300048920 Bacteria 1778
590 Ga0496118_0000233 3300048921 Bacteria 97731
591 Ga0496118_0007687 3300048921 Bacteria 11337
592 Ga0496118_0029929 3300048921 Bacteria 4556
593 Ga0496118_0038968 3300048921 Bacteria 3800
594 Ga0496119_0001089 3300048922 Bacteria 34251
595 Ga0496119_0018827 3300048922 Bacteria 5116
596 Ga0496119_0020869 3300048922 Bacteria 4755
597 Ga0496119_0061517 3300048922 Bacteria 2241
598 Ga0496119_0062517 3300048922 Bacteria 2218
599 Ga0496119_0204399 3300048922 Bacteria 1020
600 Ga0496120_0000021 3300048923 Bacteria 250966
601 Ga0496120_0009069 3300048923 Bacteria 7105
602 Ga0496120_0184618 3300048923 Bacteria 1021
603 Ga0496121_0004125 3300048924 Bacteria 19907
604 Ga0496121_0021858 3300048924 Bacteria 6246
605 Ga0496121_0063365 3300048924 Bacteria 3021
606 Ga0496121_0143804 3300048924 Bacteria 1765
607 Ga0496121_0194844 3300048924 Bacteria 1449
608 Ga0496121_0215073 3300048924 Bacteria 1358
609 Ga0496121_0281058 3300048924 Bacteria 1138
610 Ga0496121_0285018 3300048924 Bacteria 1128
611 Ga0496122_0000001 3300048925 Bacteria 1827766
612 Ga0496122_0001050 3300048925 Bacteria 48341
613 Ga0496122_0002105 3300048925 Bacteria 29496
614 Ga0496122_0002628 3300048925 Bacteria 25114
615 Ga0496122_0013396 3300048925 Bacteria 8030
616 Ga0496122_0031795 3300048925 Bacteria 4381
617 Ga0496122_0032728 3300048925 Bacteria 4293
618 Ga0496122_0046656 3300048925 Bacteria 3352
619 Ga0496122_0047999 3300048925 Bacteria 3289
620 Ga0496122_0219559 3300048925 Bacteria 1092
621 Ga0496123_0000001 3300048926 Bacteria 1831497
622 Ga0496123_0000158 3300048926 Bacteria 136078
623 Ga0496123_0002010 3300048926 Bacteria 26259
624 Ga0496123_0005487 3300048926 Bacteria 12754
625 Ga0496123_0016492 3300048926 Bacteria 5996
626 Ga0496123_0017583 3300048926 Bacteria 5741
627 Ga0496123_0053756 3300048926 Bacteria 2658
628 Ga0496124_0000743 3300048927 Bacteria 53428
629 Ga0496124_0003963 3300048927 Bacteria 17651
630 Ga0496124_0011436 3300048927 Bacteria 8874
631 Ga0496124_0015389 3300048927 Bacteria 7332
632 Ga0496124_0034825 3300048927 Bacteria 4412
633 Ga0496124_0041399 3300048927 Bacteria 3975
634 Ga0496124_0049494 3300048927 Bacteria 3585
635 Ga0496124_0069924 3300048927 Bacteria 2913
636 Ga0496124_0261566 3300048927 Bacteria 1273
637 Ga0496125_0000695 3300048928 Bacteria 55563
638 Ga0496125_0013510 3300048928 Bacteria 8022
639 Ga0496125_0016113 3300048928 Bacteria 7192
640 Ga0496125_0021027 3300048928 Bacteria 6100
641 Ga0496125_0041633 3300048928 Bacteria 3924
642 Ga0496125_0074229 3300048928 Bacteria 2638
643 Ga0496125_0282926 3300048928 Bacteria 1026
644 Ga0496126_0000195 3300048929 Bacteria 135582
645 Ga0496126_0086852 3300048929 Bacteria 2757
646 Ga0496126_0455450 3300048929 Bacteria 1029
647 Ga0495678_011095 3300049459 Bacteria 4330
648 Ga0495678_027883 3300049459 Bacteria 2390
649 Ga0495678_077409 3300049459 Bacteria 1203
650 Ga0501031_0000003 3300049568 Bacteria 206821
651 Ga0501031_0123922 3300049568 Bacteria 1688
652 Ga0501031_0169540 3300049568 Bacteria 1426
653 Ga0501031_0217196 3300049568 Bacteria 1245
654 Ga0501032_0000010 3300049569 Bacteria 206795
655 Ga0501032_0000587 3300049569 Bacteria 29296
656 Ga0501032_0012946 3300049569 Bacteria 5944
657 Ga0501032_0028404 3300049569 Bacteria 3844
658 Ga0501032_0049889 3300049569 Bacteria 2823
659 Ga0501032_0068127 3300049569 Bacteria 2376
660 Ga0501032_0081072 3300049569 Bacteria 2159
661 Ga0501032_0097643 3300049569 Bacteria 1947
662 Ga0501033_0000017 3300049570 Bacteria 206819
663 Ga0501033_0000076 3300049570 Bacteria 93921
664 Ga0501033_0000521 3300049570 Bacteria 36032
665 Ga0501033_0003783 3300049570 Bacteria 12302
666 Ga0501033_0005881 3300049570 Bacteria 9639
667 Ga0501033_0011725 3300049570 Bacteria 6703
668 Ga0501033_0016419 3300049570 Bacteria 5608
669 Ga0501033_0141001 3300049570 Bacteria 1742
670 Ga0501033_0223152 3300049570 Bacteria 1341
671 Ga0501033_0236443 3300049570 Bacteria 1297
672 Ga0501033_0244080 3300049570 Bacteria 1274
673 Ga0501033_0396228 3300049570 Bacteria 963
674 Ga0501034_0000053 3300049571 Bacteria 206821
675 Ga0501034_0000077 3300049571 Bacteria 173873
676 Ga0501034_0001873 3300049571 Bacteria 26689
677 Ga0501034_0008667 3300049571 Bacteria 10724
678 Ga0501034_0009703 3300049571 Bacteria 10066
679 Ga0501034_0050206 3300049571 Bacteria 4207
680 Ga0501034_0058149 3300049571 Bacteria 3886
681 Ga0501034_0087591 3300049571 Bacteria 3113
682 Ga0501034_0136949 3300049571 Bacteria 2429
683 Ga0501034_0148265 3300049571 Bacteria 2322
684 Ga0501034_0166741 3300049571 Bacteria 2171
685 Ga0501034_0224552 3300049571 Bacteria 1829
686 Ga0501034_0353748 3300049571 Bacteria 1397
687 Ga0501034_0386069 3300049571 Bacteria 1325
688 Ga0501034_0423857 3300049571 Bacteria 1251
689 Ga0501034_0479686 3300049571 Bacteria 1159
690 Ga0501034_0562339 3300049571 Bacteria 1049
691 Ga0501036_0000009 3300049572 Bacteria 206821
692 Ga0501036_0002844 3300049572 Bacteria 13723
693 Ga0501036_0028303 3300049572 Bacteria 4736
694 Ga0501036_0030433 3300049572 Bacteria 4559
695 Ga0501036_0036991 3300049572 Bacteria 4129
696 Ga0501036_0084228 3300049572 Bacteria 2688
697 Ga0501036_0109061 3300049572 Bacteria 2339
698 Ga0501036_0146725 3300049572 Bacteria 1990
699 Ga0501036_0164430 3300049572 Bacteria 1871
700 Ga0501036_0165501 3300049572 Bacteria 1864
701 Ga0501037_0000008 3300049573 Bacteria 206812
702 Ga0501037_0000224 3300049573 Bacteria 49243
703 Ga0501037_0000812 3300049573 Bacteria 23359
704 Ga0501037_0002684 3300049573 Bacteria 12837
705 Ga0501037_0019672 3300049573 Bacteria 4981
706 Ga0501037_0062874 3300049573 Bacteria 2706
707 Ga0501037_0129370 3300049573 Bacteria 1811
708 Ga0501037_0189083 3300049573 Bacteria 1458
709 Ga0501038_0000008 3300049574 Bacteria 206821
710 Ga0501038_0000241 3300049574 Bacteria 46177
711 Ga0501038_0109237 3300049574 Bacteria 2292
712 Ga0501038_0131033 3300049574 Bacteria 2059
713 Ga0501038_0154162 3300049574 Bacteria 1871
714 Ga0501038_0277545 3300049574 Bacteria 1320
715 Ga0501038_0442920 3300049574 Bacteria 1000
716 Ga0501039_0000021 3300049575 Bacteria 162552
717 Ga0501039_0000131 3300049575 Bacteria 52205
718 Ga0501039_0000196 3300049575 Bacteria 43498
719 Ga0501039_0319359 3300049575 Bacteria 1221
720 Ga0501039_0342868 3300049575 Bacteria 1174
721 Ga0501040_0003914 3300049576 Bacteria 9662
722 Ga0501040_0074137 3300049576 Bacteria 2352
723 Ga0501040_0271701 3300049576 Bacteria 1210
724 Ga0501041_0087680 3300049577 Bacteria 1921
725 Ga0501042_0011075 3300049578 Bacteria 6074
726 Ga0501042_0304709 3300049578 Bacteria 1151
727 Ga0501043_0000005 3300049579 Bacteria 254466
728 Ga0501043_0000043 3300049579 Bacteria 115410
729 Ga0501043_0000405 3300049579 Bacteria 38778
730 Ga0501043_0010702 3300049579 Bacteria 7186
731 Ga0501043_0210303 3300049579 Bacteria 1508
732 Ga0501043_0372383 3300049579 Bacteria 1082
733 Ga0501043_0379472 3300049579 Bacteria 1070
734 Ga0501046_0001156 3300049580 Bacteria 25669
735 Ga0501046_0026209 3300049580 Bacteria 4762
736 Ga0501046_0038328 3300049580 Bacteria 3848
737 Ga0501047_0000129 3300049581 Bacteria 91572
738 Ga0501047_0000894 3300049581 Bacteria 30442
739 Ga0501047_0005104 3300049581 Bacteria 12319
740 Ga0501047_0020856 3300049581 Bacteria 6294
741 Ga0501047_0030968 3300049581 Bacteria 5158
742 Ga0501047_0046886 3300049581 Bacteria 4175
743 Ga0501047_0049610 3300049581 Bacteria 4053
744 Ga0501047_0052545 3300049581 Bacteria 3939
745 Ga0501047_0056209 3300049581 Bacteria 3805
746 Ga0501047_0087523 3300049581 Bacteria 2992
747 Ga0501047_0212705 3300049581 Bacteria 1791
748 Ga0501047_0481443 3300049581 Bacteria 1069
749 Ga0501047_0686654 3300049581 Bacteria 842
750 Ga0501048_0000282 3300049582 Bacteria 34461
751 Ga0501048_0004455 3300049582 Bacteria 10658
752 Ga0501048_0020443 3300049582 Bacteria 4852
753 Ga0501067_0000213 3300049583 Bacteria 32191
754 Ga0501067_0001197 3300049583 Bacteria 14101
755 Ga0501067_0028159 3300049583 Bacteria 3112
756 Ga0501067_0036197 3300049583 Bacteria 2741
757 Ga0501067_0042891 3300049583 Bacteria 2512
758 Ga0501067_0045622 3300049583 Bacteria 2433
759 Ga0501068_0005249 3300049584 Bacteria 7072
760 Ga0501068_0027596 3300049584 Bacteria 3353
761 Ga0501069_0000011 3300049585 Bacteria 153214
762 Ga0501069_0025402 3300049585 Bacteria 3238
763 Ga0501069_0055908 3300049585 Bacteria 2198
764 Ga0501069_0076670 3300049585 Bacteria 1880
765 Ga0501069_0159404 3300049585 Bacteria 1299
766 Ga0501069_0196147 3300049585 Bacteria 1169
767 Ga0501069_0367186 3300049585 Bacteria 849
768 Ga0501070_0000117 3300049586 Bacteria 70793
769 Ga0501070_0001936 3300049586 Bacteria 18277
770 Ga0501070_0004936 3300049586 Bacteria 11386
771 Ga0501070_0005238 3300049586 Bacteria 11055
772 Ga0501070_0006463 3300049586 Bacteria 9977
773 Ga0501070_0107545 3300049586 Bacteria 2305
774 Ga0501070_0120810 3300049586 Bacteria 2165
775 Ga0501070_0136845 3300049586 Bacteria 2022
776 Ga0501071_0005058 3300049587 Bacteria 8437
777 Ga0501071_0238175 3300049587 Bacteria 1372
778 Ga0501072_0386210 3300049588 Bacteria 1111
779 Ga0501072_0503666 3300049588 Bacteria 958
780 Ga0501073_0011311 3300049589 Bacteria 6530
781 Ga0501073_0015653 3300049589 Bacteria 5500
782 Ga0501073_0027903 3300049589 Bacteria 4034
783 Ga0501073_0067096 3300049589 Bacteria 2501
784 Ga0501073_0073448 3300049589 Bacteria 2381
785 Ga0501073_0096224 3300049589 Bacteria 2056
786 Ga0501073_0100118 3300049589 Bacteria 2012
787 Ga0501073_0146464 3300049589 Bacteria 1636
788 Ga0501073_0176648 3300049589 Bacteria 1478
789 Ga0501073_0197845 3300049589 Bacteria 1390
790 Ga0501073_0256299 3300049589 Bacteria 1208
791 Ga0501073_0425378 3300049589 Bacteria 918
792 Ga0501074_0002555 3300049590 Bacteria 12701
793 Ga0501074_0016136 3300049590 Bacteria 5428
794 Ga0501074_0033856 3300049590 Bacteria 3704
795 Ga0501075_0171117 3300049591 Bacteria 1657
796 Ga0501076_0008864 3300049592 Bacteria 7398
797 Ga0501076_0070351 3300049592 Bacteria 2797
798 Ga0501077_0043446 3300049593 Bacteria 2856
799 Ga0501079_0337543 3300049741 Bacteria 1180
800 Ga0501080_0000053 3300049742 Bacteria 74409
801 Ga0501080_0005693 3300049742 Bacteria 11145
802 Ga0501080_0014905 3300049742 Bacteria 7157
803 Ga0501080_0018576 3300049742 Bacteria 6434
804 Ga0501080_0050494 3300049742 Bacteria 3871
805 Ga0501080_0065574 3300049742 Bacteria 3377
806 Ga0501080_0071736 3300049742 Bacteria 3221
807 Ga0501080_0077400 3300049742 Bacteria 3093
808 Ga0501080_0455512 3300049742 Bacteria 1146
809 Ga0501080_0525103 3300049742 Bacteria 1056
810 Ga0501081_0003348 3300049743 Bacteria 10196
811 Ga0501081_0262315 3300049743 Bacteria 1263
812 Ga0501083_0000406 3300049744 Bacteria 27431
813 Ga0501083_0017663 3300049744 Bacteria 4973
814 Ga0501083_0090776 3300049744 Bacteria 2017
815 Ga0501083_0181102 3300049744 Bacteria 1376
816 Ga0501280_003795 3300049776 Bacteria 2278
817 Ga0501035_0000010 3300049822 Bacteria 309349
818 Ga0501035_0000023 3300049822 Bacteria 206821
819 Ga0501035_0000107 3300049822 Bacteria 103130
820 Ga0501035_0000449 3300049822 Bacteria 46083
821 Ga0501035_0001177 3300049822 Bacteria 27251
822 Ga0501035_0003419 3300049822 Bacteria 15188
823 Ga0501035_0003519 3300049822 Bacteria 14970
824 Ga0501035_0007710 3300049822 Bacteria 10052
825 Ga0501035_0065014 3300049822 Bacteria 3241
826 Ga0501035_0156239 3300049822 Bacteria 1977
827 Ga0501035_0342862 3300049822 Bacteria 1251
828 Ga0501035_0469443 3300049822 Bacteria 1039
829 Ga0501044_0000006 3300049823 Bacteria 291413
830 Ga0501044_0000021 3300049823 Bacteria 206821
831 Ga0501044_0000154 3300049823 Bacteria 85407
832 Ga0501044_0008423 3300049823 Bacteria 11307
833 Ga0501044_0010150 3300049823 Bacteria 10235
834 Ga0501044_0032199 3300049823 Bacteria 5513
835 Ga0501044_0036530 3300049823 Bacteria 5140
836 Ga0501044_0053659 3300049823 Bacteria 4146
837 Ga0501044_0085982 3300049823 Bacteria 3177
838 Ga0501044_0087274 3300049823 Bacteria 3151
839 Ga0501044_0091619 3300049823 Bacteria 3066
840 Ga0501044_0098638 3300049823 Bacteria 2941
841 Ga0501044_0126201 3300049823 Bacteria 2556
842 Ga0501044_0280465 3300049823 Bacteria 1600
843 Ga0501045_0007088 3300049824 Bacteria 7770
844 Ga0501045_0140475 3300049824 Bacteria 1796
845 Ga0501045_0141357 3300049824 Bacteria 1790
846 nmdc:mga03683_51889_c1 3300050489 Bacteria 1713
847 nmdc:mga03683_91461_c1 3300050489 Bacteria 1327
848 nmdc:mga03n38_3995_c1 3300050490 Bacteria 4818
849 nmdc:mga00v17_132932_c1 3300050491 Bacteria 1591
850 nmdc:mga00v17_211366_c1 3300050491 Bacteria 1255
851 nmdc:mga00v17_3192_c1 3300050491 Bacteria 8448
852 nmdc:mga00v17_72_c1 3300050491 Bacteria 60922
853 nmdc:mga0yw44_166453_c1 3300050492 Bacteria 1446
854 nmdc:mga0yw44_1917_c1 3300050492 Bacteria 8593
855 nmdc:mga0yw44_96982_c1 3300050492 Bacteria 1872
856 nmdc:mga0k408_37840_c1 3300050493 Bacteria 2770
857 nmdc:mga0k408_68174_c1 3300050493 Bacteria 2075
858 nmdc:mga0k408_82874_c1 3300050493 Bacteria 1880
859 nmdc:mga06z11_11753_c1 3300050494 Bacteria 3786
860 nmdc:mga06z11_260156_c1 3300050494 Bacteria 1024
861 nmdc:mga06z11_52758_c1 3300050494 Bacteria 2088
862 nmdc:mga06z11_62571_c1 3300050494 Bacteria 1944
863 nmdc:mga06z11_91541_c1 3300050494 Bacteria 1652
864 nmdc:mga04h51_11247_c1 3300050495 Bacteria 2480
865 nmdc:mga04h51_56754_c1 3300050495 Bacteria 1330
866 nmdc:mga07m45_123910_c1 3300050496 Bacteria 1109
867 nmdc:mga07m45_50268_c1 3300050496 Bacteria 2349
868 nmdc:mga0rr50_41028_c1 3300050513 Bacteria 3369
869 nmdc:mga08x19_22_c1 3300050514 Bacteria 297462
870 nmdc:mga0sz30_119851_c1 3300050516 Bacteria 1156
871 nmdc:mga0sz30_13611_c1 3300050516 Bacteria 3188
872 nmdc:mga0sz30_175615_c1 3300050516 Bacteria 950
873 nmdc:mga0sz30_26730_c1 3300050516 Bacteria 2367
874 nmdc:mga0sz30_609_c1 3300050516 Bacteria 13266
875 Ga0500610_0064816 3300053079 Bacteria 1906
876 Ga0495619_0105390 3300053085 Bacteria 1922
877 Ga0500578_0109792 3300053086 Bacteria 1739
878 Ga0500651_0167214 3300053093 Bacteria 1313
879 Ga0500556_0000033 3300053104 Bacteria 147801
880 Ga0500560_018504 3300053107 Bacteria 1943
881 Ga0500569_001278 3300053109 Bacteria 4689
882 Ga0500569_021263 3300053109 Bacteria 1713
883 Ga0500594_0002582 3300053118 Bacteria 3934
884 Ga0500618_001151 3300053125 Bacteria 12825
885 Ga0500642_0019133 3300053130 Bacteria 2665
886 Ga0500658_0000230 3300053134 Bacteria 26381
887 Ga0500658_0141410 3300053134 Bacteria 1080
888 Ga0500561_0000123 3300053137 Bacteria 14866
889 Ga0500568_0000205 3300053139 Bacteria 51687
890 Ga0500568_0000924 3300053139 Bacteria 20259
891 Ga0500568_0004782 3300053139 Bacteria 7160
892 Ga0500568_0066844 3300053139 Bacteria 1382
893 Ga0500573_0007042 3300053140 Bacteria 6113
894 Ga0500604_0050123 3300053151 Bacteria 1286
895 Ga0500616_0002449 3300053153 Bacteria 15425
896 Ga0500616_0017030 3300053153 Bacteria 4127
897 Ga0500616_0068987 3300053153 Bacteria 1809
898 Ga0500616_0080810 3300053153 Bacteria 1634
899 Ga0500620_029555 3300053155 Bacteria 1723
900 Ga0500622_0001035 3300053156 Bacteria 23258
901 Ga0500622_0132185 3300053156 Bacteria 1198
902 Ga0500624_000320 3300053157 Bacteria 16425
903 Ga0500627_0052506 3300053158 Bacteria 1779
904 Ga0500627_0101530 3300053158 Bacteria 1291
905 Ga0500633_0009280 3300053160 Bacteria 2579
906 Ga0501084_0238511 3300054114 Bacteria 1535
907 Ga0501084_0453913 3300054114 Bacteria 1083
908 Ga0587072_023137 3300059643 Bacteria 1114
909 Ga0501082_0048193 3300060353 Bacteria 3672
910 Ga0530510_0239918 3300061734 Bacteria 1349
911 Ga0530510_0558227 3300061734 Bacteria 870

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0069924 Ga0496124_0069924_1422_2237 222
2 iso_pu_bacteria 2906393657 2906394515 222
3 3300049571 Ga0501034_0050206 Ga0501034_0050206_3345_4163 225
4 3300049571 Ga0501034_0562339 Ga0501034_0562339_254_1039 225
5 3300049581 Ga0501047_0030968 Ga0501047_0030968_2654_3472 226
6 3300061734 Ga0530510_0558227 Ga0530510_0558227_17_826 227
7 3300037853 Ga0436364_0053004 Ga0436364_0053004_561_1310 228
8 3300049572 Ga0501036_0164430 Ga0501036_0164430_165_983 228
9 3300049581 Ga0501047_0212705 Ga0501047_0212705_106_924 228
10 3300049583 Ga0501067_0042891 Ga0501067_0042891_946_1764 228
11 3300049588 Ga0501072_0503666 Ga0501072_0503666_83_901 228
12 3300049589 Ga0501073_0073448 Ga0501073_0073448_844_1662 228
13 3300049590 Ga0501074_0016136 Ga0501074_0016136_3968_4786 228
14 3300049742 Ga0501080_0077400 Ga0501080_0077400_871_1689 228
15 iso_pu_bacteria 2958137437 2958143854 228
16 iso_pu_bacteria 8004727605 8004729883 228
17 iso_pu_bacteria 2906386501 2906393385 230
18 iso_pu_bacteria 2924718760 2924722625 230
19 iso_pu_bacteria 2965089291 2965093465 230
20 3300049589 Ga0501073_0176648 Ga0501073_0176648_496_1314 231
21 3300049744 Ga0501083_0017663 Ga0501083_0017663_2515_3333 231
22 3300005937 Ga0081455_10107875 Ga0081455_101078752 234
23 3300006173 Ga0070716_100072389 Ga0070716_1000723892 234
24 3300007788 Ga0099795_10055087 Ga0099795_100550872 234
25 3300045051 Ga0451576_0639612 Ga0451576_0639612_218_1042 234
26 3300049822 Ga0501035_0003519 Ga0501035_0003519_8767_9591 234
27 3300009094 Ga0111539_10309258 Ga0111539_103092582 236
28 3300041413 Ga0439465_0031347 Ga0439465_0031347_713_1531 236
29 3300049589 Ga0501073_0100118 Ga0501073_0100118_426_1247 236
30 3300005434 Ga0070709_10052912 Ga0070709_100529121 237
31 3300006028 Ga0070717_10173981 Ga0070717_101739813 237
32 3300025906 Ga0207699_10007510 Ga0207699_100075106 237
33 3300037853 Ga0436364_0628381 Ga0436364_0628381_11_829 237
34 3300025915 Ga0207693_10162802 Ga0207693_101628022 238
35 3300031239 Ga0265328_10016074 Ga0265328_100160742 238
36 3300031242 Ga0265329_10062820 Ga0265329_100628202 238
37 3300031250 Ga0265331_10003656 Ga0265331_100036562 238
38 3300031251 Ga0265327_10015085 Ga0265327_100150855 238
39 3300031344 Ga0265316_10059448 Ga0265316_100594482 238
40 3300041441 Ga0451787_397122 Ga0451787_397122_85_903 238
41 3300041501 Ga0451845_0022414 Ga0451845_0022414_1269_2087 238
42 3300041507 Ga0451851_0106610 Ga0451851_0106610_101_919 238
43 3300041509 Ga0451843_1153044 Ga0451843_1153044_29_847 238
44 3300041512 Ga0451853_4116506 Ga0451853_4116506_185_1003 238
45 3300046492 Ga0495585_0025667 Ga0495585_0025667_2249_3067 238
46 3300046500 Ga0495596_0059795 Ga0495596_0059795_278_1096 238
47 3300046518 Ga0495631_0103618 Ga0495631_0103618_325_1143 238
48 3300046524 Ga0495648_0027504 Ga0495648_0027504_1522_2340 238
49 3300046660 Ga0495625_0113690 Ga0495625_0113690_900_1718 238
50 3300049579 Ga0501043_0379472 Ga0501043_0379472_15_758 238
51 3300039437 Ga0436365_0289217 Ga0436365_0289217_3312_4106 239
52 3300048922 Ga0496119_0020869 Ga0496119_0020869_1045_1866 239
53 3300048925 Ga0496122_0032728 Ga0496122_0032728_2301_3122 239
54 3300048925 Ga0496122_0047999 Ga0496122_0047999_211_1032 239
55 3300048926 Ga0496123_0016492 Ga0496123_0016492_968_1789 239
56 3300048928 Ga0496125_0074229 Ga0496125_0074229_1707_2528 239
57 3300049569 Ga0501032_0068127 Ga0501032_0068127_1377_2198 239
58 3300049570 Ga0501033_0011725 Ga0501033_0011725_2617_3438 239
59 3300049571 Ga0501034_0058149 Ga0501034_0058149_396_1217 239
60 3300049572 Ga0501036_0036991 Ga0501036_0036991_751_1572 239
61 3300049573 Ga0501037_0129370 Ga0501037_0129370_112_933 239
62 3300049581 Ga0501047_0046886 Ga0501047_0046886_1917_2738 239
63 3300049823 Ga0501044_0036530 Ga0501044_0036530_2730_3551 239
64 3300003187 JGI25151J46595_10000346 JGI25151J46595_100003464 241
65 3300003215 JGI25153J46596_10003250 JGI25153J46596_100032504 241
66 3300003215 JGI25153J46596_10007980 JGI25153J46596_100079803 241
67 3300003374 JGI25161J50226_1006024 JGI25161J50226_10060242 241
68 3300003771 Ga0055526_1001675 Ga0055526_10016755 241
69 3300003771 Ga0055526_1003766 Ga0055526_10037662 241
70 3300003775 Ga0055524_1006985 Ga0055524_10069852 241
71 3300003792 Ga0055540_1018350 Ga0055540_10183502 241
72 3300004625 Ga0055543_1001242 Ga0055543_10012424 241
73 3300006042 Ga0075368_10024940 Ga0075368_100249402 241
74 3300006051 Ga0075364_10152227 Ga0075364_101522272 241
75 3300006177 Ga0075362_10090892 Ga0075362_100908922 241
76 3300006178 Ga0075367_10010369 Ga0075367_100103692 241
77 3300006186 Ga0075369_10007695 Ga0075369_100076954 241
78 3300006195 Ga0075366_10085442 Ga0075366_100854422 241
79 3300006353 Ga0075370_10188242 Ga0075370_101882422 241
80 3300025245 Ga0207425_1003710 Ga0207425_10037104 241
81 3300025258 Ga0209129_1019425 Ga0209129_10194252 241
82 3300025273 Ga0209673_1001964 Ga0209673_10019645 241
83 3300025294 Ga0209025_1000970 Ga0209025_10009703 241
84 3300025295 Ga0209564_1000091 Ga0209564_1000091175 241
85 3300025295 Ga0209564_1001931 Ga0209564_10019314 241
86 3300025297 Ga0209758_1001962 Ga0209758_100196211 241
87 3300025297 Ga0209758_1002450 Ga0209758_10024507 241
88 3300025299 Ga0209256_1000541 Ga0209256_10005419 241
89 3300025299 Ga0209256_1005494 Ga0209256_10054942 241
90 3300025302 Ga0207426_1000063 Ga0207426_1000063224 241
91 3300025304 Ga0209257_1007835 Ga0209257_10078354 241
92 3300027866 Ga0209813_10012420 Ga0209813_100124203 241
93 3300037853 Ga0436364_0563011 Ga0436364_0563011_304_1053 241
94 3300041496 Ga0451839_1498607 Ga0451839_1498607_235_1053 241
95 3300041498 Ga0451841_1101904 Ga0451841_1101904_25_843 241
96 3300041509 Ga0451843_0615050 Ga0451843_0615050_665_1483 241
97 3300046460 Ga0495638_0023748 Ga0495638_0023748_242_1060 241
98 3300046501 Ga0495607_0033186 Ga0495607_0033186_1521_2339 241
99 3300046506 Ga0495583_0039945 Ga0495583_0039945_27_845 241
100 3300046512 Ga0495610_0013489 Ga0495610_0013489_3146_3964 241
101 3300046513 Ga0495616_0046111 Ga0495616_0046111_196_1014 241
102 3300046515 Ga0495620_0016232 Ga0495620_0016232_534_1352 241
103 3300046522 Ga0495643_0053111 Ga0495643_0053111_755_1573 241
104 3300046530 Ga0495654_0079010 Ga0495654_0079010_473_1291 241
105 3300046542 Ga0495597_0031888 Ga0495597_0031888_1170_1988 241
106 3300046616 Ga0495668_0031652 Ga0495668_0031652_693_1511 241
107 3300046810 Ga0495660_0023466 Ga0495660_0023466_818_1636 241
108 3300047443 Ga0495687_019134 Ga0495687_019134_2514_3332 241
109 3300047472 Ga0495686_0035111 Ga0495686_0035111_2066_2884 241
110 3300048922 Ga0496119_0001089 Ga0496119_0001089_3800_4621 241
111 3300048925 Ga0496122_0002105 Ga0496122_0002105_23355_24176 241
112 3300048926 Ga0496123_0002010 Ga0496123_0002010_5001_5822 241
113 3300049459 Ga0495678_027883 Ga0495678_027883_1515_2333 241
114 3300050489 nmdc:mga03683_91461_c1 nmdc:mga03683_91461_c1_120_938 241
115 3300050516 nmdc:mga0sz30_119851_c1 nmdc:mga0sz30_119851_c1_223_1041 241
116 3300053086 Ga0500578_0109792 Ga0500578_0109792_854_1672 241
117 3300053104 Ga0500556_0000033 Ga0500556_0000033_101118_101939 241
118 3300053109 Ga0500569_021263 Ga0500569_021263_447_1265 241
119 3300053134 Ga0500658_0000230 Ga0500658_0000230_3146_3964 241
120 3300025299 Ga0209256_1018895 Ga0209256_10188952 242
121 3300049570 Ga0501033_0236443 Ga0501033_0236443_423_1211 242
122 3300049571 Ga0501034_0087591 Ga0501034_0087591_1986_2774 242
123 3300049585 Ga0501069_0025402 Ga0501069_0025402_208_996 242
124 3300049822 Ga0501035_0156239 Ga0501035_0156239_834_1622 242
125 3300042876 Ga0451577_0048226 Ga0451577_0048226_1370_2161 243
126 3300045051 Ga0451576_0000457 Ga0451576_0000457_57647_58531 243
127 3300048907 Ga0496104_0057690 Ga0496104_0057690_108_905 243
128 3300049569 Ga0501032_0028404 Ga0501032_0028404_2861_3685 244
129 3300049571 Ga0501034_0000077 Ga0501034_0000077_42907_43731 244
130 3300049572 Ga0501036_0109061 Ga0501036_0109061_280_1104 244
131 3300049573 Ga0501037_0019672 Ga0501037_0019672_936_1760 244
132 3300049574 Ga0501038_0154162 Ga0501038_0154162_717_1541 244
133 3300049575 Ga0501039_0000131 Ga0501039_0000131_2822_3646 244
134 3300049576 Ga0501040_0074137 Ga0501040_0074137_758_1582 244
135 3300049580 Ga0501046_0001156 Ga0501046_0001156_5471_6295 244
136 3300049581 Ga0501047_0000129 Ga0501047_0000129_78723_79547 244
137 3300049583 Ga0501067_0000213 Ga0501067_0000213_24293_25117 244
138 3300049586 Ga0501070_0136845 Ga0501070_0136845_634_1458 244
139 3300049589 Ga0501073_0011311 Ga0501073_0011311_5516_6340 244
140 3300049742 Ga0501080_0000053 Ga0501080_0000053_5949_6773 244
141 3300049822 Ga0501035_0000010 Ga0501035_0000010_179227_180051 244
142 3300049823 Ga0501044_0000006 Ga0501044_0000006_33183_34007 244
143 3300049824 Ga0501045_0140475 Ga0501045_0140475_744_1568 244
144 iso_pu_bacteria 2878788777 2878791401 244
145 3300021388 Ga0213875_10000030 Ga0213875_10000030158 245
146 3300032126 Ga0307415_100510670 Ga0307415_1005106702 245
147 3300037853 Ga0436364_0207431 Ga0436364_0207431_18590_19381 245
148 3300048905 Ga0496102_0152186 Ga0496102_0152186_18_776 245
149 3300009101 Ga0105247_10347259 Ga0105247_103472592 246
150 3300049568 Ga0501031_0123922 Ga0501031_0123922_766_1584 246
151 3300002773 JGI25152J39213_1005371 JGI25152J39213_10053713 247
152 3300003187 JGI25151J46595_10005499 JGI25151J46595_100054993 247
153 3300025258 Ga0209129_1000123 Ga0209129_100012352 247
154 3300025294 Ga0209025_1003063 Ga0209025_10030634 247
155 3300031241 Ga0265325_10002414 Ga0265325_100024146 247
156 3300031249 Ga0265339_10040311 Ga0265339_100403113 247
157 3300031344 Ga0265316_10040084 Ga0265316_100400843 247
158 3300049744 Ga0501083_0181102 Ga0501083_0181102_384_1142 247
159 3300003187 JGI25151J46595_10017127 JGI25151J46595_100171272 248
160 3300005347 Ga0070668_100074040 Ga0070668_1000740401 248
161 3300006948 Ga0099826_10000423 Ga0099826_1000042313 248
162 3300025284 Ga0209130_1011836 Ga0209130_10118362 248
163 3300025294 Ga0209025_1000441 Ga0209025_100044154 248
164 3300027666 Ga0209282_1000224 Ga0209282_100022413 248
165 3300028577 Ga0265318_10143745 Ga0265318_101437451 248
166 3300031247 Ga0265340_10044194 Ga0265340_100441942 248
167 3300031344 Ga0265316_10031264 Ga0265316_100312642 248
168 3300031711 Ga0265314_10010850 Ga0265314_100108507 248
169 3300031712 Ga0265342_10084702 Ga0265342_100847022 248
170 3300031995 Ga0307409_100529568 Ga0307409_1005295682 248
171 3300041486 Ga0451807_0622738 Ga0451807_0622738_113_916 248
172 3300048919 Ga0496116_0050161 Ga0496116_0050161_1097_1909 248
173 3300048920 Ga0496117_0104866 Ga0496117_0104866_632_1444 248
174 3300048928 Ga0496125_0021027 Ga0496125_0021027_424_1236 248
175 3300005548 Ga0070665_100025086 Ga0070665_1000250863 249
176 3300009147 Ga0114129_10675954 Ga0114129_106759542 249
177 3300028379 Ga0268266_10015355 Ga0268266_100153554 249
178 3300003203 JGI25406J46586_10003471 JGI25406J46586_100034716 250
179 3300003203 JGI25406J46586_10004531 JGI25406J46586_100045314 250
180 3300003771 Ga0055526_1016134 Ga0055526_10161343 250
181 3300003775 Ga0055524_1000384 Ga0055524_100038415 250
182 3300003775 Ga0055524_1011084 Ga0055524_10110843 250
183 3300003790 Ga0055528_1000866 Ga0055528_10008662 250
184 3300005985 Ga0081539_10000881 Ga0081539_1000088141 250
185 3300013249 Ga0171463_1001 Ga0171463_1001688 250
186 3300015690 Ga0183363_1012 Ga0183363_101231 250
187 3300025273 Ga0209673_1000015 Ga0209673_1000015362 250
188 3300025294 Ga0209025_1003049 Ga0209025_10030494 250
189 3300025295 Ga0209564_1005067 Ga0209564_10050674 250
190 3300025299 Ga0209256_1000180 Ga0209256_100018062 250
191 3300025299 Ga0209256_1001340 Ga0209256_100134018 250
192 3300031911 Ga0307412_10078925 Ga0307412_100789253 250
193 3300041405 Ga0439438_036258 Ga0439438_036258_189_1004 250
194 3300042014 Ga0439457_020608 Ga0439457_020608_442_1257 250
195 3300042122 Ga0450920_028507 Ga0450920_028507_124_939 250
196 3300042145 Ga0450906_029462 Ga0450906_029462_67_882 250
197 3300042435 Ga0439434_0073404 Ga0439434_0073404_101_916 250
198 3300042531 Ga0450918_001536 Ga0450918_001536_2155_2970 250
199 3300046460 Ga0495638_0099707 Ga0495638_0099707_524_1342 250
200 3300053153 Ga0500616_0080810 Ga0500616_0080810_325_1149 250
201 3300005445 Ga0070708_100764056 Ga0070708_1007640561 251
202 3300030878 Ga0265770_1017861 Ga0265770_10178612 251
203 3300032004 Ga0307414_10287044 Ga0307414_102870441 251
204 3300035170 Ga0373943_0000613 Ga0373943_0000613_7185_7997 251
205 3300035692 Ga0373935_0005946 Ga0373935_0005946_1938_2750 251
206 3300035725 Ga0373947_0000256 Ga0373947_0000256_21993_22805 251
207 3300046472 Ga0495580_0044198 Ga0495580_0044198_46_858 251
208 3300046514 Ga0495618_0181186 Ga0495618_0181186_130_942 251
209 3300046517 Ga0495630_0004618 Ga0495630_0004618_6721_7533 251
210 3300046526 Ga0495666_0012120 Ga0495666_0012120_1243_2055 251
211 3300046531 Ga0495665_0042485 Ga0495665_0042485_1510_2322 251
212 3300046533 Ga0495640_0123195 Ga0495640_0123195_111_923 251
213 3300046683 Ga0495658_0047318 Ga0495658_0047318_20_832 251
214 3300046690 Ga0495624_0007453 Ga0495624_0007453_252_1064 251
215 3300047471 Ga0495684_0005376 Ga0495684_0005376_1708_2520 251
216 3300047471 Ga0495684_0007110 Ga0495684_0007110_6757_7569 251
217 3300047673 Ga0495593_0031816 Ga0495593_0031816_901_1713 251
218 3300049571 Ga0501034_0353748 Ga0501034_0353748_131_949 251
219 3300049591 Ga0501075_0171117 Ga0501075_0171117_308_1108 251
220 3300049592 Ga0501076_0008864 Ga0501076_0008864_6499_7299 251
221 3300049593 Ga0501077_0043446 Ga0501077_0043446_2015_2815 251
222 3300049743 Ga0501081_0003348 Ga0501081_0003348_5401_6201 251
223 3300053085 Ga0495619_0105390 Ga0495619_0105390_347_1159 251
224 3300060353 Ga0501082_0048193 Ga0501082_0048193_1304_2104 251
225 3300061734 Ga0530510_0239918 Ga0530510_0239918_521_1321 251
226 iso_pu_bacteria 2643221598 2644001280 251
227 iso_pu_bacteria 2643221614 2644086002 251
228 iso_pu_bacteria 2643221661 2644345331 251
229 iso_pu_bacteria 2643221666 2644369605 251
230 iso_pu_bacteria 2891088606 2891093155 251
231 3300005535 Ga0070684_100134267 Ga0070684_1001342672 252
232 3300005564 Ga0070664_100173555 Ga0070664_1001735552 252
233 3300005843 Ga0068860_100783811 Ga0068860_1007838111 252
234 3300014325 Ga0163163_10009574 Ga0163163_100095748 252
235 3300026078 Ga0207702_10863996 Ga0207702_108639961 252
236 3300031239 Ga0265328_10010982 Ga0265328_100109823 252
237 3300035725 Ga0373947_0346379 Ga0373947_0346379_186_968 252
238 3300037471 Ga0395905_0464233 Ga0395905_0464233_294_1112 252
239 3300038443 Ga0395901_0027330 Ga0395901_0027330_1965_2783 252
240 3300048904 Ga0496101_0036946 Ga0496101_0036946_1822_2604 252
241 3300048905 Ga0496102_0191113 Ga0496102_0191113_522_1304 252
242 3300048908 Ga0496105_0000392 Ga0496105_0000392_14656_15438 252
243 3300048911 Ga0496108_0001992 Ga0496108_0001992_14291_15073 252
244 3300048912 Ga0496109_0012017 Ga0496109_0012017_1552_2334 252
245 3300048914 Ga0496111_0001116 Ga0496111_0001116_13798_14580 252
246 3300048915 Ga0496112_0002870 Ga0496112_0002870_8559_9341 252
247 3300048916 Ga0496113_0004045 Ga0496113_0004045_3525_4307 252
248 3300048918 Ga0496115_0006960 Ga0496115_0006960_1779_2561 252
249 3300049572 Ga0501036_0028303 Ga0501036_0028303_1279_2079 252
250 3300049577 Ga0501041_0087680 Ga0501041_0087680_218_1018 252
251 3300049578 Ga0501042_0304709 Ga0501042_0304709_229_1029 252
252 3300049582 Ga0501048_0000282 Ga0501048_0000282_8478_9302 252
253 3300049582 Ga0501048_0020443 Ga0501048_0020443_1878_2678 252
254 3300049586 Ga0501070_0107545 Ga0501070_0107545_1468_2286 252
255 3300049587 Ga0501071_0238175 Ga0501071_0238175_332_1132 252
256 3300049588 Ga0501072_0386210 Ga0501072_0386210_180_980 252
257 3300049592 Ga0501076_0070351 Ga0501076_0070351_1141_1941 252
258 3300049824 Ga0501045_0141357 Ga0501045_0141357_365_1165 252
259 3300050491 nmdc:mga00v17_3192_c1 nmdc:mga00v17_3192_c1_4420_5232 252
260 3300002739 JGI25158J39367_1002742 JGI25158J39367_10027423 253
261 3300002987 JGI25159J45721_1000016 JGI25159J45721_100001649 253
262 3300003354 JGI25160J50197_1000002 JGI25160J50197_1000002486 253
263 3300003374 JGI25161J50226_1000397 JGI25161J50226_100039714 253
264 3300004625 Ga0055543_1000022 Ga0055543_100002261 253
265 3300005262 Ga0065165_1000058 Ga0065165_1000058111 253
266 3300005330 Ga0070690_100004984 Ga0070690_1000049842 253
267 3300005340 Ga0070689_100001622 Ga0070689_1000016226 253
268 3300005347 Ga0070668_100084250 Ga0070668_1000842502 253
269 3300005353 Ga0070669_100113247 Ga0070669_1001132472 253
270 3300005354 Ga0070675_100162214 Ga0070675_1001622142 253
271 3300005355 Ga0070671_100130128 Ga0070671_1001301282 253
272 3300005365 Ga0070688_100003117 Ga0070688_1000031172 253
273 3300005456 Ga0070678_100098451 Ga0070678_1000984513 253
274 3300005615 Ga0070702_100066993 Ga0070702_1000669932 253
275 3300005617 Ga0068859_100071069 Ga0068859_1000710692 253
276 3300005618 Ga0068864_100025873 Ga0068864_1000258733 253
277 3300005718 Ga0068866_10163645 Ga0068866_101636452 253
278 3300005844 Ga0068862_100307554 Ga0068862_1003075541 253
279 3300006237 Ga0097621_100436463 Ga0097621_1004364631 253
280 3300006931 Ga0097620_100071067 Ga0097620_1000710672 253
281 3300009148 Ga0105243_10012317 Ga0105243_100123172 253
282 3300009177 Ga0105248_10020676 Ga0105248_100206766 253
283 3300013306 Ga0163162_10254260 Ga0163162_102542602 253
284 3300013308 Ga0157375_10195734 Ga0157375_101957342 253
285 3300014325 Ga0163163_10128427 Ga0163163_101284272 253
286 3300017792 Ga0163161_10388757 Ga0163161_103887572 253
287 3300025208 Ga0209436_100737 Ga0209436_1007373 253
288 3300025284 Ga0209130_1000008 Ga0209130_100000860 253
289 3300025294 Ga0209025_1000631 Ga0209025_10006313 253
290 3300025302 Ga0207426_1000016 Ga0207426_1000016501 253
291 3300025303 Ga0209051_1028922 Ga0209051_10289222 253
292 3300025907 Ga0207645_10019613 Ga0207645_100196132 253
293 3300025936 Ga0207670_10001231 Ga0207670_100012316 253
294 3300025938 Ga0207704_10086021 Ga0207704_100860212 253
295 3300025941 Ga0207711_10153095 Ga0207711_101530953 253
296 3300026089 Ga0207648_10216168 Ga0207648_102161682 253
297 3300026095 Ga0207676_10007593 Ga0207676_100075934 253
298 3300026121 Ga0207683_10025771 Ga0207683_100257713 253
299 3300028380 Ga0268265_10272616 Ga0268265_102726161 253
300 3300031251 Ga0265327_10001660 Ga0265327_1000166020 253
301 3300031456 Ga0307513_10016341 Ga0307513_100163418 253
302 3300034816 Ga0373930_0011195 Ga0373930_0011195_120_905 253
303 3300035084 Ga0373928_0032115 Ga0373928_0032115_361_1146 253
304 3300035091 Ga0373951_0007101 Ga0373951_0007101_1361_2146 253
305 3300035691 Ga0373931_0070810 Ga0373931_0070810_57_842 253
306 3300048903 Ga0496100_0011359 Ga0496100_0011359_986_1771 253
307 3300048904 Ga0496101_0013345 Ga0496101_0013345_1099_1884 253
308 3300048906 Ga0496103_0209709 Ga0496103_0209709_320_1105 253
309 3300048909 Ga0496106_0214127 Ga0496106_0214127_668_1453 253
310 3300048909 Ga0496106_0409951 Ga0496106_0409951_13_831 253
311 3300048914 Ga0496111_0022364 Ga0496111_0022364_2927_3712 253
312 3300048915 Ga0496112_0042420 Ga0496112_0042420_25_810 253
313 3300048916 Ga0496113_0149293 Ga0496113_0149293_152_937 253
314 3300048917 Ga0496114_0084239 Ga0496114_0084239_1690_2475 253
315 3300048924 Ga0496121_0194844 Ga0496121_0194844_413_1231 253
316 3300048924 Ga0496121_0215073 Ga0496121_0215073_322_1140 253
317 3300048924 Ga0496121_0281058 Ga0496121_0281058_240_1058 253
318 3300048925 Ga0496122_0219559 Ga0496122_0219559_257_1075 253
319 3300048927 Ga0496124_0049494 Ga0496124_0049494_1881_2699 253
320 3300048929 Ga0496126_0455450 Ga0496126_0455450_157_975 253
321 3300049568 Ga0501031_0000003 Ga0501031_0000003_111347_112165 253
322 3300049569 Ga0501032_0000010 Ga0501032_0000010_111347_112165 253
323 3300049570 Ga0501033_0000017 Ga0501033_0000017_111347_112165 253
324 3300049570 Ga0501033_0244080 Ga0501033_0244080_271_1092 253
325 3300049571 Ga0501034_0000053 Ga0501034_0000053_94657_95475 253
326 3300049572 Ga0501036_0000009 Ga0501036_0000009_111347_112165 253
327 3300049573 Ga0501037_0000008 Ga0501037_0000008_94648_95466 253
328 3300049574 Ga0501038_0000008 Ga0501038_0000008_94657_95475 253
329 3300049575 Ga0501039_0000021 Ga0501039_0000021_67078_67896 253
330 3300049576 Ga0501040_0003914 Ga0501040_0003914_2633_3451 253
331 3300049579 Ga0501043_0000405 Ga0501043_0000405_22112_22930 253
332 3300049581 Ga0501047_0000894 Ga0501047_0000894_7689_8507 253
333 3300049585 Ga0501069_0367186 Ga0501069_0367186_28_828 253
334 3300049586 Ga0501070_0005238 Ga0501070_0005238_3287_4105 253
335 3300049589 Ga0501073_0256299 Ga0501073_0256299_309_1109 253
336 3300049742 Ga0501080_0018576 Ga0501080_0018576_2717_3517 253
337 3300049742 Ga0501080_0071736 Ga0501080_0071736_2415_3197 253
338 3300049822 Ga0501035_0000023 Ga0501035_0000023_111347_112165 253
339 3300049823 Ga0501044_0000021 Ga0501044_0000021_94657_95475 253
340 iso_pu_bacteria 2671180139 2671694879 253
341 3300005337 Ga0070682_100164415 Ga0070682_1001644152 254
342 3300005347 Ga0070668_100006623 Ga0070668_1000066233 254
343 3300005347 Ga0070668_100008269 Ga0070668_1000082698 254
344 3300005347 Ga0070668_100014191 Ga0070668_1000141916 254
345 3300005436 Ga0070713_100385128 Ga0070713_1003851282 254
346 3300005617 Ga0068859_100348761 Ga0068859_1003487612 254
347 3300005617 Ga0068859_100383314 Ga0068859_1003833141 254
348 3300005843 Ga0068860_100000083 Ga0068860_100000083138 254
349 3300005843 Ga0068860_100087672 Ga0068860_1000876723 254
350 3300005844 Ga0068862_100050812 Ga0068862_1000508122 254
351 3300005844 Ga0068862_100155563 Ga0068862_1001555632 254
352 3300005844 Ga0068862_100222386 Ga0068862_1002223863 254
353 3300006931 Ga0097620_100348769 Ga0097620_1003487692 254
354 3300006931 Ga0097620_100383329 Ga0097620_1003833291 254
355 3300009098 Ga0105245_10445948 Ga0105245_104459482 254
356 3300025972 Ga0207668_10004893 Ga0207668_100048933 254
357 3300025972 Ga0207668_10023824 Ga0207668_100238243 254
358 3300025972 Ga0207668_10146336 Ga0207668_101463363 254
359 3300026118 Ga0207675_100305961 Ga0207675_1003059611 254
360 3300028380 Ga0268265_10002598 Ga0268265_100025988 254
361 3300028380 Ga0268265_10039627 Ga0268265_100396275 254
362 3300028381 Ga0268264_10000055 Ga0268264_10000055271 254
363 3300028381 Ga0268264_10462787 Ga0268264_104627872 254
364 3300031824 Ga0307413_10183526 Ga0307413_101835261 254
365 3300031911 Ga0307412_10150819 Ga0307412_101508192 254
366 3300048928 Ga0496125_0282926 Ga0496125_0282926_192_980 254
367 3300049822 Ga0501035_0065014 Ga0501035_0065014_898_1716 254
368 3300003203 JGI25406J46586_10051175 JGI25406J46586_100511752 255
369 3300003203 JGI25406J46586_10064206 JGI25406J46586_100642061 255
370 3300003775 Ga0055524_1050089 Ga0055524_10500891 255
371 3300005985 Ga0081539_10016778 Ga0081539_100167782 255
372 3300006038 Ga0075365_10058029 Ga0075365_100580293 255
373 3300006948 Ga0099826_10101545 Ga0099826_101015451 255
374 3300011119 Ga0105246_10467859 Ga0105246_104678591 255
375 3300014969 Ga0157376_10679045 Ga0157376_106790451 255
376 3300022739 Ga0228711_1000019 Ga0228711_10000195 255
377 3300022740 Ga0228710_1000022 Ga0228710_10000225 255
378 3300027111 Ga0209281_1000227 Ga0209281_100022711 255
379 3300027666 Ga0209282_1000042 Ga0209282_100004211 255
380 3300031967 Ga0315914_1000009 Ga0315914_1000009116 255
381 3300033430 Ga0315913_1000015 Ga0315913_100001511 255
382 3300033464 Ga0315915_1000013 Ga0315915_100001372 255
383 3300035115 Ga0373941_0147295 Ga0373941_0147295_21_812 255
384 3300049571 Ga0501034_0423857 Ga0501034_0423857_246_1067 255
385 3300049581 Ga0501047_0481443 Ga0501047_0481443_94_885 255
386 3300050491 nmdc:mga00v17_211366_c1 nmdc:mga00v17_211366_c1_122_913 255
387 3300053130 Ga0500642_0019133 Ga0500642_0019133_565_1356 255
388 3300005331 Ga0070670_100135511 Ga0070670_1001355112 256
389 3300005347 Ga0070668_100023623 Ga0070668_1000236233 256
390 3300005367 Ga0070667_100016097 Ga0070667_1000160972 256
391 3300005617 Ga0068859_100021694 Ga0068859_1000216944 256
392 3300005618 Ga0068864_100025900 Ga0068864_1000259004 256
393 3300005719 Ga0068861_100032017 Ga0068861_1000320172 256
394 3300005843 Ga0068860_100138148 Ga0068860_1001381482 256
395 3300005844 Ga0068862_100070545 Ga0068862_1000705453 256
396 3300005844 Ga0068862_100204986 Ga0068862_1002049862 256
397 3300006051 Ga0075364_10273369 Ga0075364_102733692 256
398 3300006177 Ga0075362_10162958 Ga0075362_101629582 256
399 3300006931 Ga0097620_100021695 Ga0097620_1000216953 256
400 3300014969 Ga0157376_10177241 Ga0157376_101772412 256
401 3300025295 Ga0209564_1025178 Ga0209564_10251782 256
402 3300025925 Ga0207650_10255069 Ga0207650_102550692 256
403 3300025972 Ga0207668_10096720 Ga0207668_100967202 256
404 3300025986 Ga0207658_10329177 Ga0207658_103291772 256
405 3300026118 Ga0207675_100031839 Ga0207675_1000318393 256
406 3300028381 Ga0268264_10033405 Ga0268264_100334053 256
407 3300031247 Ga0265340_10064914 Ga0265340_100649142 256
408 3300046674 Ga0495588_0137928 Ga0495588_0137928_254_1057 256
409 3300049589 Ga0501073_0425378 Ga0501073_0425378_83_901 256
410 3300050494 nmdc:mga06z11_260156_c1 nmdc:mga06z11_260156_c1_159_953 256
411 3300053153 Ga0500616_0068987 Ga0500616_0068987_771_1565 256
412 iso_pu_bacteria 2537561587 2537872806 256
413 iso_pu_bacteria 2554235003 2554246643 256
414 iso_pu_bacteria 2558860242 2559293871 256
415 iso_pu_bacteria 2599185210 2599605420 256
416 iso_pu_bacteria 2600255279 2601609156 256
417 iso_pu_bacteria 2600255308 2601745931 256
418 iso_pu_bacteria 2643221582 2643921141 256
419 iso_pu_bacteria 2643221693 2644519215 256
420 iso_pu_bacteria 2808606387 2808986353 256
421 iso_pu_bacteria 2818991439 2819556484 256
422 iso_pu_bacteria 2838675328 2838677213 256
423 iso_pu_bacteria 2838714209 2838716101 256
424 iso_pu_bacteria 2838719591 2838720099 256
425 iso_pu_bacteria 2838724970 2838726853 256
426 iso_pu_bacteria 2841846520 2841847032 256
427 iso_pu_bacteria 2841859092 2841860438 256
428 iso_pu_bacteria 2842124991 2842126939 256
429 iso_pu_bacteria 2842130223 2842132106 256
430 iso_pu_bacteria 2842152218 2842152725 256
431 iso_pu_bacteria 2842170452 2842172346 256
432 iso_pu_bacteria 2842175837 2842176344 256
433 iso_pu_bacteria 2842187318 2842189208 256
434 iso_pu_bacteria 2842211629 2842213522 256
435 iso_pu_bacteria 2842224351 2842224860 256
436 iso_pu_bacteria 2842515876 2842517223 256
437 iso_pu_bacteria 2899792073 2899792504 256
438 iso_pu_bacteria 2899845264 2899847906 256
439 iso_pu_bacteria 2919114240 2919116304 256
440 iso_pu_bacteria 2926754445 2926757258 256
441 iso_pu_bacteria 2926760298 2926761473 256
442 iso_pu_bacteria 2933006813 2933007370 256
443 iso_pu_bacteria 2933011516 2933012134 256
444 iso_pu_bacteria 2933594066 2933594578 256
445 iso_pu_bacteria 2978969890 2978973314 256
446 iso_pu_bacteria 2979089926 2979093239 256
447 iso_pu_bacteria 2979095461 2979099376 256
448 iso_pu_bacteria 2979100975 2979105210 256
449 iso_pu_bacteria 2984509177 2984512934 256
450 iso_pu_bacteria 2984518228 2984520702 256
451 iso_pu_bacteria 2984537506 2984539994 256
452 iso_pu_bacteria 2984587000 2984591595 256
453 iso_pu_bacteria 2984601300 2984602185 256
454 iso_pu_bacteria 650716007 650739062 256
455 iso_pu_bacteria 8003570095 8003572694 256
456 3300049571 Ga0501034_0386069 Ga0501034_0386069_211_1029 257
457 3300049583 Ga0501067_0001197 Ga0501067_0001197_106_924 257
458 3300049589 Ga0501073_0067096 Ga0501073_0067096_217_1035 257
459 3300054114 Ga0501084_0453913 Ga0501084_0453913_88_906 257
460 iso_pu_bacteria 2558860983 2561466895 257
461 iso_pu_bacteria 2889914905 2889916061 257
462 iso_pu_bacteria 2965047637 2965050726 257
463 3300049568 Ga0501031_0169540 Ga0501031_0169540_427_1245 258
464 3300049569 Ga0501032_0012946 Ga0501032_0012946_1103_1921 258
465 3300049570 Ga0501033_0003783 Ga0501033_0003783_2157_2975 258
466 3300049570 Ga0501033_0005881 Ga0501033_0005881_1497_2315 258
467 3300049570 Ga0501033_0396228 Ga0501033_0396228_20_844 258
468 3300049571 Ga0501034_0009703 Ga0501034_0009703_8628_9446 258
469 3300049571 Ga0501034_0136949 Ga0501034_0136949_49_849 258
470 3300049572 Ga0501036_0030433 Ga0501036_0030433_693_1511 258
471 3300049573 Ga0501037_0002684 Ga0501037_0002684_5359_6177 258
472 3300049576 Ga0501040_0271701 Ga0501040_0271701_209_1027 258
473 3300049578 Ga0501042_0011075 Ga0501042_0011075_3439_4257 258
474 3300049581 Ga0501047_0020856 Ga0501047_0020856_1270_2088 258
475 3300049581 Ga0501047_0686654 Ga0501047_0686654_23_823 258
476 3300049582 Ga0501048_0004455 Ga0501048_0004455_157_975 258
477 3300049584 Ga0501068_0005249 Ga0501068_0005249_254_1072 258
478 3300049585 Ga0501069_0196147 Ga0501069_0196147_320_1138 258
479 3300049586 Ga0501070_0006463 Ga0501070_0006463_6098_6916 258
480 3300049589 Ga0501073_0146464 Ga0501073_0146464_688_1506 258
481 3300049742 Ga0501080_0065574 Ga0501080_0065574_1497_2315 258
482 3300049822 Ga0501035_0003419 Ga0501035_0003419_7419_8237 258
483 3300049822 Ga0501035_0469443 Ga0501035_0469443_28_846 258
484 3300049824 Ga0501045_0007088 Ga0501045_0007088_5616_6434 258
485 iso_pu_bacteria 2513237159 2513996768 258
486 iso_pu_bacteria 2582581283 2585165003 258
487 iso_pu_bacteria 2582581306 2585269547 258
488 iso_pu_bacteria 2582581865 2585385485 258
489 iso_pu_bacteria 2582581866 2585391905 258
490 iso_pu_bacteria 2599185236 2599719550 258
491 iso_pu_bacteria 2643221607 2644047122 258
492 iso_pu_bacteria 2643221618 2644103236 258
493 iso_pu_bacteria 2643221626 2644151892 258
494 iso_pu_bacteria 2643221636 2644203439 258
495 iso_pu_bacteria 2643221637 2644206701 258
496 iso_pu_bacteria 2643221655 2644306164 258
497 iso_pu_bacteria 2643221659 2644330414 258
498 iso_pu_bacteria 2643221686 2644479911 258
499 iso_pu_bacteria 2643221688 2644492247 258
500 iso_pu_bacteria 2643221689 2644496750 258
501 iso_pu_bacteria 2643221698 2644542840 258
502 iso_pu_bacteria 2643221712 2644618886 258
503 iso_pu_bacteria 2643221718 2644650348 258
504 iso_pu_bacteria 2837678835 2837683332 258
505 iso_pu_bacteria 2842205361 2842206954 258
506 iso_pu_bacteria 2842278818 2842280353 258
507 iso_pu_bacteria 2842285085 2842286835 258
508 iso_pu_bacteria 2842402390 2842403612 258
509 iso_pu_bacteria 2842409023 2842410686 258
510 iso_pu_bacteria 2842415677 2842417332 258
511 iso_pu_bacteria 2842521101 2842521699 258
512 iso_pu_bacteria 2844163670 2844170748 258
513 iso_pu_bacteria 2889790730 2889795369 258
514 iso_pu_bacteria 2941499720 2941500709 258
515 iso_pu_bacteria 8005301065 8005301550 258
516 iso_pu_bacteria 8005688590 8005690266 258
517 iso_pu_bacteria 8018150411 8018153603 258
518 iso_pu_bacteria 8054558443 8054559212 258
519 iso_pu_bacteria 8056875544 8056879034 258
520 3300005548 Ga0070665_100004421 Ga0070665_1000044215 259
521 3300006042 Ga0075368_10000355 Ga0075368_100003551 259
522 3300006178 Ga0075367_10002714 Ga0075367_100027143 259
523 3300006186 Ga0075369_10025016 Ga0075369_100250162 259
524 3300006186 Ga0075369_10043510 Ga0075369_100435101 259
525 3300006195 Ga0075366_10115249 Ga0075366_101152492 259
526 3300006353 Ga0075370_10025169 Ga0075370_100251693 259
527 3300006948 Ga0099826_10006813 Ga0099826_100068135 259
528 3300013100 Ga0157373_10001801 Ga0157373_100018018 259
529 3300013102 Ga0157371_10000058 Ga0157371_1000005816 259
530 3300013104 Ga0157370_10000792 Ga0157370_1000079222 259
531 3300027312 Ga0209371_1000009 Ga0209371_1000009426 259
532 3300027312 Ga0209371_1000547 Ga0209371_100054723 259
533 3300027666 Ga0209282_1003866 Ga0209282_10038663 259
534 3300027866 Ga0209813_10000358 Ga0209813_100003583 259
535 3300028379 Ga0268266_10006291 Ga0268266_100062913 259
536 3300030500 Ga0268256_1000010 Ga0268256_1000010425 259
537 3300030500 Ga0268256_1016656 Ga0268256_10166562 259
538 3300046558 Ga0495633_0060660 Ga0495633_0060660_124_936 259
539 3300046674 Ga0495588_0002043 Ga0495588_0002043_341_1153 259
540 3300046692 Ga0495671_0041827 Ga0495671_0041827_27_839 259
541 3300047470 Ga0495681_0017611 Ga0495681_0017611_2627_3439 259
542 3300048916 Ga0496113_0080376 Ga0496113_0080376_1318_2130 259
543 3300048917 Ga0496114_0152441 Ga0496114_0152441_233_1051 259
544 3300048919 Ga0496116_0018419 Ga0496116_0018419_4116_4928 259
545 3300048920 Ga0496117_0000002 Ga0496117_0000002_1955701_1956513 259
546 3300048921 Ga0496118_0000233 Ga0496118_0000233_53591_54403 259
547 3300048922 Ga0496119_0061517 Ga0496119_0061517_509_1321 259
548 3300048923 Ga0496120_0000021 Ga0496120_0000021_110062_110874 259
549 3300048925 Ga0496122_0000001 Ga0496122_0000001_1326491_1327303 259
550 3300048926 Ga0496123_0000001 Ga0496123_0000001_1330222_1331034 259
551 3300048927 Ga0496124_0015389 Ga0496124_0015389_4381_5193 259
552 3300048928 Ga0496125_0041633 Ga0496125_0041633_1185_1997 259
553 3300050491 nmdc:mga00v17_72_c1 nmdc:mga00v17_72_c1_21618_22430 259
554 3300050492 nmdc:mga0yw44_166453_c1 nmdc:mga0yw44_166453_c1_563_1375 259
555 3300050493 nmdc:mga0k408_82874_c1 nmdc:mga0k408_82874_c1_432_1244 259
556 3300050494 nmdc:mga06z11_11753_c1 nmdc:mga06z11_11753_c1_2637_3449 259
557 3300050495 nmdc:mga04h51_11247_c1 nmdc:mga04h51_11247_c1_1237_2049 259
558 3300050496 nmdc:mga07m45_50268_c1 nmdc:mga07m45_50268_c1_394_1206 259
559 3300050516 nmdc:mga0sz30_13611_c1 nmdc:mga0sz30_13611_c1_129_941 259
560 3300050516 nmdc:mga0sz30_26730_c1 nmdc:mga0sz30_26730_c1_271_1083 259
561 3300050516 nmdc:mga0sz30_609_c1 nmdc:mga0sz30_609_c1_9845_10657 259
562 3300053107 Ga0500560_018504 Ga0500560_018504_983_1795 259
563 3300053137 Ga0500561_0000123 Ga0500561_0000123_11956_12768 259
564 3300053157 Ga0500624_000320 Ga0500624_000320_11997_12809 259
565 3300059643 Ga0587072_023137 Ga0587072_023137_218_1030 259
566 iso_pu_bacteria 2509276021 2509388439 259
567 iso_pu_bacteria 2509276033 2509443987 259
568 iso_pu_bacteria 2510065019 2510131414 259
569 iso_pu_bacteria 2510461076 2510897768 259
570 iso_pu_bacteria 2510917028 2511184788 259
571 iso_pu_bacteria 2510917030 2511196816 259
572 iso_pu_bacteria 2513237084 2513570633 259
573 iso_pu_bacteria 2513237085 2513580214 259
574 iso_pu_bacteria 2513237087 2513591482 259
575 iso_pu_bacteria 2513237088 2513596735 259
576 iso_pu_bacteria 2513237093 2513634261 259
577 iso_pu_bacteria 2513237103 2513713190 259
578 iso_pu_bacteria 2513237138 2513864850 259
579 iso_pu_bacteria 2513237144 2513910356 259
580 iso_pu_bacteria 2513237146 2513928304 259
581 iso_pu_bacteria 2513237162 2514020246 259
582 iso_pu_bacteria 2515075009 2515110375 259
583 iso_pu_bacteria 2515154113 2515634575 259
584 iso_pu_bacteria 2515154114 2515643800 259
585 iso_pu_bacteria 2515154116 2515657198 259
586 iso_pu_bacteria 2515154134 2515743301 259
587 iso_pu_bacteria 2516653077 2517039062 259
588 iso_pu_bacteria 2516653085 2517079318 259
589 iso_pu_bacteria 2517093000 2517093259 259
590 iso_pu_bacteria 2517287029 2517409526 259
591 iso_pu_bacteria 2519899620 2520375540 259
592 iso_pu_bacteria 2529292951 2530647821 259
593 iso_pu_bacteria 2534681796 2535515095 259
594 iso_pu_bacteria 2582581294 2585203673 259
595 iso_pu_bacteria 2582581298 2585227077 259
596 iso_pu_bacteria 2582581299 2585233195 259
597 iso_pu_bacteria 2582581304 2585255914 259
598 iso_pu_bacteria 2582581867 2585398550 259
599 iso_pu_bacteria 2585427526 2585529265 259
600 iso_pu_bacteria 2585427528 2585539684 259
601 iso_pu_bacteria 2585427529 2585550498 259
602 iso_pu_bacteria 2585427590 2585819300 259
603 iso_pu_bacteria 2585427593 2585837641 259
604 iso_pu_bacteria 2585427594 2585844653 259
605 iso_pu_bacteria 2599185156 2599333005 259
606 iso_pu_bacteria 2599185170 2599419186 259
607 iso_pu_bacteria 2599185352 2600191457 259
608 iso_pu_bacteria 2615840624 2616297117 259
609 iso_pu_bacteria 2643221557 2643806297 259
610 iso_pu_bacteria 2643221599 2644007319 259
611 iso_pu_bacteria 2643221610 2644070101 259
612 iso_pu_bacteria 2643221634 2644190587 259
613 iso_pu_bacteria 2643221643 2644241547 259
614 iso_pu_bacteria 2643221668 2644381072 259
615 iso_pu_bacteria 2643221675 2644414978 259
616 iso_pu_bacteria 2643221680 2644448635 259
617 iso_pu_bacteria 2643221723 2644674023 259
618 iso_pu_bacteria 2643221726 2644689057 259
619 iso_pu_bacteria 2718217882 2719179570 259
620 iso_pu_bacteria 2718217927 2719384123 259
621 iso_pu_bacteria 2718217997 2719663916 259
622 iso_pu_bacteria 2718218009 2719730240 259
623 iso_pu_bacteria 2718218199 2720490335 259
624 iso_pu_bacteria 2718218232 2720611710 259
625 iso_pu_bacteria 2718218233 2720618559 259
626 iso_pu_bacteria 2718218235 2720629967 259
627 iso_pu_bacteria 2718218269 2720773662 259
628 iso_pu_bacteria 2718218363 2721145663 259
629 iso_pu_bacteria 2718218365 2721157179 259
630 iso_pu_bacteria 2718218366 2721162542 259
631 iso_pu_bacteria 2718218423 2721397893 259
632 iso_pu_bacteria 2721755514 2722838712 259
633 iso_pu_bacteria 2721755556 2723025335 259
634 iso_pu_bacteria 2721755684 2723558918 259
635 iso_pu_bacteria 2721755685 2723565488 259
636 iso_pu_bacteria 2721755809 2724036703 259
637 iso_pu_bacteria 2721755810 2724042996 259
638 iso_pu_bacteria 2721755819 2724088269 259
639 iso_pu_bacteria 2721755822 2724102753 259
640 iso_pu_bacteria 2721755823 2724108653 259
641 iso_pu_bacteria 2724679232 2725948993 259
642 iso_pu_bacteria 2728369352 2730106271 259
643 iso_pu_bacteria 2728369365 2730162807 259
644 iso_pu_bacteria 2728369397 2730296811 259
645 iso_pu_bacteria 2738541293 2738801241 259
646 iso_pu_bacteria 2738541333 2739037074 259
647 iso_pu_bacteria 2765235942 2766066567 259
648 iso_pu_bacteria 2791355256 2793295210 259
649 iso_pu_bacteria 2791355259 2793316330 259
650 iso_pu_bacteria 2791355260 2793323438 259
651 iso_pu_bacteria 2791355261 2793326168 259
652 iso_pu_bacteria 2791355262 2793334228 259
653 iso_pu_bacteria 2791355263 2793341806 259
654 iso_pu_bacteria 2791355264 2793348143 259
655 iso_pu_bacteria 2791355265 2793357235 259
656 iso_pu_bacteria 2791355266 2793361512 259
657 iso_pu_bacteria 2791355267 2793364674 259
658 iso_pu_bacteria 2802429605 2805929369 259
659 iso_pu_bacteria 2802429606 2805932372 259
660 iso_pu_bacteria 2802429633 2806047544 259
661 iso_pu_bacteria 2802429634 2806054963 259
662 iso_pu_bacteria 2802429635 2806062135 259
663 iso_pu_bacteria 2802429636 2806067139 259
664 iso_pu_bacteria 2802429637 2806076460 259
665 iso_pu_bacteria 2828305725 2828307785 259
666 iso_pu_bacteria 2838016132 2838020284 259
667 iso_pu_bacteria 2838022645 2838028180 259
668 iso_pu_bacteria 2838035591 2838037130 259
669 iso_pu_bacteria 2838042994 2838044424 259
670 iso_pu_bacteria 2838048938 2838051500 259
671 iso_pu_bacteria 2838061910 2838063974 259
672 iso_pu_bacteria 2838068647 2838071108 259
673 iso_pu_bacteria 2838661181 2838663694 259
674 iso_pu_bacteria 2838668709 2838672397 259
675 iso_pu_bacteria 2838680041 2838680582 259
676 iso_pu_bacteria 2838686498 2838691585 259
677 iso_pu_bacteria 2838694306 2838695385 259
678 iso_pu_bacteria 2838701080 2838703861 259
679 iso_pu_bacteria 2838707686 2838708761 259
680 iso_pu_bacteria 2838729681 2838733931 259
681 iso_pu_bacteria 2838742623 2838747005 259
682 iso_pu_bacteria 2841851746 2841856146 259
683 iso_pu_bacteria 2841864319 2841866815 259
684 iso_pu_bacteria 2842077413 2842080004 259
685 iso_pu_bacteria 2842118031 2842120623 259
686 iso_pu_bacteria 2842146304 2842148347 259
687 iso_pu_bacteria 2842156927 2842161934 259
688 iso_pu_bacteria 2842163707 2842169690 259
689 iso_pu_bacteria 2842180545 2842185776 259
690 iso_pu_bacteria 2842192696 2842192883 259
691 iso_pu_bacteria 2842198810 2842205173 259
692 iso_pu_bacteria 2842217011 2842218797 259
693 iso_pu_bacteria 2842229732 2842235304 259
694 iso_pu_bacteria 2842237096 2842238173 259
695 iso_pu_bacteria 2842243621 2842248241 259
696 iso_pu_bacteria 2842250916 2842253413 259
697 iso_pu_bacteria 2842257432 2842262165 259
698 iso_pu_bacteria 2842264693 2842268762 259
699 iso_pu_bacteria 2842271015 2842276558 259
700 iso_pu_bacteria 2842291075 2842293664 259
701 iso_pu_bacteria 2842304105 2842306505 259
702 iso_pu_bacteria 2842311132 2842312622 259
703 iso_pu_bacteria 2842317721 2842322511 259
704 iso_pu_bacteria 2842341865 2842343076 259
705 iso_pu_bacteria 2842363717 2842367198 259
706 iso_pu_bacteria 2842370503 2842371045 259
707 iso_pu_bacteria 2842377471 2842380061 259
708 iso_pu_bacteria 2842384541 2842387132 259
709 iso_pu_bacteria 2842395702 2842399245 259
710 iso_pu_bacteria 2842422224 2842424724 259
711 iso_pu_bacteria 2842428310 2842433038 259
712 iso_pu_bacteria 2842434925 2842439343 259
713 iso_pu_bacteria 2842441272 2842445972 259
714 iso_pu_bacteria 2842447887 2842451847 259
715 iso_pu_bacteria 2842462802 2842467158 259
716 iso_pu_bacteria 2842469257 2842473814 259
717 iso_pu_bacteria 2842489311 2842492463 259
718 iso_pu_bacteria 2842495871 2842500043 259
719 iso_pu_bacteria 2842922631 2842923311 259
720 iso_pu_bacteria 2844454524 2844455994 259
721 iso_pu_bacteria 2857516855 2857523442 259
722 iso_pu_bacteria 2891373044 2891374936 259
723 iso_pu_bacteria 2919100787 2919101350 259
724 iso_pu_bacteria 2919450847 2919454236 259
725 iso_pu_bacteria 2920822456 2920823377 259
726 iso_pu_bacteria 2923556063 2923557143 259
727 iso_pu_bacteria 2933016740 2933017682 259
728 iso_pu_bacteria 2933570622 2933573574 259
729 iso_pu_bacteria 2933586486 2933593995 259
730 iso_pu_bacteria 2933599457 2933601907 259
731 iso_pu_bacteria 2935894831 2935895908 259
732 iso_pu_bacteria 2935901341 2935907167 259
733 iso_pu_bacteria 2936367885 2936368931 259
734 iso_pu_bacteria 2936375103 2936378454 259
735 iso_pu_bacteria 2936381700 2936383741 259
736 iso_pu_bacteria 2989349275 2989351407 259
737 iso_pu_bacteria 2989771324 2989772789 259
738 iso_pu_bacteria 2996887358 2996892174 259
739 iso_pu_bacteria 2996893221 2996893431 259
740 iso_pu_bacteria 3003930520 3003931953 259
741 iso_pu_bacteria 3005409236 3005411231 259
742 iso_pu_bacteria 3005445848 3005446182 259
743 iso_pu_bacteria 3005452660 3005452839 259
744 iso_pu_bacteria 639633055 639646644 259
745 iso_pu_bacteria 8001845381 8001848076 259
746 iso_pu_bacteria 8005258706 8005263476 259
747 iso_pu_bacteria 8005275841 8005278834 259
748 iso_pu_bacteria 8005282627 8005289012 259
749 iso_pu_bacteria 8005289223 8005291086 259
750 iso_pu_bacteria 8005307578 8005309197 259
751 iso_pu_bacteria 8005321885 8005326701 259
752 iso_pu_bacteria 8005376324 8005377437 259
753 iso_pu_bacteria 8005382845 8005387300 259
754 iso_pu_bacteria 8005395548 8005400123 259
755 iso_pu_bacteria 8005430974 8005432930 259
756 iso_pu_bacteria 8005460587 8005461014 259
757 iso_pu_bacteria 8005497431 8005498658 259
758 iso_pu_bacteria 8005542996 8005543768 259
759 iso_pu_bacteria 8005556819 8005560629 259
760 iso_pu_bacteria 8005563573 8005563912 259
761 iso_pu_bacteria 8005570704 8005576919 259
762 iso_pu_bacteria 8005619151 8005619852 259
763 iso_pu_bacteria 8005626139 8005628424 259
764 iso_pu_bacteria 8005668836 8005670069 259
765 iso_pu_bacteria 8005695170 8005699257 259
766 iso_pu_bacteria 8018127388 8018133121 259
767 iso_pu_bacteria 8018163183 8018169022 259
768 iso_pu_bacteria 8018176218 8018179460 259
769 iso_pu_bacteria 8023680758 8023684234 259
770 iso_pu_bacteria 8024479707 8024480273 259
771 iso_pu_bacteria 8024486573 8024491417 259
772 iso_pu_bacteria 8024501048 8024501606 259
773 iso_pu_bacteria 8056375014 8056375631 259
774 iso_pu_bacteria 8056382006 8056385945 259
775 iso_pu_bacteria 8057874678 8057876045 259
776 3300005340 Ga0070689_100445583 Ga0070689_1004455832 260
777 3300005354 Ga0070675_100635039 Ga0070675_1006350391 260
778 3300031241 Ga0265325_10003327 Ga0265325_100033275 260
779 3300049570 Ga0501033_0223152 Ga0501033_0223152_298_1116 260
780 3300049589 Ga0501073_0015653 Ga0501073_0015653_633_1451 260
781 3300053140 Ga0500573_0007042 Ga0500573_0007042_4083_4898 260
782 iso_pu_bacteria 2508501122 2509107042 260
783 iso_pu_bacteria 2509276019 2509375002 260
784 iso_pu_bacteria 2510065057 2510305154 260
785 iso_pu_bacteria 2511231052 2511500536 260
786 iso_pu_bacteria 2512047086 2512531995 260
787 iso_pu_bacteria 2512875026 2512972687 260
788 iso_pu_bacteria 2513237086 2513584162 260
789 iso_pu_bacteria 2513237089 2513602924 260
790 iso_pu_bacteria 2513237091 2513620441 260
791 iso_pu_bacteria 2513237140 2513880611 260
792 iso_pu_bacteria 2513237143 2513903341 260
793 iso_pu_bacteria 2513237156 2513986333 260
794 iso_pu_bacteria 2513237160 2514005176 260
795 iso_pu_bacteria 2515154107 2515607724 260
796 iso_pu_bacteria 2516143018 2516204337 260
797 iso_pu_bacteria 2516653046 2516891858 260
798 iso_pu_bacteria 2517487022 2517568654 260
799 iso_pu_bacteria 2551306084 2551679337 260
800 iso_pu_bacteria 2551306085 2551686158 260
801 iso_pu_bacteria 2551306086 2551692118 260
802 iso_pu_bacteria 2551306087 2551699805 260
803 iso_pu_bacteria 2551306089 2551710541 260
804 iso_pu_bacteria 2551306089 2551712287 260
805 iso_pu_bacteria 2551306090 2551723203 260
806 iso_pu_bacteria 2551306091 2551729900 260
807 iso_pu_bacteria 2551306092 2551733414 260
808 iso_pu_bacteria 2551306093 2551743530 260
809 iso_pu_bacteria 2558860100 2558866004 260
810 iso_pu_bacteria 2657244999 2657681898 260
811 iso_pu_bacteria 2690316117 2692317253 260
812 iso_pu_bacteria 2751185821 2753461347 260
813 iso_pu_bacteria 2757320392 2757569210 260
814 iso_pu_bacteria 2791355082 2792582919 260
815 iso_pu_bacteria 2791355091 2792623808 260
816 iso_pu_bacteria 2791355092 2792629812 260
817 iso_pu_bacteria 2791355094 2792638147 260
818 iso_pu_bacteria 2791355253 2793283344 260
819 iso_pu_bacteria 2802428858 2802720313 260
820 iso_pu_bacteria 2802428859 2802726132 260
821 iso_pu_bacteria 2802428860 2802731703 260
822 iso_pu_bacteria 2802428861 2802739454 260
823 iso_pu_bacteria 2802428862 2802742596 260
824 iso_pu_bacteria 2802428863 2802749301 260
825 iso_pu_bacteria 2802429268 2804750917 260
826 iso_pu_bacteria 2838074704 2838075375 260
827 iso_pu_bacteria 2847417321 2847417680 260
828 iso_pu_bacteria 2848992105 2848992485 260
829 iso_pu_bacteria 2850079185 2850079978 260
830 iso_pu_bacteria 2855825444 2855831775 260
831 iso_pu_bacteria 2855839649 2855840006 260
832 iso_pu_bacteria 2855872281 2855874533 260
833 iso_pu_bacteria 2858800743 2858803970 260
834 iso_pu_bacteria 2896384573 2896391552 260
835 iso_pu_bacteria 2913295892 2913297990 260
836 iso_pu_bacteria 2915980308 2915980785 260
837 iso_pu_bacteria 2915986958 2915992627 260
838 iso_pu_bacteria 2915993759 2915999677 260
839 iso_pu_bacteria 2916000859 2916001999 260
840 iso_pu_bacteria 2916007675 2916011985 260
841 iso_pu_bacteria 2916014648 2916016049 260
842 iso_pu_bacteria 2916021584 2916022537 260
843 iso_pu_bacteria 2916028427 2916033363 260
844 iso_pu_bacteria 2916035215 2916038811 260
845 iso_pu_bacteria 2916041962 2916042794 260
846 iso_pu_bacteria 2916048683 2916050252 260
847 iso_pu_bacteria 2916055098 2916057718 260
848 iso_pu_bacteria 2916061851 2916063648 260
849 iso_pu_bacteria 2920760137 2920763391 260
850 iso_pu_bacteria 2921201388 2921207177 260
851 iso_pu_bacteria 2921244191 2921245201 260
852 iso_pu_bacteria 2921250672 2921257157 260
853 iso_pu_bacteria 2921257292 2921260347 260
854 iso_pu_bacteria 2921263974 2921266488 260
855 iso_pu_bacteria 2921282425 2921287562 260
856 iso_pu_bacteria 2921289301 2921291941 260
857 iso_pu_bacteria 2921296804 2921299139 260
858 iso_pu_bacteria 2924144063 2924146051 260
859 iso_pu_bacteria 2924150972 2924154446 260
860 iso_pu_bacteria 2924158325 2924163504 260
861 iso_pu_bacteria 2924165586 2924165983 260
862 iso_pu_bacteria 2924172951 2924174664 260
863 iso_pu_bacteria 2924179722 2924180863 260
864 iso_pu_bacteria 2924186466 2924191817 260
865 iso_pu_bacteria 2924193448 2924194292 260
866 iso_pu_bacteria 2924200457 2924202437 260
867 iso_pu_bacteria 2924207177 2924209669 260
868 iso_pu_bacteria 2924214083 2924218018 260
869 iso_pu_bacteria 2924221636 2924224272 260
870 iso_pu_bacteria 2924228884 2924232994 260
871 iso_pu_bacteria 2936996657 2936999120 260
872 iso_pu_bacteria 2937002841 2937005046 260
873 iso_pu_bacteria 2937009748 2937011327 260
874 iso_pu_bacteria 2937016420 2937018766 260
875 iso_pu_bacteria 2937023124 2937023820 260
876 iso_pu_bacteria 2937029754 2937034528 260
877 iso_pu_bacteria 2937036028 2937041311 260
878 iso_pu_bacteria 2937042894 2937049482 260
879 iso_pu_bacteria 2937049772 2937053987 260
880 iso_pu_bacteria 2937056579 2937060448 260
881 iso_pu_bacteria 2937063883 2937070044 260
882 iso_pu_bacteria 2937071275 2937071519 260
883 iso_pu_bacteria 2937078374 2937078739 260
884 iso_pu_bacteria 2937084907 2937086070 260
885 iso_pu_bacteria 2937098957 2937103439 260
886 iso_pu_bacteria 2937106411 2937110368 260
887 iso_pu_bacteria 2937113482 2937114676 260
888 iso_pu_bacteria 2937119839 2937122586 260
889 iso_pu_bacteria 2937126314 2937128464 260
890 iso_pu_bacteria 2939669807 2939672847 260
891 iso_pu_bacteria 2957375807 2957382056 260
892 iso_pu_bacteria 2957382221 2957383664 260
893 iso_pu_bacteria 2957388812 2957394077 260
894 iso_pu_bacteria 2957395598 2957399558 260
895 iso_pu_bacteria 2957402308 2957403712 260
896 iso_pu_bacteria 2957408893 2957411037 260
897 iso_pu_bacteria 2957415311 2957421564 260
898 iso_pu_bacteria 2957422303 2957426227 260
899 iso_pu_bacteria 2957430029 2957435414 260
900 iso_pu_bacteria 2957437181 2957439532 260
901 iso_pu_bacteria 2957443900 2957447117 260
902 iso_pu_bacteria 2957450854 2957457329 260
903 iso_pu_bacteria 2957457609 2957464401 260
904 iso_pu_bacteria 2957464669 2957466183 260
905 iso_pu_bacteria 2957471148 2957471753 260
906 iso_pu_bacteria 2957478035 2957480326 260
907 iso_pu_bacteria 2957484790 2957489018 260
908 iso_pu_bacteria 2957491536 2957494601 260
909 iso_pu_bacteria 2957498199 2957499058 260
910 iso_pu_bacteria 2957505466 2957508619 260
911 iso_pu_bacteria 2960584000 2960585708 260
912 iso_pu_bacteria 2960591022 2960594767 260
913 iso_pu_bacteria 2960597568 2960599738 260
914 iso_pu_bacteria 2960603979 2960605544 260
915 iso_pu_bacteria 2960610863 2960616934 260
916 iso_pu_bacteria 2960617483 2960621705 260
917 iso_pu_bacteria 2960624210 2960629192 260
918 iso_pu_bacteria 2960631154 2960637456 260
919 iso_pu_bacteria 2960637947 2960644790 260
920 iso_pu_bacteria 2960645483 2960647694 260
921 iso_pu_bacteria 2960652885 2960657207 260
922 iso_pu_bacteria 2960660292 2960660401 260
923 iso_pu_bacteria 2960667422 2960668425 260
924 iso_pu_bacteria 2960674078 2960675592 260
925 iso_pu_bacteria 2960680706 2960686612 260
926 iso_pu_bacteria 2960687367 2960690335 260
927 iso_pu_bacteria 2960693952 2960698823 260
928 iso_pu_bacteria 2964607997 2964609375 260
929 iso_pu_bacteria 2964615318 2964619809 260
930 iso_pu_bacteria 2964621998 2964622434 260
931 iso_pu_bacteria 2964628898 2964634318 260
932 iso_pu_bacteria 2964636051 2964636408 260
933 iso_pu_bacteria 2964643177 2964646967 260
934 iso_pu_bacteria 2964649959 2964650342 260
935 iso_pu_bacteria 2964656573 2964659475 260
936 iso_pu_bacteria 2964663802 2964665802 260
937 iso_pu_bacteria 2964670856 2964674982 260
938 iso_pu_bacteria 2964678106 2964680620 260
939 iso_pu_bacteria 2964685014 2964691101 260
940 iso_pu_bacteria 2964691889 2964693040 260
941 iso_pu_bacteria 2964698721 2964704133 260
942 iso_pu_bacteria 2964705432 2964707185 260
943 iso_pu_bacteria 2964712639 2964718573 260
944 iso_pu_bacteria 2964719344 2964719890 260
945 iso_pu_bacteria 2967664464 2967669776 260
946 iso_pu_bacteria 2967671571 2967678178 260
947 iso_pu_bacteria 2967678726 2967684968 260
948 iso_pu_bacteria 2967686174 2967691526 260
949 iso_pu_bacteria 2967693043 2967695080 260
950 iso_pu_bacteria 2967699805 2967700359 260
951 iso_pu_bacteria 2967706974 2967712776 260
952 iso_pu_bacteria 2967714385 2967714674 260
953 iso_pu_bacteria 2967728569 2967730559 260
954 iso_pu_bacteria 2967735183 2967736321 260
955 iso_pu_bacteria 2967742019 2967747814 260
956 iso_pu_bacteria 2967748971 2967751846 260
957 iso_pu_bacteria 2967755722 2967761298 260
958 iso_pu_bacteria 2967762386 2967762678 260
959 iso_pu_bacteria 2967769361 2967771303 260
960 iso_pu_bacteria 2967775926 2967776734 260
961 iso_pu_bacteria 2970019648 2970023311 260
962 iso_pu_bacteria 2970026789 2970030580 260
963 iso_pu_bacteria 2970033650 2970034021 260
964 iso_pu_bacteria 2970040964 2970045500 260
965 iso_pu_bacteria 2970047711 2970052617 260
966 iso_pu_bacteria 2970054988 2970057420 260
967 iso_pu_bacteria 2970061556 2970063963 260
968 iso_pu_bacteria 2970068827 2970071369 260
969 iso_pu_bacteria 2970076120 2970080401 260
970 iso_pu_bacteria 2970082768 2970087338 260
971 iso_pu_bacteria 2970088815 2970095376 260
972 iso_pu_bacteria 2970095765 2970101514 260
973 iso_pu_bacteria 2970102677 2970103366 260
974 iso_pu_bacteria 2970109326 2970116048 260
975 iso_pu_bacteria 2970116247 2970121902 260
976 iso_pu_bacteria 2970122695 2970126298 260
977 iso_pu_bacteria 2970129317 2970131578 260
978 iso_pu_bacteria 2970136068 2970143474 260
979 iso_pu_bacteria 2970143518 2970148541 260
980 iso_pu_bacteria 2970149975 2970153264 260
981 iso_pu_bacteria 2970156795 2970159522 260
982 iso_pu_bacteria 2970164137 2970167708 260
983 iso_pu_bacteria 2970170962 2970177018 260
984 iso_pu_bacteria 2970177841 2970181887 260
985 iso_pu_bacteria 2970184632 2970188446 260
986 iso_pu_bacteria 2970191845 2970196435 260
987 iso_pu_bacteria 2977516862 2977517728 260
988 iso_pu_bacteria 2977523885 2977529133 260
989 iso_pu_bacteria 2977530762 2977535862 260
990 iso_pu_bacteria 2977537788 2977539988 260
991 iso_pu_bacteria 2977544691 2977549464 260
992 iso_pu_bacteria 2977551784 2977552920 260
993 iso_pu_bacteria 2977558990 2977559279 260
994 iso_pu_bacteria 2977565890 2977567521 260
995 iso_pu_bacteria 2977572785 2977573169 260
996 iso_pu_bacteria 2977579622 2977580448 260
997 iso_pu_bacteria 643692032 643824539 260
998 iso_pu_bacteria 648276728 648739372 260
999 iso_pu_bacteria 8003992118 8003992449 260
1000 iso_pu_bacteria 8003999396 8003999777 260
1001 iso_pu_bacteria 8045864390 8045866279 260
1002 iso_pu_bacteria 8049293176 8049293475 260
1003 3300003215 JGI25153J46596_10001067 JGI25153J46596_100010673 261
1004 3300006195 Ga0075366_10021892 Ga0075366_100218923 261
1005 3300025297 Ga0209758_1001507 Ga0209758_10015072 261
1006 3300025936 Ga0207670_10460986 Ga0207670_104609862 261
1007 3300028794 Ga0307515_10000023 Ga0307515_10000023127 261
1008 3300031456 Ga0307513_10006014 Ga0307513_100060144 261
1009 3300035695 Ga0373927_0000806 Ga0373927_0000806_7498_8313 261
1010 3300037068 Ga0373925_0013258 Ga0373925_0013258_3474_4289 261
1011 3300046660 Ga0495625_0064023 Ga0495625_0064023_1729_2544 261
1012 3300049743 Ga0501081_0262315 Ga0501081_0262315_175_984 261
1013 3300050493 nmdc:mga0k408_37840_c1 nmdc:mga0k408_37840_c1_1385_2197 261
1014 3300050493 nmdc:mga0k408_68174_c1 nmdc:mga0k408_68174_c1_1172_1984 261
1015 3300050513 nmdc:mga0rr50_41028_c1 nmdc:mga0rr50_41028_c1_1254_2072 261
1016 3300050514 nmdc:mga08x19_22_c1 nmdc:mga08x19_22_c1_50137_50955 261
1017 3300053139 Ga0500568_0000205 Ga0500568_0000205_20520_21338 261
1018 3300053139 Ga0500568_0066844 Ga0500568_0066844_49_858 261
1019 iso_pu_bacteria 2503198000 2503200587 261
1020 iso_pu_bacteria 2508501123 2509116880 261
1021 iso_pu_bacteria 2508501127 2509141882 261
1022 iso_pu_bacteria 2509276018 2509373983 261
1023 iso_pu_bacteria 2509276022 2509395375 261
1024 iso_pu_bacteria 2510065059 2510316340 261
1025 iso_pu_bacteria 2511231027 2511389351 261
1026 iso_pu_bacteria 2512875016 2512928794 261
1027 iso_pu_bacteria 2512875024 2512963538 261
1028 iso_pu_bacteria 2513237090 2513612360 261
1029 iso_pu_bacteria 2513237164 2514038189 261
1030 iso_pu_bacteria 2513237305 2514422798 261
1031 iso_pu_bacteria 2513237351 2514590767 261
1032 iso_pu_bacteria 2534681786 2535485290 261
1033 iso_pu_bacteria 2588253730 2588514338 261
1034 iso_pu_bacteria 2597489875 2597811165 261
1035 iso_pu_bacteria 2599185301 2599940577 261
1036 iso_pu_bacteria 2643221550 2643770262 261
1037 iso_pu_bacteria 2643221551 2643778057 261
1038 iso_pu_bacteria 2643221555 2643796505 261
1039 iso_pu_bacteria 2643221564 2643840341 261
1040 iso_pu_bacteria 2643221595 2643989854 261
1041 iso_pu_bacteria 2643221623 2644132498 261
1042 iso_pu_bacteria 2643221627 2644153506 261
1043 iso_pu_bacteria 2687453392 2688597754 261
1044 iso_pu_bacteria 2693429783 2694629152 261
1045 iso_pu_bacteria 2693429784 2694636934 261
1046 iso_pu_bacteria 2721755686 2723578247 261
1047 iso_pu_bacteria 2738543024 2739309602 261
1048 iso_pu_bacteria 2751185800 2753358023 261
1049 iso_pu_bacteria 2756170246 2756676349 261
1050 iso_pu_bacteria 2758568016 2758638830 261
1051 iso_pu_bacteria 2765235802 2765464329 261
1052 iso_pu_bacteria 2767802442 2770194656 261
1053 iso_pu_bacteria 2775506902 2776272542 261
1054 iso_pu_bacteria 2775506904 2776284483 261
1055 iso_pu_bacteria 2791355123 2792750120 261
1056 iso_pu_bacteria 2837651117 2837651952 261
1057 iso_pu_bacteria 2839993093 2839994244 261
1058 iso_pu_bacteria 2840764183 2840769355 261
1059 iso_pu_bacteria 2841734538 2841735624 261
1060 iso_pu_bacteria 2842871566 2842873042 261
1061 iso_pu_bacteria 2844002411 2844004354 261
1062 iso_pu_bacteria 2844009547 2844009853 261
1063 iso_pu_bacteria 2847670302 2847672619 261
1064 iso_pu_bacteria 2847686936 2847691814 261
1065 iso_pu_bacteria 2854911287 2854916251 261
1066 iso_pu_bacteria 2856314179 2856315158 261
1067 iso_pu_bacteria 2856320880 2856328166 261
1068 iso_pu_bacteria 2856328259 2856329858 261
1069 iso_pu_bacteria 2856334872 2856338767 261
1070 iso_pu_bacteria 2856342000 2856346631 261
1071 iso_pu_bacteria 2856364286 2856367610 261
1072 iso_pu_bacteria 2857349434 2857353652 261
1073 iso_pu_bacteria 2857367948 2857371920 261
1074 iso_pu_bacteria 2869162929 2869166964 261
1075 iso_pu_bacteria 2869169390 2869172489 261
1076 iso_pu_bacteria 2869234852 2869235717 261
1077 iso_pu_bacteria 2869242130 2869244336 261
1078 iso_pu_bacteria 2869249662 2869256717 261
1079 iso_pu_bacteria 2869256925 2869258705 261
1080 iso_pu_bacteria 2869264136 2869266048 261
1081 iso_pu_bacteria 2869271264 2869276259 261
1082 iso_pu_bacteria 2869278585 2869284299 261
1083 iso_pu_bacteria 2869285874 2869286818 261
1084 iso_pu_bacteria 2871429161 2871434082 261
1085 iso_pu_bacteria 2871444079 2871451033 261
1086 iso_pu_bacteria 2871451962 2871454746 261
1087 iso_pu_bacteria 2871459585 2871462916 261
1088 iso_pu_bacteria 2871466892 2871474267 261
1089 iso_pu_bacteria 2871474448 2871475683 261
1090 iso_pu_bacteria 2871481445 2871483939 261
1091 iso_pu_bacteria 2871488783 2871490078 261
1092 iso_pu_bacteria 2871495908 2871501989 261
1093 iso_pu_bacteria 2874102143 2874107154 261
1094 iso_pu_bacteria 2874109183 2874111819 261
1095 iso_pu_bacteria 2874116593 2874118188 261
1096 iso_pu_bacteria 2874123672 2874126822 261
1097 iso_pu_bacteria 2874131515 2874132334 261
1098 iso_pu_bacteria 2874139085 2874139238 261
1099 iso_pu_bacteria 2874146452 2874147740 261
1100 iso_pu_bacteria 2874155637 2874156658 261
1101 iso_pu_bacteria 2874162495 2874163841 261
1102 iso_pu_bacteria 2874168670 2874170895 261
1103 iso_pu_bacteria 2876363079 2876369163 261
1104 iso_pu_bacteria 2876377896 2876378442 261
1105 iso_pu_bacteria 2876386047 2876386215 261
1106 iso_pu_bacteria 2876392853 2876393784 261
1107 iso_pu_bacteria 2876399893 2876401499 261
1108 iso_pu_bacteria 2876413966 2876414768 261
1109 iso_pu_bacteria 2876420981 2876421596 261
1110 iso_pu_bacteria 2878035449 2878041987 261
1111 iso_pu_bacteria 2878730984 2878736119 261
1112 iso_pu_bacteria 2878738818 2878740085 261
1113 iso_pu_bacteria 2878745973 2878746792 261
1114 iso_pu_bacteria 2878753008 2878753237 261
1115 iso_pu_bacteria 2878760144 2878765774 261
1116 iso_pu_bacteria 2878767105 2878772448 261
1117 iso_pu_bacteria 2878774303 2878775284 261
1118 iso_pu_bacteria 2878781027 2878781186 261
1119 iso_pu_bacteria 2881155292 2881158433 261
1120 iso_pu_bacteria 2881161766 2881164085 261
1121 iso_pu_bacteria 2881845957 2881847276 261
1122 iso_pu_bacteria 2881861095 2881867778 261
1123 iso_pu_bacteria 2882632389 2882634307 261
1124 iso_pu_bacteria 2882912400 2882912866 261
1125 iso_pu_bacteria 2885305155 2885308820 261
1126 iso_pu_bacteria 2885318864 2885319094 261
1127 iso_pu_bacteria 2885326080 2885332328 261
1128 iso_pu_bacteria 2885334103 2885335947 261
1129 iso_pu_bacteria 2885342637 2885349542 261
1130 iso_pu_bacteria 2885350715 2885354795 261
1131 iso_pu_bacteria 2888337043 2888342457 261
1132 iso_pu_bacteria 2888343758 2888346304 261
1133 iso_pu_bacteria 2888350351 2888351802 261
1134 iso_pu_bacteria 2889010040 2889013776 261
1135 iso_pu_bacteria 2889016732 2889021522 261
1136 iso_pu_bacteria 2894652903 2894655391 261
1137 iso_pu_bacteria 2894817345 2894819416 261
1138 iso_pu_bacteria 2903448605 2903449371 261
1139 iso_pu_bacteria 2903492973 2903497998 261
1140 iso_pu_bacteria 2903492973 2903500680 261
1141 iso_pu_bacteria 2903513507 2903515962 261
1142 iso_pu_bacteria 2903521522 2903526369 261
1143 iso_pu_bacteria 2903528002 2903529656 261
1144 iso_pu_bacteria 2903540706 2903546720 261
1145 iso_pu_bacteria 2904578770 2904579082 261
1146 iso_pu_bacteria 2904659560 2904660509 261
1147 iso_pu_bacteria 2906308376 2906309172 261
1148 iso_pu_bacteria 2906321335 2906326779 261
1149 iso_pu_bacteria 2906328253 2906328732 261
1150 iso_pu_bacteria 2906354277 2906357193 261
1151 iso_pu_bacteria 2906363423 2906365194 261
1152 iso_pu_bacteria 2906370794 2906372139 261
1153 iso_pu_bacteria 2906401398 2906406115 261
1154 iso_pu_bacteria 2906408224 2906412301 261
1155 iso_pu_bacteria 2906414383 2906415155 261
1156 iso_pu_bacteria 2915650412 2915652847 261
1157 iso_pu_bacteria 2917554339 2917555967 261
1158 iso_pu_bacteria 2919119836 2919122090 261
1159 iso_pu_bacteria 2922130491 2922136560 261
1160 iso_pu_bacteria 2922151315 2922157492 261
1161 iso_pu_bacteria 2922158528 2922160061 261
1162 iso_pu_bacteria 2922172374 2922174598 261
1163 iso_pu_bacteria 2922178524 2922183264 261
1164 iso_pu_bacteria 2922185730 2922189179 261
1165 iso_pu_bacteria 2924726620 2924728221 261
1166 iso_pu_bacteria 2924733363 2924738438 261
1167 iso_pu_bacteria 2924741084 2924747272 261
1168 iso_pu_bacteria 2924748358 2924754203 261
1169 iso_pu_bacteria 2924754689 2924757633 261
1170 iso_pu_bacteria 2924762789 2924765499 261
1171 iso_pu_bacteria 2924776078 2924777684 261
1172 iso_pu_bacteria 2924784321 2924791166 261
1173 iso_pu_bacteria 2928521798 2928521972 261
1174 iso_pu_bacteria 2937813078 2937813969 261
1175 iso_pu_bacteria 2937822353 2937828722 261
1176 iso_pu_bacteria 2937836603 2937837047 261
1177 iso_pu_bacteria 2937843397 2937845197 261
1178 iso_pu_bacteria 2937848649 2937850882 261
1179 iso_pu_bacteria 2937861824 2937863172 261
1180 iso_pu_bacteria 2937868953 2937874196 261
1181 iso_pu_bacteria 2937877337 2937883902 261
1182 iso_pu_bacteria 2937891427 2937892388 261
1183 iso_pu_bacteria 2937972304 2937976653 261
1184 iso_pu_bacteria 2937980651 2937981879 261
1185 iso_pu_bacteria 2937994558 2938000579 261
1186 iso_pu_bacteria 2938014810 2938015395 261
1187 iso_pu_bacteria 2954011201 2954014671 261
1188 iso_pu_bacteria 2958034702 2958038397 261
1189 iso_pu_bacteria 2958041894 2958056007 261
1190 iso_pu_bacteria 2958041894 2958056370 261
1191 iso_pu_bacteria 2958064165 2958066458 261
1192 iso_pu_bacteria 2958071322 2958075381 261
1193 iso_pu_bacteria 2958084443 2958091180 261
1194 iso_pu_bacteria 2958092219 2958098955 261
1195 iso_pu_bacteria 2958100919 2958102913 261
1196 iso_pu_bacteria 2958108152 2958114968 261
1197 iso_pu_bacteria 2958115193 2958121449 261
1198 iso_pu_bacteria 2958122699 2958125021 261
1199 iso_pu_bacteria 2958130278 2958131222 261
1200 iso_pu_bacteria 2958144490 2958151158 261
1201 iso_pu_bacteria 2958158011 2958163523 261
1202 iso_pu_bacteria 2958165035 2958170950 261
1203 iso_pu_bacteria 2958172287 2958174207 261
1204 iso_pu_bacteria 2958179912 2958180621 261
1205 iso_pu_bacteria 2961077736 2961078455 261
1206 iso_pu_bacteria 2961114664 2961120831 261
1207 iso_pu_bacteria 2961136820 2961137081 261
1208 iso_pu_bacteria 2961163497 2961169394 261
1209 iso_pu_bacteria 2961170736 2961177061 261
1210 iso_pu_bacteria 2961183825 2961184271 261
1211 iso_pu_bacteria 2963644680 2963650439 261
1212 iso_pu_bacteria 2965018300 2965023646 261
1213 iso_pu_bacteria 2965025482 2965031047 261
1214 iso_pu_bacteria 2965032056 2965035567 261
1215 iso_pu_bacteria 2965040258 2965040347 261
1216 iso_pu_bacteria 2965062239 2965067219 261
1217 iso_pu_bacteria 2965110997 2965115132 261
1218 iso_pu_bacteria 2965119406 2965121531 261
1219 iso_pu_bacteria 2967996073 2968002813 261
1220 iso_pu_bacteria 2968003550 2968005210 261
1221 iso_pu_bacteria 2968016561 2968021298 261
1222 iso_pu_bacteria 2968083720 2968085612 261
1223 iso_pu_bacteria 2968091066 2968095268 261
1224 iso_pu_bacteria 2968097103 2968101239 261
1225 iso_pu_bacteria 2968110612 2968111568 261
1226 iso_pu_bacteria 2968117919 2968120210 261
1227 iso_pu_bacteria 2968128360 2968128613 261
1228 iso_pu_bacteria 2968171901 2968177784 261
1229 iso_pu_bacteria 2970469710 2970476403 261
1230 iso_pu_bacteria 2970489779 2970491393 261
1231 iso_pu_bacteria 2970503327 2970509734 261
1232 iso_pu_bacteria 2970510686 2970516056 261
1233 iso_pu_bacteria 2970524798 2970527812 261
1234 iso_pu_bacteria 2970532167 2970532485 261
1235 iso_pu_bacteria 2970540015 2970541928 261
1236 iso_pu_bacteria 2970547951 2970554658 261
1237 iso_pu_bacteria 2970554993 2970560630 261
1238 iso_pu_bacteria 2970593180 2970598915 261
1239 iso_pu_bacteria 2970619444 2970620938 261
1240 iso_pu_bacteria 2970627176 2970628607 261
1241 iso_pu_bacteria 2977821940 2977822170 261
1242 iso_pu_bacteria 2977828996 2977835541 261
1243 iso_pu_bacteria 2977843712 2977846967 261
1244 iso_pu_bacteria 2977851361 2977854915 261
1245 iso_pu_bacteria 2977858184 2977859098 261
1246 iso_pu_bacteria 2977864932 2977865319 261
1247 iso_pu_bacteria 2977872689 2977879351 261
1248 iso_pu_bacteria 2977907340 2977913816 261
1249 iso_pu_bacteria 2977922695 2977923858 261
1250 iso_pu_bacteria 2977935797 2977937066 261
1251 iso_pu_bacteria 2977942078 2977945747 261
1252 iso_pu_bacteria 2977971508 2977979669 261
1253 iso_pu_bacteria 2977986579 2977989984 261
1254 iso_pu_bacteria 2979710463 2979710603 261
1255 iso_pu_bacteria 2979764755 2979764888 261
1256 iso_pu_bacteria 2979772303 2979774499 261
1257 iso_pu_bacteria 2979779861 2979780033 261
1258 iso_pu_bacteria 2979793036 2979797620 261
1259 iso_pu_bacteria 2979808191 2979814521 261
1260 iso_pu_bacteria 2987636660 2987642935 261
1261 iso_pu_bacteria 2987645492 2987645850 261
1262 iso_pu_bacteria 2987652177 2987654527 261
1263 iso_pu_bacteria 2987659509 2987665628 261
1264 iso_pu_bacteria 2987666974 2987671735 261
1265 iso_pu_bacteria 2987673487 2987680931 261
1266 iso_pu_bacteria 2996310559 2996312907 261
1267 iso_pu_bacteria 2996336353 2996337642 261
1268 iso_pu_bacteria 2996341866 2996346062 261
1269 iso_pu_bacteria 2996348954 2996356395 261
1270 iso_pu_bacteria 2996386984 2996393962 261
1271 iso_pu_bacteria 3000135777 3000142382 261
1272 iso_pu_bacteria 3002141150 3002142635 261
1273 iso_pu_bacteria 3004167301 3004172300 261
1274 iso_pu_bacteria 3004188549 3004194582 261
1275 iso_pu_bacteria 3004195979 3004197774 261
1276 iso_pu_bacteria 3004203850 3004210728 261
1277 iso_pu_bacteria 3004211236 3004213296 261
1278 iso_pu_bacteria 3004218560 3004221368 261
1279 iso_pu_bacteria 3004232784 3004236236 261
1280 iso_pu_bacteria 3004268573 3004271607 261
1281 iso_pu_bacteria 3004275668 3004282699 261
1282 iso_pu_bacteria 3004289098 3004294588 261
1283 iso_pu_bacteria 3004334049 3004338364 261
1284 iso_pu_bacteria 637000159 637078492 261
1285 iso_pu_bacteria 649633066 649872297 261
1286 iso_pu_bacteria 8002285264 8002288290 261
1287 iso_pu_bacteria 8004300914 8004307328 261
1288 iso_pu_bacteria 8004312739 8004320707 261
1289 iso_pu_bacteria 8004374579 8004374808 261
1290 iso_pu_bacteria 8004387939 8004388102 261
1291 iso_pu_bacteria 8004395343 8004403783 261
1292 iso_pu_bacteria 8004445564 8004447206 261
1293 iso_pu_bacteria 8004633249 8004639099 261
1294 iso_pu_bacteria 8004640170 8004644526 261
1295 iso_pu_bacteria 8004695233 8004697201 261
1296 iso_pu_bacteria 8004703790 8004713182 261
1297 iso_pu_bacteria 8004714634 8004715429 261
1298 iso_pu_bacteria 8055617313 8055619096 261
1299 3300002773 JGI25152J39213_1001989 JGI25152J39213_10019892 262
1300 3300002773 JGI25152J39213_1003655 JGI25152J39213_10036552 262
1301 3300002773 JGI25152J39213_1003941 JGI25152J39213_10039415 262
1302 3300002773 JGI25152J39213_1006110 JGI25152J39213_10061102 262
1303 3300002773 JGI25152J39213_1006231 JGI25152J39213_10062312 262
1304 3300002774 JGI25150J39212_1000012 JGI25150J39212_100001288 262
1305 3300002774 JGI25150J39212_1000635 JGI25150J39212_10006352 262
1306 3300002774 JGI25150J39212_1004118 JGI25150J39212_10041182 262
1307 3300002774 JGI25150J39212_1013033 JGI25150J39212_10130331 262
1308 3300002987 JGI25159J45721_1000903 JGI25159J45721_10009032 262
1309 3300003187 JGI25151J46595_10000025 JGI25151J46595_10000025128 262
1310 3300003187 JGI25151J46595_10005451 JGI25151J46595_100054512 262
1311 3300003215 JGI25153J46596_10001672 JGI25153J46596_100016722 262
1312 3300003215 JGI25153J46596_10014039 JGI25153J46596_100140392 262
1313 3300003215 JGI25153J46596_10014326 JGI25153J46596_100143262 262
1314 3300003374 JGI25161J50226_1000074 JGI25161J50226_100007425 262
1315 3300003771 Ga0055526_1003529 Ga0055526_10035292 262
1316 3300003771 Ga0055526_1015038 Ga0055526_10150383 262
1317 3300003775 Ga0055524_1005796 Ga0055524_10057962 262
1318 3300003775 Ga0055524_1029125 Ga0055524_10291252 262
1319 3300003775 Ga0055524_1038230 Ga0055524_10382302 262
1320 3300003790 Ga0055528_1000642 Ga0055528_100064214 262
1321 3300003790 Ga0055528_1001522 Ga0055528_10015229 262
1322 3300003790 Ga0055528_1031997 Ga0055528_10319971 262
1323 3300003792 Ga0055540_1000471 Ga0055540_100047122 262
1324 3300003792 Ga0055540_1002010 Ga0055540_10020105 262
1325 3300003792 Ga0055540_1016068 Ga0055540_10160682 262
1326 3300004625 Ga0055543_1000141 Ga0055543_10001414 262
1327 3300005331 Ga0070670_100305429 Ga0070670_1003054292 262
1328 3300005355 Ga0070671_100005795 Ga0070671_1000057952 262
1329 3300005367 Ga0070667_100393777 Ga0070667_1003937772 262
1330 3300006038 Ga0075365_10003968 Ga0075365_100039684 262
1331 3300006178 Ga0075367_10000124 Ga0075367_1000012416 262
1332 3300006186 Ga0075369_10001413 Ga0075369_100014134 262
1333 3300009011 Ga0105251_10010361 Ga0105251_100103613 262
1334 3300009177 Ga0105248_10014988 Ga0105248_100149883 262
1335 3300009763 Ga0123340_1051759 Ga0123340_10517592 262
1336 3300009766 Ga0123342_1014771 Ga0123342_10147714 262
1337 3300009766 Ga0123342_1029482 Ga0123342_10294822 262
1338 3300025208 Ga0209436_100429 Ga0209436_1004299 262
1339 3300025245 Ga0207425_1000012 Ga0207425_1000012290 262
1340 3300025245 Ga0207425_1001525 Ga0207425_10015254 262
1341 3300025245 Ga0207425_1006553 Ga0207425_10065532 262
1342 3300025258 Ga0209129_1000081 Ga0209129_100008171 262
1343 3300025258 Ga0209129_1000726 Ga0209129_10007264 262
1344 3300025258 Ga0209129_1001366 Ga0209129_100136612 262
1345 3300025258 Ga0209129_1002322 Ga0209129_10023222 262
1346 3300025258 Ga0209129_1010413 Ga0209129_10104132 262
1347 3300025273 Ga0209673_1000967 Ga0209673_10009678 262
1348 3300025273 Ga0209673_1001074 Ga0209673_100107419 262
1349 3300025273 Ga0209673_1003197 Ga0209673_10031974 262
1350 3300025273 Ga0209673_1005594 Ga0209673_10055943 262
1351 3300025284 Ga0209130_1000002 Ga0209130_100000257 262
1352 3300025292 Ga0209676_1012908 Ga0209676_10129082 262
1353 3300025294 Ga0209025_1000024 Ga0209025_1000024290 262
1354 3300025294 Ga0209025_1000528 Ga0209025_100052828 262
1355 3300025294 Ga0209025_1003580 Ga0209025_10035803 262
1356 3300025294 Ga0209025_1007670 Ga0209025_10076705 262
1357 3300025294 Ga0209025_1014304 Ga0209025_10143043 262
1358 3300025294 Ga0209025_1022843 Ga0209025_10228432 262
1359 3300025294 Ga0209025_1052054 Ga0209025_10520542 262
1360 3300025295 Ga0209564_1000382 Ga0209564_100038271 262
1361 3300025295 Ga0209564_1000830 Ga0209564_100083025 262
1362 3300025295 Ga0209564_1016131 Ga0209564_10161312 262
1363 3300025295 Ga0209564_1051984 Ga0209564_10519842 262
1364 3300025297 Ga0209758_1000046 Ga0209758_1000046252 262
1365 3300025297 Ga0209758_1001048 Ga0209758_100104820 262
1366 3300025297 Ga0209758_1002458 Ga0209758_100245812 262
1367 3300025297 Ga0209758_1002490 Ga0209758_10024906 262
1368 3300025297 Ga0209758_1033320 Ga0209758_10333202 262
1369 3300025299 Ga0209256_1000874 Ga0209256_100087425 262
1370 3300025299 Ga0209256_1005579 Ga0209256_10055792 262
1371 3300025299 Ga0209256_1014814 Ga0209256_10148142 262
1372 3300025299 Ga0209256_1018807 Ga0209256_10188072 262
1373 3300025302 Ga0207426_1000013 Ga0207426_100001357 262
1374 3300025302 Ga0207426_1000172 Ga0207426_1000172111 262
1375 3300025302 Ga0207426_1001124 Ga0207426_100112418 262
1376 3300025303 Ga0209051_1000084 Ga0209051_1000084136 262
1377 3300025303 Ga0209051_1002801 Ga0209051_10028014 262
1378 3300025303 Ga0209051_1023790 Ga0209051_10237901 262
1379 3300025304 Ga0209257_1002194 Ga0209257_10021945 262
1380 3300025304 Ga0209257_1021726 Ga0209257_10217262 262
1381 3300025904 Ga0207647_10149812 Ga0207647_101498122 262
1382 3300025941 Ga0207711_10116001 Ga0207711_101160012 262
1383 3300028794 Ga0307515_10004227 Ga0307515_1000422726 262
1384 3300031235 Ga0265330_10083083 Ga0265330_100830832 262
1385 3300031247 Ga0265340_10012328 Ga0265340_100123285 262
1386 3300031247 Ga0265340_10045406 Ga0265340_100454062 262
1387 3300031344 Ga0265316_10057891 Ga0265316_100578912 262
1388 3300031456 Ga0307513_10192335 Ga0307513_101923352 262
1389 3300031595 Ga0265313_10003820 Ga0265313_100038206 262
1390 3300031595 Ga0265313_10029972 Ga0265313_100299723 262
1391 3300031711 Ga0265314_10036703 Ga0265314_100367033 262
1392 3300031712 Ga0265342_10018121 Ga0265342_100181212 262
1393 3300031712 Ga0265342_10207728 Ga0265342_102077282 262
1394 3300031731 Ga0307405_10015383 Ga0307405_100153832 262
1395 3300031901 Ga0307406_10046275 Ga0307406_100462753 262
1396 3300031911 Ga0307412_10027331 Ga0307412_100273312 262
1397 3300041413 Ga0439465_0001471 Ga0439465_0001471_6765_7583 262
1398 3300041413 Ga0439465_0004192 Ga0439465_0004192_3130_3948 262
1399 3300041413 Ga0439465_0053697 Ga0439465_0053697_372_1190 262
1400 3300041494 Ga0451837_1340741 Ga0451837_1340741_439_1257 262
1401 3300042006 Ga0439432_022899 Ga0439432_022899_1189_2007 262
1402 3300042006 Ga0439432_034204 Ga0439432_034204_119_937 262
1403 3300042007 Ga0439449_0100599 Ga0439449_0100599_237_1058 262
1404 3300046453 Ga0495627_083255 Ga0495627_083255_38_856 262
1405 3300046471 Ga0495650_0034324 Ga0495650_0034324_16_834 262
1406 3300046474 Ga0495605_0128815 Ga0495605_0128815_303_1121 262
1407 3300046492 Ga0495585_0004077 Ga0495585_0004077_1067_1885 262
1408 3300046492 Ga0495585_0151849 Ga0495585_0151849_13_831 262
1409 3300046506 Ga0495583_0001709 Ga0495583_0001709_4969_5787 262
1410 3300046506 Ga0495583_0015869 Ga0495583_0015869_1128_1946 262
1411 3300046512 Ga0495610_0001297 Ga0495610_0001297_17959_18777 262
1412 3300046513 Ga0495616_0016614 Ga0495616_0016614_223_1041 262
1413 3300046513 Ga0495616_0123801 Ga0495616_0123801_175_993 262
1414 3300046515 Ga0495620_0019139 Ga0495620_0019139_589_1407 262
1415 3300046518 Ga0495631_0000651 Ga0495631_0000651_1540_2358 262
1416 3300046519 Ga0495632_0015871 Ga0495632_0015871_3168_3986 262
1417 3300046519 Ga0495632_0028828 Ga0495632_0028828_147_965 262
1418 3300046524 Ga0495648_0047779 Ga0495648_0047779_1787_2605 262
1419 3300046530 Ga0495654_0001032 Ga0495654_0001032_17031_17852 262
1420 3300046530 Ga0495654_0113723 Ga0495654_0113723_14_832 262
1421 3300046538 Ga0495609_0058088 Ga0495609_0058088_306_1124 262
1422 3300046616 Ga0495668_0003018 Ga0495668_0003018_12030_12848 262
1423 3300046648 Ga0495611_0095065 Ga0495611_0095065_537_1355 262
1424 3300046660 Ga0495625_0001384 Ga0495625_0001384_9875_10693 262
1425 3300046660 Ga0495625_0243837 Ga0495625_0243837_121_942 262
1426 3300046810 Ga0495660_0029351 Ga0495660_0029351_295_1113 262
1427 3300047320 Ga0495672_0024115 Ga0495672_0024115_1269_2087 262
1428 3300047469 Ga0495673_0033885 Ga0495673_0033885_864_1682 262
1429 3300047472 Ga0495686_0005372 Ga0495686_0005372_244_1062 262
1430 3300047472 Ga0495686_0213673 Ga0495686_0213673_49_867 262
1431 3300048090 Ga0495615_0042369 Ga0495615_0042369_180_998 262
1432 3300048904 Ga0496101_0215314 Ga0496101_0215314_549_1367 262
1433 3300048909 Ga0496106_0021532 Ga0496106_0021532_3563_4381 262
1434 3300048919 Ga0496116_0001443 Ga0496116_0001443_16893_17711 262
1435 3300048919 Ga0496116_0002283 Ga0496116_0002283_7120_7938 262
1436 3300048919 Ga0496116_0055920 Ga0496116_0055920_418_1236 262
1437 3300048919 Ga0496116_0188455 Ga0496116_0188455_15_833 262
1438 3300048920 Ga0496117_0004761 Ga0496117_0004761_8595_9413 262
1439 3300048920 Ga0496117_0005892 Ga0496117_0005892_5327_6145 262
1440 3300048920 Ga0496117_0047517 Ga0496117_0047517_2030_2848 262
1441 3300048920 Ga0496117_0052840 Ga0496117_0052840_1779_2597 262
1442 3300048921 Ga0496118_0007687 Ga0496118_0007687_5305_6123 262
1443 3300048921 Ga0496118_0029929 Ga0496118_0029929_1912_2730 262
1444 3300048921 Ga0496118_0038968 Ga0496118_0038968_762_1580 262
1445 3300048922 Ga0496119_0204399 Ga0496119_0204399_31_849 262
1446 3300048924 Ga0496121_0004125 Ga0496121_0004125_6700_7518 262
1447 3300048924 Ga0496121_0021858 Ga0496121_0021858_3255_4073 262
1448 3300048924 Ga0496121_0063365 Ga0496121_0063365_531_1349 262
1449 3300048924 Ga0496121_0143804 Ga0496121_0143804_886_1704 262
1450 3300048924 Ga0496121_0285018 Ga0496121_0285018_224_1042 262
1451 3300048925 Ga0496122_0001050 Ga0496122_0001050_19858_20676 262
1452 3300048925 Ga0496122_0002628 Ga0496122_0002628_15175_15993 262
1453 3300048925 Ga0496122_0013396 Ga0496122_0013396_5144_5962 262
1454 3300048925 Ga0496122_0031795 Ga0496122_0031795_3081_3899 262
1455 3300048925 Ga0496122_0046656 Ga0496122_0046656_2020_2838 262
1456 3300048926 Ga0496123_0000158 Ga0496123_0000158_27666_28484 262
1457 3300048926 Ga0496123_0005487 Ga0496123_0005487_1543_2361 262
1458 3300048926 Ga0496123_0017583 Ga0496123_0017583_2560_3378 262
1459 3300048926 Ga0496123_0053756 Ga0496123_0053756_1679_2497 262
1460 3300048927 Ga0496124_0000743 Ga0496124_0000743_34535_35353 262
1461 3300048927 Ga0496124_0003963 Ga0496124_0003963_7157_7975 262
1462 3300048927 Ga0496124_0011436 Ga0496124_0011436_1326_2144 262
1463 3300048927 Ga0496124_0034825 Ga0496124_0034825_567_1385 262
1464 3300048927 Ga0496124_0041399 Ga0496124_0041399_509_1327 262
1465 3300048927 Ga0496124_0261566 Ga0496124_0261566_179_997 262
1466 3300048928 Ga0496125_0000695 Ga0496125_0000695_42328_43146 262
1467 3300048928 Ga0496125_0013510 Ga0496125_0013510_3832_4650 262
1468 3300048928 Ga0496125_0016113 Ga0496125_0016113_193_1011 262
1469 3300048929 Ga0496126_0000195 Ga0496126_0000195_107026_107844 262
1470 3300049459 Ga0495678_011095 Ga0495678_011095_2917_3735 262
1471 3300049459 Ga0495678_077409 Ga0495678_077409_239_1060 262
1472 3300049568 Ga0501031_0217196 Ga0501031_0217196_25_843 262
1473 3300049569 Ga0501032_0081072 Ga0501032_0081072_1165_1983 262
1474 3300049569 Ga0501032_0097643 Ga0501032_0097643_147_965 262
1475 3300049571 Ga0501034_0148265 Ga0501034_0148265_494_1312 262
1476 3300049571 Ga0501034_0224552 Ga0501034_0224552_10_828 262
1477 3300049572 Ga0501036_0146725 Ga0501036_0146725_1153_1971 262
1478 3300049572 Ga0501036_0165501 Ga0501036_0165501_210_1031 262
1479 3300049573 Ga0501037_0189083 Ga0501037_0189083_378_1196 262
1480 3300049574 Ga0501038_0131033 Ga0501038_0131033_73_891 262
1481 3300049575 Ga0501039_0342868 Ga0501039_0342868_333_1154 262
1482 3300049579 Ga0501043_0010702 Ga0501043_0010702_3604_4422 262
1483 3300049579 Ga0501043_0210303 Ga0501043_0210303_283_1101 262
1484 3300049581 Ga0501047_0056209 Ga0501047_0056209_2946_3764 262
1485 3300049581 Ga0501047_0087523 Ga0501047_0087523_1471_2289 262
1486 3300049583 Ga0501067_0036197 Ga0501067_0036197_1089_1907 262
1487 3300049585 Ga0501069_0076670 Ga0501069_0076670_579_1400 262
1488 3300049586 Ga0501070_0120810 Ga0501070_0120810_205_1026 262
1489 3300049589 Ga0501073_0096224 Ga0501073_0096224_1053_1874 262
1490 3300049589 Ga0501073_0197845 Ga0501073_0197845_30_848 262
1491 3300049742 Ga0501080_0050494 Ga0501080_0050494_2095_2913 262
1492 3300049742 Ga0501080_0455512 Ga0501080_0455512_211_1032 262
1493 3300049744 Ga0501083_0090776 Ga0501083_0090776_228_1046 262
1494 3300049776 Ga0501280_003795 Ga0501280_003795_1319_2140 262
1495 3300049823 Ga0501044_0053659 Ga0501044_0053659_3140_3958 262
1496 3300049823 Ga0501044_0098638 Ga0501044_0098638_731_1549 262
1497 3300049823 Ga0501044_0126201 Ga0501044_0126201_918_1736 262
1498 3300053093 Ga0500651_0167214 Ga0500651_0167214_384_1202 262
1499 3300053109 Ga0500569_001278 Ga0500569_001278_996_1814 262
1500 3300053118 Ga0500594_0002582 Ga0500594_0002582_31_849 262
1501 3300053125 Ga0500618_001151 Ga0500618_001151_7547_8368 262
1502 3300053139 Ga0500568_0000924 Ga0500568_0000924_5250_6068 262
1503 3300053139 Ga0500568_0004782 Ga0500568_0004782_4960_5778 262
1504 3300053151 Ga0500604_0050123 Ga0500604_0050123_113_931 262
1505 3300053153 Ga0500616_0002449 Ga0500616_0002449_5611_6429 262
1506 3300053156 Ga0500622_0001035 Ga0500622_0001035_18705_19523 262
1507 3300053156 Ga0500622_0132185 Ga0500622_0132185_307_1125 262
1508 3300053160 Ga0500633_0009280 Ga0500633_0009280_128_946 262
1509 3300006038 Ga0075365_10138288 Ga0075365_101382882 263
1510 3300021320 Ga0214544_1000012 Ga0214544_1000012147 263
1511 3300021321 Ga0214542_1000011 Ga0214542_1000011141 263
1512 3300021321 Ga0214542_1017282 Ga0214542_10172825 263
1513 3300021327 Ga0214543_1000004 Ga0214543_1000004359 263
1514 3300021327 Ga0214543_1000256 Ga0214543_100025642 263
1515 3300027111 Ga0209281_1000519 Ga0209281_10005197 263
1516 3300032002 Ga0307416_100603293 Ga0307416_1006032932 263
1517 3300050494 nmdc:mga06z11_62571_c1 nmdc:mga06z11_62571_c1_38_856 263
1518 3300050516 nmdc:mga0sz30_175615_c1 nmdc:mga0sz30_175615_c1_103_921 263
1519 3300005336 Ga0070680_100036295 Ga0070680_1000362954 264
1520 3300005337 Ga0070682_100040460 Ga0070682_1000404601 264
1521 3300005339 Ga0070660_100218298 Ga0070660_1002182981 264
1522 3300005341 Ga0070691_10158127 Ga0070691_101581271 264
1523 3300005366 Ga0070659_100032393 Ga0070659_1000323932 264
1524 3300005440 Ga0070705_100012932 Ga0070705_1000129323 264
1525 3300005441 Ga0070700_100267034 Ga0070700_1002670341 264
1526 3300005455 Ga0070663_100071387 Ga0070663_1000713872 264
1527 3300005458 Ga0070681_10006028 Ga0070681_100060285 264
1528 3300005530 Ga0070679_100014502 Ga0070679_1000145022 264
1529 3300005539 Ga0068853_100015631 Ga0068853_1000156315 264
1530 3300005546 Ga0070696_100032028 Ga0070696_1000320282 264
1531 3300005548 Ga0070665_100003769 Ga0070665_1000037696 264
1532 3300005563 Ga0068855_100288527 Ga0068855_1002885272 264
1533 3300005564 Ga0070664_100156462 Ga0070664_1001564622 264
1534 3300005614 Ga0068856_100479612 Ga0068856_1004796121 264
1535 3300005615 Ga0070702_100062629 Ga0070702_1000626292 264
1536 3300005843 Ga0068860_100461223 Ga0068860_1004612232 264
1537 3300006038 Ga0075365_10174103 Ga0075365_101741032 264
1538 3300009101 Ga0105247_10056622 Ga0105247_100566222 264
1539 3300009148 Ga0105243_10067473 Ga0105243_100674732 264
1540 3300009174 Ga0105241_10050610 Ga0105241_100506103 264
1541 3300009545 Ga0105237_10041352 Ga0105237_100413523 264
1542 3300010375 Ga0105239_10143028 Ga0105239_101430283 264
1543 3300013296 Ga0157374_10535891 Ga0157374_105358912 264
1544 3300013297 Ga0157378_10071978 Ga0157378_100719782 264
1545 3300025900 Ga0207710_10119331 Ga0207710_101193312 264
1546 3300025904 Ga0207647_10009890 Ga0207647_100098902 264
1547 3300025914 Ga0207671_10118463 Ga0207671_101184632 264
1548 3300025917 Ga0207660_10118213 Ga0207660_101182133 264
1549 3300025919 Ga0207657_10135462 Ga0207657_101354622 264
1550 3300025921 Ga0207652_10515267 Ga0207652_105152671 264
1551 3300025945 Ga0207679_10109678 Ga0207679_101096782 264
1552 3300026067 Ga0207678_10000100 Ga0207678_1000010012 264
1553 3300026078 Ga0207702_10446584 Ga0207702_104465841 264
1554 3300028379 Ga0268266_10003101 Ga0268266_100031019 264
1555 3300028381 Ga0268264_10051148 Ga0268264_100511482 264
1556 3300046460 Ga0495638_0022249 Ga0495638_0022249_2609_3427 264
1557 3300047472 Ga0495686_0031564 Ga0495686_0031564_131_946 264
1558 3300048904 Ga0496101_0051851 Ga0496101_0051851_1613_2437 264
1559 3300048905 Ga0496102_0007685 Ga0496102_0007685_7920_8744 264
1560 3300048906 Ga0496103_0025599 Ga0496103_0025599_1475_2299 264
1561 3300048907 Ga0496104_0445266 Ga0496104_0445266_67_891 264
1562 3300048909 Ga0496106_0070794 Ga0496106_0070794_460_1284 264
1563 3300048910 Ga0496107_0032993 Ga0496107_0032993_778_1602 264
1564 3300048918 Ga0496115_0050412 Ga0496115_0050412_1180_2004 264
1565 3300048918 Ga0496115_0120401 Ga0496115_0120401_1185_2003 264
1566 3300049580 Ga0501046_0026209 Ga0501046_0026209_3580_4404 264
1567 3300049583 Ga0501067_0028159 Ga0501067_0028159_1016_1840 264
1568 3300049823 Ga0501044_0032199 Ga0501044_0032199_3179_4003 264
1569 3300053158 Ga0500627_0052506 Ga0500627_0052506_919_1734 264
1570 3300001979 JGI24740J21852_10003648 JGI24740J21852_100036482 265
1571 3300002705 JGI25156J39149_1011633 JGI25156J39149_10116333 265
1572 3300002741 JGI25157J39369_1002049 JGI25157J39369_10020495 265
1573 3300003763 Ga0055529_1003391 Ga0055529_10033912 265
1574 3300005548 Ga0070665_100781846 Ga0070665_1007818461 265
1575 3300005614 Ga0068856_100246320 Ga0068856_1002463202 265
1576 3300006038 Ga0075365_10015283 Ga0075365_100152832 265
1577 3300006042 Ga0075368_10074969 Ga0075368_100749692 265
1578 3300006048 Ga0075363_100022130 Ga0075363_1000221302 265
1579 3300006048 Ga0075363_100112488 Ga0075363_1001124882 265
1580 3300006051 Ga0075364_10022542 Ga0075364_100225422 265
1581 3300006051 Ga0075364_10162493 Ga0075364_101624932 265
1582 3300006177 Ga0075362_10049994 Ga0075362_100499942 265
1583 3300006177 Ga0075362_10051585 Ga0075362_100515852 265
1584 3300006178 Ga0075367_10045731 Ga0075367_100457313 265
1585 3300009093 Ga0105240_10712829 Ga0105240_107128292 265
1586 3300009174 Ga0105241_10088427 Ga0105241_100884272 265
1587 3300009174 Ga0105241_10293398 Ga0105241_102933982 265
1588 3300009545 Ga0105237_10034925 Ga0105237_100349253 265
1589 3300009545 Ga0105237_10563059 Ga0105237_105630592 265
1590 3300009545 Ga0105237_10882249 Ga0105237_108822491 265
1591 3300009553 Ga0105249_10438761 Ga0105249_104387612 265
1592 3300010375 Ga0105239_10028240 Ga0105239_100282404 265
1593 3300010375 Ga0105239_10073717 Ga0105239_100737172 265
1594 3300010375 Ga0105239_10124983 Ga0105239_101249831 265
1595 3300013105 Ga0157369_10083884 Ga0157369_100838842 265
1596 3300013306 Ga0163162_10964457 Ga0163162_109644572 265
1597 3300013307 Ga0157372_10451691 Ga0157372_104516912 265
1598 3300015261 Ga0182006_1022618 Ga0182006_10226183 265
1599 3300015262 Ga0182007_10016195 Ga0182007_100161952 265
1600 3300025246 Ga0209646_1009151 Ga0209646_10091512 265
1601 3300025250 Ga0209026_1000116 Ga0209026_100011655 265
1602 3300025254 Ga0209148_1000256 Ga0209148_100025611 265
1603 3300025256 Ga0209759_1000153 Ga0209759_100015369 265
1604 3300025261 Ga0209233_1000047 Ga0209233_1000047291 265
1605 3300025261 Ga0209233_1006535 Ga0209233_10065352 265
1606 3300025272 Ga0209455_1000409 Ga0209455_100040919 265
1607 3300025904 Ga0207647_10015550 Ga0207647_100155503 265
1608 3300025909 Ga0207705_10138964 Ga0207705_101389642 265
1609 3300025911 Ga0207654_10075474 Ga0207654_100754742 265
1610 3300025913 Ga0207695_10147766 Ga0207695_101477662 265
1611 3300025914 Ga0207671_10032373 Ga0207671_100323732 265
1612 3300025914 Ga0207671_10187119 Ga0207671_101871191 265
1613 3300025914 Ga0207671_10334587 Ga0207671_103345871 265
1614 3300025919 Ga0207657_10105467 Ga0207657_101054672 265
1615 3300025932 Ga0207690_10259193 Ga0207690_102591932 265
1616 3300025937 Ga0207669_10141686 Ga0207669_101416862 265
1617 3300025986 Ga0207658_10208395 Ga0207658_102083951 265
1618 3300026116 Ga0207674_10106290 Ga0207674_101062901 265
1619 3300026121 Ga0207683_10111605 Ga0207683_101116052 265
1620 3300026142 Ga0207698_10630914 Ga0207698_106309141 265
1621 3300026142 Ga0207698_10678705 Ga0207698_106787051 265
1622 3300027866 Ga0209813_10021450 Ga0209813_100214502 265
1623 3300028379 Ga0268266_10515040 Ga0268266_105150401 265
1624 3300028379 Ga0268266_10801064 Ga0268266_108010641 265
1625 3300037312 Ga0395899_0000014 Ga0395899_0000014_219422_220243 265
1626 3300037418 Ga0395900_0000007 Ga0395900_0000007_219441_220262 265
1627 3300037466 Ga0395898_0000011 Ga0395898_0000011_268599_269420 265
1628 3300037471 Ga0395905_0000008 Ga0395905_0000008_219441_220262 265
1629 3300037471 Ga0395905_0011842 Ga0395905_0011842_2180_2998 265
1630 3300038443 Ga0395901_0000020 Ga0395901_0000020_45499_46320 265
1631 3300038443 Ga0395901_0027701 Ga0395901_0027701_2420_3238 265
1632 3300044683 Ga0466965_0240164 Ga0466965_0240164_91_909 265
1633 3300044901 Ga0466960_0003639 Ga0466960_0003639_3581_4399 265
1634 3300046460 Ga0495638_0131159 Ga0495638_0131159_386_1204 265
1635 3300046616 Ga0495668_0017367 Ga0495668_0017367_1476_2294 265
1636 3300046660 Ga0495625_0017986 Ga0495625_0017986_397_1215 265
1637 3300046665 Ga0495661_0216745 Ga0495661_0216745_26_844 265
1638 3300048913 Ga0496110_0122735 Ga0496110_0122735_841_1659 265
1639 3300048915 Ga0496112_0025119 Ga0496112_0025119_3908_4726 265
1640 3300048916 Ga0496113_0280657 Ga0496113_0280657_121_939 265
1641 3300048922 Ga0496119_0018827 Ga0496119_0018827_3611_4429 265
1642 3300048922 Ga0496119_0062517 Ga0496119_0062517_1004_1822 265
1643 3300048923 Ga0496120_0009069 Ga0496120_0009069_2097_2915 265
1644 3300048923 Ga0496120_0184618 Ga0496120_0184618_87_905 265
1645 3300048929 Ga0496126_0086852 Ga0496126_0086852_398_1216 265
1646 3300049569 Ga0501032_0000587 Ga0501032_0000587_17543_18364 265
1647 3300049569 Ga0501032_0049889 Ga0501032_0049889_267_1088 265
1648 3300049570 Ga0501033_0000076 Ga0501033_0000076_56935_57759 265
1649 3300049570 Ga0501033_0000521 Ga0501033_0000521_3157_3978 265
1650 3300049570 Ga0501033_0016419 Ga0501033_0016419_3517_4338 265
1651 3300049570 Ga0501033_0141001 Ga0501033_0141001_582_1403 265
1652 3300049571 Ga0501034_0001873 Ga0501034_0001873_2606_3430 265
1653 3300049571 Ga0501034_0008667 Ga0501034_0008667_2412_3236 265
1654 3300049571 Ga0501034_0166741 Ga0501034_0166741_1003_1824 265
1655 3300049571 Ga0501034_0479686 Ga0501034_0479686_247_1065 265
1656 3300049572 Ga0501036_0002844 Ga0501036_0002844_6653_7477 265
1657 3300049572 Ga0501036_0084228 Ga0501036_0084228_1709_2530 265
1658 3300049573 Ga0501037_0000224 Ga0501037_0000224_413_1234 265
1659 3300049573 Ga0501037_0000812 Ga0501037_0000812_6666_7490 265
1660 3300049573 Ga0501037_0062874 Ga0501037_0062874_125_946 265
1661 3300049574 Ga0501038_0000241 Ga0501038_0000241_23281_24105 265
1662 3300049574 Ga0501038_0109237 Ga0501038_0109237_384_1205 265
1663 3300049574 Ga0501038_0277545 Ga0501038_0277545_181_1002 265
1664 3300049574 Ga0501038_0442920 Ga0501038_0442920_86_907 265
1665 3300049575 Ga0501039_0000196 Ga0501039_0000196_23429_24253 265
1666 3300049575 Ga0501039_0319359 Ga0501039_0319359_356_1177 265
1667 3300049579 Ga0501043_0000005 Ga0501043_0000005_31923_32744 265
1668 3300049579 Ga0501043_0000043 Ga0501043_0000043_61658_62482 265
1669 3300049579 Ga0501043_0372383 Ga0501043_0372383_174_995 265
1670 3300049580 Ga0501046_0038328 Ga0501046_0038328_2906_3730 265
1671 3300049581 Ga0501047_0005104 Ga0501047_0005104_1247_2068 265
1672 3300049581 Ga0501047_0049610 Ga0501047_0049610_127_948 265
1673 3300049581 Ga0501047_0052545 Ga0501047_0052545_2899_3720 265
1674 3300049583 Ga0501067_0045622 Ga0501067_0045622_1272_2093 265
1675 3300049584 Ga0501068_0027596 Ga0501068_0027596_124_945 265
1676 3300049585 Ga0501069_0000011 Ga0501069_0000011_27234_28055 265
1677 3300049585 Ga0501069_0055908 Ga0501069_0055908_394_1215 265
1678 3300049585 Ga0501069_0159404 Ga0501069_0159404_387_1208 265
1679 3300049586 Ga0501070_0000117 Ga0501070_0000117_16885_17706 265
1680 3300049586 Ga0501070_0001936 Ga0501070_0001936_16481_17302 265
1681 3300049586 Ga0501070_0004936 Ga0501070_0004936_1715_2536 265
1682 3300049587 Ga0501071_0005058 Ga0501071_0005058_3375_4196 265
1683 3300049589 Ga0501073_0027903 Ga0501073_0027903_2983_3804 265
1684 3300049590 Ga0501074_0002555 Ga0501074_0002555_10415_11236 265
1685 3300049590 Ga0501074_0033856 Ga0501074_0033856_2738_3559 265
1686 3300049741 Ga0501079_0337543 Ga0501079_0337543_247_1068 265
1687 3300049742 Ga0501080_0005693 Ga0501080_0005693_9904_10725 265
1688 3300049742 Ga0501080_0014905 Ga0501080_0014905_3792_4613 265
1689 3300049742 Ga0501080_0525103 Ga0501080_0525103_148_969 265
1690 3300049744 Ga0501083_0000406 Ga0501083_0000406_15587_16408 265
1691 3300049822 Ga0501035_0000107 Ga0501035_0000107_28131_28952 265
1692 3300049822 Ga0501035_0000449 Ga0501035_0000449_23314_24138 265
1693 3300049822 Ga0501035_0001177 Ga0501035_0001177_20915_21736 265
1694 3300049822 Ga0501035_0007710 Ga0501035_0007710_4660_5481 265
1695 3300049822 Ga0501035_0342862 Ga0501035_0342862_206_1027 265
1696 3300049823 Ga0501044_0000154 Ga0501044_0000154_77004_77825 265
1697 3300049823 Ga0501044_0008423 Ga0501044_0008423_9044_9865 265
1698 3300049823 Ga0501044_0010150 Ga0501044_0010150_6127_6951 265
1699 3300049823 Ga0501044_0085982 Ga0501044_0085982_1990_2811 265
1700 3300049823 Ga0501044_0087274 Ga0501044_0087274_2152_2973 265
1701 3300049823 Ga0501044_0091619 Ga0501044_0091619_1833_2654 265
1702 3300049823 Ga0501044_0280465 Ga0501044_0280465_633_1454 265
1703 3300050489 nmdc:mga03683_51889_c1 nmdc:mga03683_51889_c1_109_927 265
1704 3300050490 nmdc:mga03n38_3995_c1 nmdc:mga03n38_3995_c1_76_894 265
1705 3300050491 nmdc:mga00v17_132932_c1 nmdc:mga00v17_132932_c1_135_953 265
1706 3300050492 nmdc:mga0yw44_1917_c1 nmdc:mga0yw44_1917_c1_4453_5271 265
1707 3300050492 nmdc:mga0yw44_96982_c1 nmdc:mga0yw44_96982_c1_248_1066 265
1708 3300050494 nmdc:mga06z11_52758_c1 nmdc:mga06z11_52758_c1_95_913 265
1709 3300050494 nmdc:mga06z11_91541_c1 nmdc:mga06z11_91541_c1_186_1004 265
1710 3300050495 nmdc:mga04h51_56754_c1 nmdc:mga04h51_56754_c1_430_1248 265
1711 3300050496 nmdc:mga07m45_123910_c1 nmdc:mga07m45_123910_c1_131_949 265
1712 3300053079 Ga0500610_0064816 Ga0500610_0064816_327_1145 265
1713 3300053134 Ga0500658_0141410 Ga0500658_0141410_58_876 265
1714 3300053153 Ga0500616_0017030 Ga0500616_0017030_20_838 265
1715 3300053155 Ga0500620_029555 Ga0500620_029555_560_1378 265
1716 3300053158 Ga0500627_0101530 Ga0500627_0101530_212_1030 265
1717 3300054114 Ga0501084_0238511 Ga0501084_0238511_298_1119 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

63

246

0.78

Feature Viewer

pLDDT pTM Quality
60.97 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map