F495458
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1717 | 1175 | 911 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0057690|Ga0496104_0057690_108_905 |
| Length | 254 |
| Sequence | MKRGKFDITVLTLGFAYSFNASKLVTVWGGFSLQWYKSMWSNQGLMDAAWVTLRVGILSATIGTILGTLAALSLTRFARFPGRVLFSGMIYAPLVMPEVITGLSLLLLFVAVGVDRGFWTVVIAHTTFTMCYVAIVVQSRLLTFDRSLEEAALDLGCPPVKTFFRITLPLIFPAVIAFTLSLDDLVIASFATGPGATTLPIKIYSQVRLGVTPEINAICTILIGLVTIGVIVASVASKRTELQRMRDEHAAARN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 8 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 9 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 10 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 11 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 12 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 13 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 14 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 15 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 16 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 17 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 18 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 19 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 20 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 21 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 22 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 23 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 24 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 25 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 26 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 27 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 28 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 29 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 30 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 31 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 32 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 33 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 34 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 35 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 36 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 37 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 38 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 39 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 40 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 41 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 42 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 43 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 44 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 45 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 46 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 47 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 48 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 49 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 50 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 51 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 52 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 53 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 54 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 55 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 56 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 57 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 58 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 59 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 60 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 61 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 62 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 63 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 64 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 65 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 66 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 67 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 68 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 69 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 70 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 71 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 72 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 73 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 74 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 75 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 76 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 77 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 78 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 79 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 80 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 81 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 82 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 83 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 84 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 85 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 86 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 87 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 88 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 89 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 90 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 91 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 92 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 93 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 94 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 95 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 96 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 97 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 98 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 99 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 100 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 101 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 102 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 103 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 104 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 105 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 106 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 107 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 108 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 109 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 110 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 111 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 112 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 113 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 114 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 115 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 116 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 117 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 118 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 119 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 120 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 121 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 122 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 123 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 124 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 125 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 126 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 127 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 128 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 129 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 130 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 131 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 132 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 133 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 134 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 135 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 136 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 137 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 138 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 139 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 140 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 141 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 142 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 143 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 144 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 145 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 146 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 147 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 148 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 149 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 150 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 151 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 152 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 153 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 154 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 155 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 156 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 157 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 158 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 159 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 160 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 161 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 162 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 163 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 164 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 165 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 166 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 167 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 168 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 169 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 170 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 171 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 172 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 173 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 174 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 175 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 176 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 177 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 178 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 179 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 180 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 181 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 182 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 183 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 184 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 185 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 186 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 187 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 188 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 189 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 190 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 191 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 192 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 193 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 194 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 195 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 196 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 197 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 198 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 199 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 200 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 201 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 202 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 203 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 204 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 205 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 206 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 207 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 208 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 209 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 210 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 211 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 212 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 213 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 214 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 215 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 216 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 217 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 218 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 219 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 220 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 221 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 222 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 223 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 224 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 225 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 226 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 227 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 228 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 229 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 230 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 231 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 232 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 233 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 234 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 235 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 236 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 237 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 238 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 239 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 240 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 241 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 242 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 243 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 244 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 245 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 246 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 247 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 248 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 249 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 250 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 251 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 252 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 253 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 254 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 255 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 256 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 257 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 258 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 259 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 260 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 261 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 262 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 263 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 264 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 265 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 266 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 267 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 268 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 269 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 270 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 271 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 272 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 273 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 274 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 275 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 276 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 277 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 278 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 279 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 280 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 281 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 282 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 283 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 284 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 285 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 286 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 287 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 288 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 289 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 290 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 291 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 292 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 293 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 294 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 295 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 296 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 297 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 298 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 299 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 300 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 301 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 302 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 303 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 304 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 305 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 306 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 307 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 308 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 309 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 310 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 311 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 312 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 313 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 314 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 315 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 316 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 317 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 318 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 319 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 320 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 321 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 322 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 323 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 324 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 325 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 326 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 327 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 328 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 329 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 330 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 331 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 332 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 333 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 334 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 335 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 336 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 337 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 338 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 339 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 340 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 341 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 342 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 343 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 344 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 345 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 346 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 347 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 348 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 349 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 350 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 351 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 352 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 353 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 354 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 355 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 356 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 357 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 358 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 359 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 360 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 361 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 362 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 363 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 364 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 365 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 366 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 367 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 368 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 369 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 370 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 371 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 372 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 373 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 374 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 375 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 376 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 377 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 378 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 379 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 380 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 381 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 382 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 383 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 384 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 385 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 386 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 387 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 388 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 389 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 390 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 391 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 392 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 393 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 394 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 395 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 396 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 397 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 398 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 399 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 400 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 401 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 402 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 403 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 404 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 405 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 406 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 407 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 408 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 409 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 410 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 411 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 412 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 413 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 414 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 415 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 416 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 417 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 418 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 419 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 420 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 421 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 422 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 423 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 424 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 425 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 426 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 427 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 428 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 429 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 430 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 431 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 432 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 433 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 434 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 435 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 436 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 437 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 438 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 439 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 440 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 441 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 442 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 443 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 444 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 445 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 446 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 447 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 448 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 449 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 450 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 451 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 452 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 453 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 454 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 455 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 456 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 457 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 458 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 459 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 460 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 461 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 462 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 463 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 464 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 465 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 466 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 467 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 468 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 469 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 470 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 471 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 472 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 473 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 474 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 475 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 476 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 477 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 478 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 479 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 480 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 481 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 482 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 483 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 484 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 485 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 486 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 487 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 488 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 489 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 490 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 491 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 492 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 493 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 494 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 495 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 496 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 497 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 498 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 499 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 500 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 501 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 502 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 503 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 504 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 505 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 506 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 507 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 508 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 509 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 510 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 511 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 512 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 513 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 514 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 515 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 516 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 517 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 518 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 519 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 520 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 521 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 522 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 523 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 524 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 525 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 526 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 527 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 528 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 529 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 530 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 531 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 532 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 533 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 534 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 535 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 536 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 537 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 538 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 539 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 540 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 541 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 542 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 543 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 544 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 545 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 546 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 547 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 548 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 549 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 550 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 551 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 552 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 553 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 554 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 555 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 556 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 557 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 558 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 559 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 560 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 561 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 562 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 563 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 564 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 565 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 566 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 567 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 568 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 569 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 570 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 571 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 572 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 573 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 574 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 575 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 576 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 577 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 578 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 579 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 580 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 581 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 582 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 583 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 584 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 585 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 586 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 587 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 588 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 589 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 590 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 591 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 592 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 593 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 594 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 595 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 596 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 597 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 598 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 599 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 600 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 601 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 602 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 603 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 604 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 605 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 606 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 607 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 608 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 609 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 610 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 611 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 612 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 613 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 614 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 615 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 616 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 617 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 618 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 619 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 620 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 621 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 622 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 623 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 624 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 625 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 626 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 627 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 628 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 629 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 630 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 631 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 632 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 633 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 634 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 635 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 636 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 637 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 638 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 639 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 640 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 641 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 642 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 643 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 644 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 645 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 646 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 647 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 648 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 649 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 650 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 651 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 652 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 653 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 654 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 655 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 656 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 657 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 658 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 659 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 660 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 661 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 662 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 663 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 664 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 665 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 666 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 667 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 668 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 669 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 670 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 671 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 672 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 673 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 674 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 675 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 676 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 677 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 678 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 679 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 680 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 681 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 682 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 683 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 684 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 685 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 686 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 687 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 688 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 689 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 690 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 691 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 692 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 693 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 694 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 695 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 696 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 697 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 698 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 699 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 700 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 701 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 702 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 703 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 704 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 705 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 706 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 707 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 708 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 709 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 710 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 711 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 712 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 713 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 714 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 715 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 716 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 717 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 718 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 719 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 720 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 721 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 722 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 723 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 724 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 725 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 726 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 727 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 728 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 729 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 730 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 731 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 732 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 733 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 734 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 735 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 736 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 737 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 738 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 739 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 740 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 741 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 742 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 743 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 744 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 745 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 746 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 747 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 748 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 749 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 750 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 751 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 752 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 753 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 754 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 755 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 756 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 757 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 758 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 759 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 760 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 761 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 762 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 763 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 764 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 765 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 766 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 767 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 768 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 769 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 770 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 771 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 772 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 773 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 774 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 775 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 776 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 777 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 778 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 779 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 780 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 781 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 782 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 783 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 784 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 785 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 786 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 787 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 788 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 789 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 790 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 791 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 792 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 793 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 794 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 795 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 796 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 797 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 798 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 799 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 800 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 801 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 802 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 803 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 804 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 805 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 806 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 807 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 808 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 809 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 810 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 811 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 812 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 813 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 814 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 815 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 816 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 817 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 818 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 819 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 820 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 821 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 822 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 823 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 824 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 825 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 826 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 827 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 828 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 829 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 830 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 831 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 832 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 833 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 834 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 835 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 836 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 837 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 838 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 839 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 840 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 841 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 842 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 843 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 844 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 845 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 846 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 847 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 848 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 849 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 850 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 851 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 852 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 853 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 854 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 855 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 856 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 857 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 858 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 859 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 860 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 861 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 862 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 863 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 864 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 865 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 866 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 867 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 868 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 869 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 870 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 871 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 872 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 873 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 874 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 875 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 876 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 877 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 878 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 879 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 880 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 881 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 882 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 883 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 884 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 885 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 886 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 887 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 888 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 889 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 890 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 891 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 892 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 893 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 894 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 895 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 896 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 897 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 898 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 899 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 900 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 901 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 902 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 903 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 904 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 905 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 906 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 907 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 908 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 909 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 910 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 911 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 912 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 913 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 914 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 915 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 916 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 917 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 918 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 919 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 920 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 921 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 922 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 923 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 924 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 925 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 926 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 927 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 928 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 929 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 930 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 931 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 932 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 933 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 934 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 935 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 936 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 937 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 938 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 939 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 940 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 941 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 942 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 943 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 944 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 945 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 946 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 947 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 948 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 949 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 950 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 951 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 952 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 953 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 954 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 955 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 956 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 957 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 958 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 959 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 960 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 961 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 962 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 963 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 964 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 965 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 966 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 967 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 968 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 969 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 970 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 971 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 972 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 973 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 974 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 975 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 976 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 977 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 978 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 979 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 980 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 981 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 982 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 983 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 984 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 985 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 986 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 987 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 988 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 989 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 990 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 991 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 992 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 993 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 994 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 995 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 996 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 997 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 998 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 999 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 1000 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 1001 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 1002 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 1003 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 1004 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 1005 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 1006 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 1007 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 1008 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 1009 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 1010 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 1011 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 1012 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 1013 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 1014 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 1015 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 1016 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 1017 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 1018 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 1019 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 1020 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 1021 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 1022 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 1023 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1024 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 1025 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 1026 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 1027 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 1028 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 1029 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 1030 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 1031 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 1032 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1033 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1034 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1035 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 1036 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1037 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1038 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1039 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1040 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1041 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1042 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1043 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1044 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 1045 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1046 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1047 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1048 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1049 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1050 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1051 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1052 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1053 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1054 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1055 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1056 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1057 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1058 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1059 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1060 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1061 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1062 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1063 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1064 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1065 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1066 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1067 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1068 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1069 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1070 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1071 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1072 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1073 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1074 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1075 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 1076 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1077 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1078 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1079 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1080 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 1081 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1082 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1083 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 1084 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1085 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 1086 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1087 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 1088 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 1089 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1090 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 1091 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 1092 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 1093 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 1094 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 1095 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 1096 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 1097 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 1098 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 1099 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 1100 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1101 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 1102 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1103 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 1104 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1105 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1106 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 1107 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1108 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 1109 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 1110 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 1111 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1112 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1113 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1114 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 1115 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1116 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1117 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1118 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1119 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1120 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1121 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 1122 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1123 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1124 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1125 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1126 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1127 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1128 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1129 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1130 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 1131 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1132 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1133 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1134 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1135 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1136 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1137 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1138 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1139 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1140 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1141 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1142 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1143 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1144 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1145 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1146 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1147 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1148 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1149 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1150 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1151 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1152 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1153 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1154 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1155 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1156 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1157 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1158 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1159 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1160 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1161 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1162 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1163 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1164 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1165 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1166 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1167 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1168 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 1169 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1170 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1171 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1172 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1173 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1174 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1175 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 52.94 |
| Metatranscriptomes | 0.12 |
| Isolates | 46.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.29 |
| Bulb | 0 |
| Endosphere | 12.81 |
| Nodule | 37.45 |
| Rhizoplane | 2.74 |
| Rhizosphere | 34.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003648 | 3300001979 | Bacteria | 6710 |
| 2 | JGI25156J39149_1011633 | 3300002705 | Bacteria | 1979 |
| 3 | JGI25158J39367_1002742 | 3300002739 | Bacteria | 2807 |
| 4 | JGI25157J39369_1002049 | 3300002741 | Bacteria | 5765 |
| 5 | JGI25152J39213_1001989 | 3300002773 | Bacteria | 8067 |
| 6 | JGI25152J39213_1003655 | 3300002773 | Bacteria | 5173 |
| 7 | JGI25152J39213_1003941 | 3300002773 | Bacteria | 4858 |
| 8 | JGI25152J39213_1005371 | 3300002773 | Bacteria | 3755 |
| 9 | JGI25152J39213_1006110 | 3300002773 | Bacteria | 3353 |
| 10 | JGI25152J39213_1006231 | 3300002773 | Bacteria | 3302 |
| 11 | JGI25150J39212_1000012 | 3300002774 | Bacteria | 182468 |
| 12 | JGI25150J39212_1000635 | 3300002774 | Bacteria | 13309 |
| 13 | JGI25150J39212_1004118 | 3300002774 | Bacteria | 3279 |
| 14 | JGI25150J39212_1013033 | 3300002774 | Bacteria | 1452 |
| 15 | JGI25159J45721_1000016 | 3300002987 | Bacteria | 139656 |
| 16 | JGI25159J45721_1000903 | 3300002987 | Bacteria | 12921 |
| 17 | JGI25151J46595_10000025 | 3300003187 | Bacteria | 213302 |
| 18 | JGI25151J46595_10000346 | 3300003187 | Bacteria | 49745 |
| 19 | JGI25151J46595_10005451 | 3300003187 | Bacteria | 6570 |
| 20 | JGI25151J46595_10005499 | 3300003187 | Bacteria | 6531 |
| 21 | JGI25151J46595_10017127 | 3300003187 | Bacteria | 3152 |
| 22 | JGI25406J46586_10003471 | 3300003203 | Bacteria | 7412 |
| 23 | JGI25406J46586_10004531 | 3300003203 | Bacteria | 6469 |
| 24 | JGI25406J46586_10051175 | 3300003203 | Bacteria | 1383 |
| 25 | JGI25406J46586_10064206 | 3300003203 | Bacteria | 1174 |
| 26 | JGI25153J46596_10001067 | 3300003215 | Bacteria | 16714 |
| 27 | JGI25153J46596_10001672 | 3300003215 | Bacteria | 13149 |
| 28 | JGI25153J46596_10003250 | 3300003215 | Bacteria | 9136 |
| 29 | JGI25153J46596_10007980 | 3300003215 | Bacteria | 5122 |
| 30 | JGI25153J46596_10014039 | 3300003215 | Bacteria | 3353 |
| 31 | JGI25153J46596_10014326 | 3300003215 | Bacteria | 3302 |
| 32 | JGI25160J50197_1000002 | 3300003354 | Bacteria | 561707 |
| 33 | JGI25161J50226_1000074 | 3300003374 | Bacteria | 85547 |
| 34 | JGI25161J50226_1000397 | 3300003374 | Bacteria | 21635 |
| 35 | JGI25161J50226_1006024 | 3300003374 | Bacteria | 2251 |
| 36 | Ga0055529_1003391 | 3300003763 | Bacteria | 2654 |
| 37 | Ga0055526_1001675 | 3300003771 | Bacteria | 15546 |
| 38 | Ga0055526_1003529 | 3300003771 | Bacteria | 9876 |
| 39 | Ga0055526_1003766 | 3300003771 | Bacteria | 9463 |
| 40 | Ga0055526_1015038 | 3300003771 | Bacteria | 3134 |
| 41 | Ga0055526_1016134 | 3300003771 | Bacteria | 2945 |
| 42 | Ga0055524_1000384 | 3300003775 | Bacteria | 38108 |
| 43 | Ga0055524_1005796 | 3300003775 | Bacteria | 5457 |
| 44 | Ga0055524_1006985 | 3300003775 | Bacteria | 4850 |
| 45 | Ga0055524_1011084 | 3300003775 | Bacteria | 3544 |
| 46 | Ga0055524_1029125 | 3300003775 | Bacteria | 1640 |
| 47 | Ga0055524_1038230 | 3300003775 | Bacteria | 1259 |
| 48 | Ga0055524_1050089 | 3300003775 | Bacteria | 956 |
| 49 | Ga0055528_1000642 | 3300003790 | Bacteria | 25591 |
| 50 | Ga0055528_1000866 | 3300003790 | Bacteria | 20524 |
| 51 | Ga0055528_1001522 | 3300003790 | Bacteria | 13999 |
| 52 | Ga0055528_1031997 | 3300003790 | Bacteria | 1355 |
| 53 | Ga0055540_1000471 | 3300003792 | Bacteria | 31092 |
| 54 | Ga0055540_1002010 | 3300003792 | Bacteria | 11314 |
| 55 | Ga0055540_1016068 | 3300003792 | Bacteria | 2147 |
| 56 | Ga0055540_1018350 | 3300003792 | Bacteria | 1919 |
| 57 | Ga0055543_1000022 | 3300004625 | Bacteria | 140745 |
| 58 | Ga0055543_1000141 | 3300004625 | Bacteria | 60055 |
| 59 | Ga0055543_1001242 | 3300004625 | Bacteria | 10604 |
| 60 | Ga0065165_1000058 | 3300005262 | Bacteria | 184784 |
| 61 | Ga0070690_100004984 | 3300005330 | Bacteria | 7433 |
| 62 | Ga0070670_100135511 | 3300005331 | Bacteria | 2128 |
| 63 | Ga0070670_100305429 | 3300005331 | Bacteria | 1392 |
| 64 | Ga0070680_100036295 | 3300005336 | Bacteria | 3982 |
| 65 | Ga0070682_100040460 | 3300005337 | Bacteria | 2868 |
| 66 | Ga0070682_100164415 | 3300005337 | Bacteria | 1536 |
| 67 | Ga0070660_100218298 | 3300005339 | Bacteria | 1549 |
| 68 | Ga0070689_100001622 | 3300005340 | Bacteria | 14368 |
| 69 | Ga0070689_100445583 | 3300005340 | Bacteria | 1101 |
| 70 | Ga0070691_10158127 | 3300005341 | Bacteria | 1167 |
| 71 | Ga0070668_100006623 | 3300005347 | Bacteria | 8584 |
| 72 | Ga0070668_100008269 | 3300005347 | Bacteria | 7723 |
| 73 | Ga0070668_100014191 | 3300005347 | Bacteria | 5952 |
| 74 | Ga0070668_100023623 | 3300005347 | Bacteria | 4651 |
| 75 | Ga0070668_100074040 | 3300005347 | Bacteria | 2656 |
| 76 | Ga0070668_100084250 | 3300005347 | Bacteria | 2496 |
| 77 | Ga0070669_100113247 | 3300005353 | Bacteria | 2061 |
| 78 | Ga0070675_100162214 | 3300005354 | Bacteria | 1923 |
| 79 | Ga0070675_100635039 | 3300005354 | Bacteria | 970 |
| 80 | Ga0070671_100005795 | 3300005355 | Bacteria | 9839 |
| 81 | Ga0070671_100130128 | 3300005355 | Bacteria | 2120 |
| 82 | Ga0070688_100003117 | 3300005365 | Bacteria | 8477 |
| 83 | Ga0070659_100032393 | 3300005366 | Bacteria | 4054 |
| 84 | Ga0070667_100016097 | 3300005367 | Bacteria | 6186 |
| 85 | Ga0070667_100393777 | 3300005367 | Bacteria | 1260 |
| 86 | Ga0070709_10052912 | 3300005434 | Bacteria | 2554 |
| 87 | Ga0070713_100385128 | 3300005436 | Bacteria | 1307 |
| 88 | Ga0070705_100012932 | 3300005440 | Bacteria | 4258 |
| 89 | Ga0070700_100267034 | 3300005441 | Bacteria | 1235 |
| 90 | Ga0070708_100764056 | 3300005445 | Bacteria | 909 |
| 91 | Ga0070663_100071387 | 3300005455 | Bacteria | 2526 |
| 92 | Ga0070678_100098451 | 3300005456 | Bacteria | 2261 |
| 93 | Ga0070681_10006028 | 3300005458 | Bacteria | 11744 |
| 94 | Ga0070679_100014502 | 3300005530 | Bacteria | 7570 |
| 95 | Ga0070684_100134267 | 3300005535 | Bacteria | 2234 |
| 96 | Ga0068853_100015631 | 3300005539 | Bacteria | 6235 |
| 97 | Ga0070696_100032028 | 3300005546 | Bacteria | 3606 |
| 98 | Ga0070665_100003769 | 3300005548 | Bacteria | 16042 |
| 99 | Ga0070665_100004421 | 3300005548 | Bacteria | 14769 |
| 100 | Ga0070665_100025086 | 3300005548 | Bacteria | 6009 |
| 101 | Ga0070665_100781846 | 3300005548 | Bacteria | 968 |
| 102 | Ga0068855_100288527 | 3300005563 | Bacteria | 1820 |
| 103 | Ga0070664_100156462 | 3300005564 | Bacteria | 2014 |
| 104 | Ga0070664_100173555 | 3300005564 | Bacteria | 1913 |
| 105 | Ga0068856_100246320 | 3300005614 | Bacteria | 1802 |
| 106 | Ga0068856_100479612 | 3300005614 | Bacteria | 1264 |
| 107 | Ga0070702_100062629 | 3300005615 | Bacteria | 2169 |
| 108 | Ga0070702_100066993 | 3300005615 | Bacteria | 2108 |
| 109 | Ga0068859_100021694 | 3300005617 | Bacteria | 6445 |
| 110 | Ga0068859_100071069 | 3300005617 | Bacteria | 3516 |
| 111 | Ga0068859_100348761 | 3300005617 | Bacteria | 1575 |
| 112 | Ga0068859_100383314 | 3300005617 | Bacteria | 1501 |
| 113 | Ga0068864_100025873 | 3300005618 | Bacteria | 4945 |
| 114 | Ga0068864_100025900 | 3300005618 | Bacteria | 4943 |
| 115 | Ga0068866_10163645 | 3300005718 | Bacteria | 1300 |
| 116 | Ga0068861_100032017 | 3300005719 | Bacteria | 3869 |
| 117 | Ga0068860_100000083 | 3300005843 | Bacteria | 168189 |
| 118 | Ga0068860_100087672 | 3300005843 | Bacteria | 2963 |
| 119 | Ga0068860_100138148 | 3300005843 | Bacteria | 2341 |
| 120 | Ga0068860_100461223 | 3300005843 | Bacteria | 1264 |
| 121 | Ga0068860_100783811 | 3300005843 | Bacteria | 966 |
| 122 | Ga0068862_100050812 | 3300005844 | Bacteria | 3544 |
| 123 | Ga0068862_100070545 | 3300005844 | Bacteria | 3016 |
| 124 | Ga0068862_100155563 | 3300005844 | Bacteria | 2038 |
| 125 | Ga0068862_100204986 | 3300005844 | Bacteria | 1779 |
| 126 | Ga0068862_100222386 | 3300005844 | Bacteria | 1710 |
| 127 | Ga0068862_100307554 | 3300005844 | Bacteria | 1460 |
| 128 | Ga0081455_10107875 | 3300005937 | Bacteria | 2219 |
| 129 | Ga0081539_10000881 | 3300005985 | Bacteria | 57379 |
| 130 | Ga0081539_10016778 | 3300005985 | Bacteria | 5198 |
| 131 | Ga0070717_10173981 | 3300006028 | Bacteria | 1874 |
| 132 | Ga0075365_10003968 | 3300006038 | Bacteria | 7748 |
| 133 | Ga0075365_10015283 | 3300006038 | Bacteria | 4639 |
| 134 | Ga0075365_10058029 | 3300006038 | Bacteria | 2576 |
| 135 | Ga0075365_10138288 | 3300006038 | Bacteria | 1689 |
| 136 | Ga0075365_10174103 | 3300006038 | Bacteria | 1503 |
| 137 | Ga0075368_10000355 | 3300006042 | Bacteria | 13436 |
| 138 | Ga0075368_10024940 | 3300006042 | Bacteria | 2292 |
| 139 | Ga0075368_10074969 | 3300006042 | Bacteria | 1371 |
| 140 | Ga0075363_100022130 | 3300006048 | Bacteria | 3211 |
| 141 | Ga0075363_100112488 | 3300006048 | Bacteria | 1514 |
| 142 | Ga0075364_10022542 | 3300006051 | Bacteria | 3978 |
| 143 | Ga0075364_10152227 | 3300006051 | Bacteria | 1559 |
| 144 | Ga0075364_10162493 | 3300006051 | Bacteria | 1508 |
| 145 | Ga0075364_10273369 | 3300006051 | Bacteria | 1149 |
| 146 | Ga0070716_100072389 | 3300006173 | Bacteria | 2029 |
| 147 | Ga0075362_10049994 | 3300006177 | Bacteria | 1869 |
| 148 | Ga0075362_10051585 | 3300006177 | Bacteria | 1842 |
| 149 | Ga0075362_10090892 | 3300006177 | Bacteria | 1417 |
| 150 | Ga0075362_10162958 | 3300006177 | Bacteria | 1074 |
| 151 | Ga0075367_10000124 | 3300006178 | Bacteria | 22440 |
| 152 | Ga0075367_10002714 | 3300006178 | Bacteria | 8171 |
| 153 | Ga0075367_10010369 | 3300006178 | Bacteria | 4894 |
| 154 | Ga0075367_10045731 | 3300006178 | Bacteria | 2569 |
| 155 | Ga0075369_10001413 | 3300006186 | Bacteria | 8182 |
| 156 | Ga0075369_10007695 | 3300006186 | Bacteria | 4117 |
| 157 | Ga0075369_10025016 | 3300006186 | Bacteria | 2479 |
| 158 | Ga0075369_10043510 | 3300006186 | Bacteria | 1927 |
| 159 | Ga0075366_10021892 | 3300006195 | Bacteria | 3716 |
| 160 | Ga0075366_10085442 | 3300006195 | Bacteria | 1887 |
| 161 | Ga0075366_10115249 | 3300006195 | Bacteria | 1618 |
| 162 | Ga0097621_100436463 | 3300006237 | Bacteria | 1178 |
| 163 | Ga0075370_10025169 | 3300006353 | Bacteria | 3290 |
| 164 | Ga0075370_10188242 | 3300006353 | Bacteria | 1216 |
| 165 | Ga0097620_100021695 | 3300006931 | Bacteria | 6445 |
| 166 | Ga0097620_100071067 | 3300006931 | Bacteria | 3516 |
| 167 | Ga0097620_100348769 | 3300006931 | Bacteria | 1575 |
| 168 | Ga0097620_100383329 | 3300006931 | Bacteria | 1501 |
| 169 | Ga0099826_10000423 | 3300006948 | Bacteria | 20100 |
| 170 | Ga0099826_10006813 | 3300006948 | Bacteria | 8363 |
| 171 | Ga0099826_10101545 | 3300006948 | Bacteria | 1734 |
| 172 | Ga0099795_10055087 | 3300007788 | Bacteria | 1460 |
| 173 | Ga0105251_10010361 | 3300009011 | Bacteria | 5415 |
| 174 | Ga0105240_10712829 | 3300009093 | Bacteria | 1094 |
| 175 | Ga0111539_10309258 | 3300009094 | Bacteria | 1839 |
| 176 | Ga0105245_10445948 | 3300009098 | Bacteria | 1302 |
| 177 | Ga0105247_10056622 | 3300009101 | Bacteria | 2422 |
| 178 | Ga0105247_10347259 | 3300009101 | Bacteria | 1042 |
| 179 | Ga0114129_10675954 | 3300009147 | Bacteria | 1330 |
| 180 | Ga0105243_10012317 | 3300009148 | Bacteria | 6468 |
| 181 | Ga0105243_10067473 | 3300009148 | Bacteria | 2879 |
| 182 | Ga0105241_10050610 | 3300009174 | Bacteria | 3167 |
| 183 | Ga0105241_10088427 | 3300009174 | Bacteria | 2439 |
| 184 | Ga0105241_10293398 | 3300009174 | Bacteria | 1393 |
| 185 | Ga0105248_10014988 | 3300009177 | Bacteria | 8533 |
| 186 | Ga0105248_10020676 | 3300009177 | Bacteria | 7294 |
| 187 | Ga0105237_10034925 | 3300009545 | Bacteria | 5088 |
| 188 | Ga0105237_10041352 | 3300009545 | Bacteria | 4649 |
| 189 | Ga0105237_10563059 | 3300009545 | Bacteria | 1146 |
| 190 | Ga0105237_10882249 | 3300009545 | Bacteria | 901 |
| 191 | Ga0105249_10438761 | 3300009553 | Bacteria | 1343 |
| 192 | Ga0123340_1051759 | 3300009763 | Bacteria | 1460 |
| 193 | Ga0123342_1014771 | 3300009766 | Bacteria | 7342 |
| 194 | Ga0123342_1029482 | 3300009766 | Bacteria | 2847 |
| 195 | Ga0105239_10028240 | 3300010375 | Bacteria | 6172 |
| 196 | Ga0105239_10073717 | 3300010375 | Bacteria | 3753 |
| 197 | Ga0105239_10124983 | 3300010375 | Bacteria | 2858 |
| 198 | Ga0105239_10143028 | 3300010375 | Bacteria | 2667 |
| 199 | Ga0105246_10467859 | 3300011119 | Bacteria | 1063 |
| 200 | Ga0157373_10001801 | 3300013100 | Bacteria | 16297 |
| 201 | Ga0157371_10000058 | 3300013102 | Bacteria | 171756 |
| 202 | Ga0157370_10000792 | 3300013104 | Bacteria | 39754 |
| 203 | Ga0157369_10083884 | 3300013105 | Bacteria | 3407 |
| 204 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 205 | Ga0157374_10535891 | 3300013296 | Bacteria | 1178 |
| 206 | Ga0157378_10071978 | 3300013297 | Bacteria | 3105 |
| 207 | Ga0163162_10254260 | 3300013306 | Bacteria | 1889 |
| 208 | Ga0163162_10964457 | 3300013306 | Bacteria | 963 |
| 209 | Ga0157372_10451691 | 3300013307 | Bacteria | 1498 |
| 210 | Ga0157375_10195734 | 3300013308 | Bacteria | 2176 |
| 211 | Ga0163163_10009574 | 3300014325 | Bacteria | 8659 |
| 212 | Ga0163163_10128427 | 3300014325 | Bacteria | 2574 |
| 213 | Ga0157376_10177241 | 3300014969 | Bacteria | 1945 |
| 214 | Ga0157376_10679045 | 3300014969 | Bacteria | 1033 |
| 215 | Ga0182006_1022618 | 3300015261 | Bacteria | 2612 |
| 216 | Ga0182007_10016195 | 3300015262 | Bacteria | 2757 |
| 217 | Ga0183363_1012 | 3300015690 | Bacteria | 90054 |
| 218 | Ga0163161_10388757 | 3300017792 | Bacteria | 1116 |
| 219 | Ga0214544_1000012 | 3300021320 | Bacteria | 229808 |
| 220 | Ga0214542_1000011 | 3300021321 | Bacteria | 238260 |
| 221 | Ga0214542_1017282 | 3300021321 | Bacteria | 6588 |
| 222 | Ga0214543_1000004 | 3300021327 | Bacteria | 527190 |
| 223 | Ga0214543_1000256 | 3300021327 | Bacteria | 82084 |
| 224 | Ga0213875_10000030 | 3300021388 | Bacteria | 178500 |
| 225 | Ga0228711_1000019 | 3300022739 | Bacteria | 111795 |
| 226 | Ga0228710_1000022 | 3300022740 | Bacteria | 111795 |
| 227 | Ga0209436_100429 | 3300025208 | Bacteria | 18855 |
| 228 | Ga0209436_100737 | 3300025208 | Bacteria | 13643 |
| 229 | Ga0207425_1000012 | 3300025245 | Bacteria | 528324 |
| 230 | Ga0207425_1001525 | 3300025245 | Bacteria | 9512 |
| 231 | Ga0207425_1003710 | 3300025245 | Bacteria | 4794 |
| 232 | Ga0207425_1006553 | 3300025245 | Bacteria | 3171 |
| 233 | Ga0209646_1009151 | 3300025246 | Bacteria | 1576 |
| 234 | Ga0209026_1000116 | 3300025250 | Bacteria | 133228 |
| 235 | Ga0209148_1000256 | 3300025254 | Bacteria | 83479 |
| 236 | Ga0209759_1000153 | 3300025256 | Bacteria | 119494 |
| 237 | Ga0209129_1000081 | 3300025258 | Bacteria | 183694 |
| 238 | Ga0209129_1000123 | 3300025258 | Bacteria | 133661 |
| 239 | Ga0209129_1000726 | 3300025258 | Bacteria | 21238 |
| 240 | Ga0209129_1001366 | 3300025258 | Bacteria | 13698 |
| 241 | Ga0209129_1002322 | 3300025258 | Bacteria | 9429 |
| 242 | Ga0209129_1010413 | 3300025258 | Bacteria | 2321 |
| 243 | Ga0209129_1019425 | 3300025258 | Bacteria | 1284 |
| 244 | Ga0209233_1000047 | 3300025261 | Bacteria | 459614 |
| 245 | Ga0209233_1006535 | 3300025261 | Bacteria | 3749 |
| 246 | Ga0209455_1000409 | 3300025272 | Bacteria | 34679 |
| 247 | Ga0209673_1000015 | 3300025273 | Bacteria | 530618 |
| 248 | Ga0209673_1000967 | 3300025273 | Bacteria | 35634 |
| 249 | Ga0209673_1001074 | 3300025273 | Bacteria | 30901 |
| 250 | Ga0209673_1001964 | 3300025273 | Bacteria | 16078 |
| 251 | Ga0209673_1003197 | 3300025273 | Bacteria | 9937 |
| 252 | Ga0209673_1005594 | 3300025273 | Bacteria | 6279 |
| 253 | Ga0209130_1000002 | 3300025284 | Bacteria | 722648 |
| 254 | Ga0209130_1000008 | 3300025284 | Bacteria | 581232 |
| 255 | Ga0209130_1011836 | 3300025284 | Bacteria | 2314 |
| 256 | Ga0209676_1012908 | 3300025292 | Bacteria | 3246 |
| 257 | Ga0209025_1000024 | 3300025294 | Bacteria | 528324 |
| 258 | Ga0209025_1000441 | 3300025294 | Bacteria | 81951 |
| 259 | Ga0209025_1000528 | 3300025294 | Bacteria | 72802 |
| 260 | Ga0209025_1000631 | 3300025294 | Bacteria | 62429 |
| 261 | Ga0209025_1000970 | 3300025294 | Bacteria | 43006 |
| 262 | Ga0209025_1003049 | 3300025294 | Bacteria | 16508 |
| 263 | Ga0209025_1003063 | 3300025294 | Bacteria | 16420 |
| 264 | Ga0209025_1003580 | 3300025294 | Bacteria | 14522 |
| 265 | Ga0209025_1007670 | 3300025294 | Bacteria | 7971 |
| 266 | Ga0209025_1014304 | 3300025294 | Bacteria | 4894 |
| 267 | Ga0209025_1022843 | 3300025294 | Bacteria | 3298 |
| 268 | Ga0209025_1052054 | 3300025294 | Bacteria | 1620 |
| 269 | Ga0209564_1000091 | 3300025295 | Bacteria | 249103 |
| 270 | Ga0209564_1000382 | 3300025295 | Bacteria | 81070 |
| 271 | Ga0209564_1000830 | 3300025295 | Bacteria | 41868 |
| 272 | Ga0209564_1001931 | 3300025295 | Bacteria | 18509 |
| 273 | Ga0209564_1005067 | 3300025295 | Bacteria | 7691 |
| 274 | Ga0209564_1016131 | 3300025295 | Bacteria | 2994 |
| 275 | Ga0209564_1025178 | 3300025295 | Bacteria | 2011 |
| 276 | Ga0209564_1051984 | 3300025295 | Bacteria | 989 |
| 277 | Ga0209758_1000046 | 3300025297 | Bacteria | 364931 |
| 278 | Ga0209758_1001048 | 3300025297 | Bacteria | 36241 |
| 279 | Ga0209758_1001507 | 3300025297 | Bacteria | 27061 |
| 280 | Ga0209758_1001962 | 3300025297 | Bacteria | 22243 |
| 281 | Ga0209758_1002450 | 3300025297 | Bacteria | 18942 |
| 282 | Ga0209758_1002458 | 3300025297 | Bacteria | 18888 |
| 283 | Ga0209758_1002490 | 3300025297 | Bacteria | 18719 |
| 284 | Ga0209758_1033320 | 3300025297 | Bacteria | 2072 |
| 285 | Ga0209256_1000180 | 3300025299 | Bacteria | 123687 |
| 286 | Ga0209256_1000541 | 3300025299 | Bacteria | 54431 |
| 287 | Ga0209256_1000874 | 3300025299 | Bacteria | 37312 |
| 288 | Ga0209256_1001340 | 3300025299 | Bacteria | 26171 |
| 289 | Ga0209256_1005494 | 3300025299 | Bacteria | 7255 |
| 290 | Ga0209256_1005579 | 3300025299 | Bacteria | 7162 |
| 291 | Ga0209256_1014814 | 3300025299 | Bacteria | 2772 |
| 292 | Ga0209256_1018807 | 3300025299 | Bacteria | 2226 |
| 293 | Ga0209256_1018895 | 3300025299 | Bacteria | 2218 |
| 294 | Ga0207426_1000013 | 3300025302 | Bacteria | 721897 |
| 295 | Ga0207426_1000016 | 3300025302 | Bacteria | 581232 |
| 296 | Ga0207426_1000063 | 3300025302 | Bacteria | 358920 |
| 297 | Ga0207426_1000172 | 3300025302 | Bacteria | 163690 |
| 298 | Ga0207426_1001124 | 3300025302 | Bacteria | 24372 |
| 299 | Ga0209051_1000084 | 3300025303 | Bacteria | 190324 |
| 300 | Ga0209051_1002801 | 3300025303 | Bacteria | 12034 |
| 301 | Ga0209051_1023790 | 3300025303 | Bacteria | 2538 |
| 302 | Ga0209051_1028922 | 3300025303 | Bacteria | 2179 |
| 303 | Ga0209257_1002194 | 3300025304 | Bacteria | 20197 |
| 304 | Ga0209257_1007835 | 3300025304 | Bacteria | 6315 |
| 305 | Ga0209257_1021726 | 3300025304 | Bacteria | 2319 |
| 306 | Ga0207710_10119331 | 3300025900 | Bacteria | 1258 |
| 307 | Ga0207647_10009890 | 3300025904 | Bacteria | 6755 |
| 308 | Ga0207647_10015550 | 3300025904 | Bacteria | 5214 |
| 309 | Ga0207647_10149812 | 3300025904 | Bacteria | 1364 |
| 310 | Ga0207699_10007510 | 3300025906 | Bacteria | 5333 |
| 311 | Ga0207645_10019613 | 3300025907 | Bacteria | 4432 |
| 312 | Ga0207705_10138964 | 3300025909 | Bacteria | 1813 |
| 313 | Ga0207654_10075474 | 3300025911 | Bacteria | 2015 |
| 314 | Ga0207695_10147766 | 3300025913 | Bacteria | 2292 |
| 315 | Ga0207671_10032373 | 3300025914 | Bacteria | 3893 |
| 316 | Ga0207671_10118463 | 3300025914 | Bacteria | 2022 |
| 317 | Ga0207671_10187119 | 3300025914 | Bacteria | 1613 |
| 318 | Ga0207671_10334587 | 3300025914 | Bacteria | 1199 |
| 319 | Ga0207693_10162802 | 3300025915 | Bacteria | 1756 |
| 320 | Ga0207660_10118213 | 3300025917 | Bacteria | 2005 |
| 321 | Ga0207657_10105467 | 3300025919 | Bacteria | 2333 |
| 322 | Ga0207657_10135462 | 3300025919 | Bacteria | 2016 |
| 323 | Ga0207652_10515267 | 3300025921 | Bacteria | 1076 |
| 324 | Ga0207650_10255069 | 3300025925 | Bacteria | 1421 |
| 325 | Ga0207690_10259193 | 3300025932 | Bacteria | 1346 |
| 326 | Ga0207670_10001231 | 3300025936 | Bacteria | 13520 |
| 327 | Ga0207670_10460986 | 3300025936 | Bacteria | 1026 |
| 328 | Ga0207669_10141686 | 3300025937 | Bacteria | 1670 |
| 329 | Ga0207704_10086021 | 3300025938 | Bacteria | 2049 |
| 330 | Ga0207711_10116001 | 3300025941 | Bacteria | 2387 |
| 331 | Ga0207711_10153095 | 3300025941 | Bacteria | 2082 |
| 332 | Ga0207679_10109678 | 3300025945 | Bacteria | 2175 |
| 333 | Ga0207668_10004893 | 3300025972 | Bacteria | 7880 |
| 334 | Ga0207668_10023824 | 3300025972 | Bacteria | 3941 |
| 335 | Ga0207668_10096720 | 3300025972 | Bacteria | 2183 |
| 336 | Ga0207668_10146336 | 3300025972 | Bacteria | 1823 |
| 337 | Ga0207658_10208395 | 3300025986 | Bacteria | 1637 |
| 338 | Ga0207658_10329177 | 3300025986 | Bacteria | 1324 |
| 339 | Ga0207678_10000100 | 3300026067 | Bacteria | 70537 |
| 340 | Ga0207702_10446584 | 3300026078 | Bacteria | 1254 |
| 341 | Ga0207702_10863996 | 3300026078 | Bacteria | 896 |
| 342 | Ga0207648_10216168 | 3300026089 | Bacteria | 1702 |
| 343 | Ga0207676_10007593 | 3300026095 | Bacteria | 7698 |
| 344 | Ga0207674_10106290 | 3300026116 | Bacteria | 2784 |
| 345 | Ga0207675_100031839 | 3300026118 | Bacteria | 4913 |
| 346 | Ga0207675_100305961 | 3300026118 | Bacteria | 1549 |
| 347 | Ga0207683_10025771 | 3300026121 | Bacteria | 5072 |
| 348 | Ga0207683_10111605 | 3300026121 | Bacteria | 2448 |
| 349 | Ga0207698_10630914 | 3300026142 | Bacteria | 1059 |
| 350 | Ga0207698_10678705 | 3300026142 | Bacteria | 1023 |
| 351 | Ga0209281_1000227 | 3300027111 | Bacteria | 119329 |
| 352 | Ga0209281_1000519 | 3300027111 | Bacteria | 50062 |
| 353 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 354 | Ga0209371_1000547 | 3300027312 | Bacteria | 35249 |
| 355 | Ga0209282_1000042 | 3300027666 | Bacteria | 119329 |
| 356 | Ga0209282_1000224 | 3300027666 | Bacteria | 29523 |
| 357 | Ga0209282_1003866 | 3300027666 | Bacteria | 8997 |
| 358 | Ga0209813_10000358 | 3300027866 | Bacteria | 11644 |
| 359 | Ga0209813_10012420 | 3300027866 | Bacteria | 2251 |
| 360 | Ga0209813_10021450 | 3300027866 | Bacteria | 1816 |
| 361 | Ga0268266_10003101 | 3300028379 | Bacteria | 16931 |
| 362 | Ga0268266_10006291 | 3300028379 | Bacteria | 10886 |
| 363 | Ga0268266_10015355 | 3300028379 | Bacteria | 6572 |
| 364 | Ga0268266_10515040 | 3300028379 | Bacteria | 1143 |
| 365 | Ga0268266_10801064 | 3300028379 | Bacteria | 910 |
| 366 | Ga0268265_10002598 | 3300028380 | Bacteria | 13459 |
| 367 | Ga0268265_10039627 | 3300028380 | Bacteria | 3474 |
| 368 | Ga0268265_10272616 | 3300028380 | Bacteria | 1510 |
| 369 | Ga0268264_10000055 | 3300028381 | Bacteria | 314947 |
| 370 | Ga0268264_10033405 | 3300028381 | Bacteria | 4226 |
| 371 | Ga0268264_10051148 | 3300028381 | Bacteria | 3442 |
| 372 | Ga0268264_10462787 | 3300028381 | Bacteria | 1231 |
| 373 | Ga0265318_10143745 | 3300028577 | Bacteria | 875 |
| 374 | Ga0307515_10000023 | 3300028794 | Bacteria | 400846 |
| 375 | Ga0307515_10004227 | 3300028794 | Bacteria | 29832 |
| 376 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 377 | Ga0268256_1016656 | 3300030500 | Bacteria | 2096 |
| 378 | Ga0265770_1017861 | 3300030878 | Bacteria | 1100 |
| 379 | Ga0265330_10083083 | 3300031235 | Bacteria | 1379 |
| 380 | Ga0265328_10010982 | 3300031239 | Bacteria | 3630 |
| 381 | Ga0265328_10016074 | 3300031239 | Bacteria | 2918 |
| 382 | Ga0265325_10002414 | 3300031241 | Bacteria | 12620 |
| 383 | Ga0265325_10003327 | 3300031241 | Bacteria | 10569 |
| 384 | Ga0265329_10062820 | 3300031242 | Bacteria | 1175 |
| 385 | Ga0265340_10012328 | 3300031247 | Bacteria | 4516 |
| 386 | Ga0265340_10044194 | 3300031247 | Bacteria | 2180 |
| 387 | Ga0265340_10045406 | 3300031247 | Bacteria | 2146 |
| 388 | Ga0265340_10064914 | 3300031247 | Bacteria | 1739 |
| 389 | Ga0265339_10040311 | 3300031249 | Bacteria | 2596 |
| 390 | Ga0265331_10003656 | 3300031250 | Bacteria | 9815 |
| 391 | Ga0265327_10001660 | 3300031251 | Bacteria | 26802 |
| 392 | Ga0265327_10015085 | 3300031251 | Bacteria | 5012 |
| 393 | Ga0265316_10031264 | 3300031344 | Bacteria | 4355 |
| 394 | Ga0265316_10040084 | 3300031344 | Bacteria | 3757 |
| 395 | Ga0265316_10057891 | 3300031344 | Bacteria | 3020 |
| 396 | Ga0265316_10059448 | 3300031344 | Bacteria | 2972 |
| 397 | Ga0307513_10006014 | 3300031456 | Bacteria | 15931 |
| 398 | Ga0307513_10016341 | 3300031456 | Bacteria | 8958 |
| 399 | Ga0307513_10192335 | 3300031456 | Bacteria | 1890 |
| 400 | Ga0265313_10003820 | 3300031595 | Bacteria | 11894 |
| 401 | Ga0265313_10029972 | 3300031595 | Bacteria | 2807 |
| 402 | Ga0265314_10010850 | 3300031711 | Bacteria | 7572 |
| 403 | Ga0265314_10036703 | 3300031711 | Bacteria | 3558 |
| 404 | Ga0265342_10018121 | 3300031712 | Bacteria | 4568 |
| 405 | Ga0265342_10084702 | 3300031712 | Bacteria | 1825 |
| 406 | Ga0265342_10207728 | 3300031712 | Bacteria | 1060 |
| 407 | Ga0307405_10015383 | 3300031731 | Bacteria | 4144 |
| 408 | Ga0307413_10183526 | 3300031824 | Bacteria | 1494 |
| 409 | Ga0307406_10046275 | 3300031901 | Bacteria | 2737 |
| 410 | Ga0307412_10027331 | 3300031911 | Bacteria | 3556 |
| 411 | Ga0307412_10078925 | 3300031911 | Bacteria | 2269 |
| 412 | Ga0307412_10150819 | 3300031911 | Bacteria | 1715 |
| 413 | Ga0315914_1000009 | 3300031967 | Bacteria | 182444 |
| 414 | Ga0307409_100529568 | 3300031995 | Bacteria | 1153 |
| 415 | Ga0307416_100603293 | 3300032002 | Bacteria | 1178 |
| 416 | Ga0307414_10287044 | 3300032004 | Bacteria | 1385 |
| 417 | Ga0307415_100510670 | 3300032126 | Bacteria | 1053 |
| 418 | Ga0315913_1000015 | 3300033430 | Bacteria | 119325 |
| 419 | Ga0315915_1000013 | 3300033464 | Bacteria | 182438 |
| 420 | Ga0373930_0011195 | 3300034816 | Bacteria | 1617 |
| 421 | Ga0373928_0032115 | 3300035084 | Bacteria | 1169 |
| 422 | Ga0373951_0007101 | 3300035091 | Bacteria | 2548 |
| 423 | Ga0373941_0147295 | 3300035115 | Bacteria | 861 |
| 424 | Ga0373943_0000613 | 3300035170 | Bacteria | 15479 |
| 425 | Ga0373931_0070810 | 3300035691 | Bacteria | 1903 |
| 426 | Ga0373935_0005946 | 3300035692 | Bacteria | 7237 |
| 427 | Ga0373927_0000806 | 3300035695 | Bacteria | 23954 |
| 428 | Ga0373947_0000256 | 3300035725 | Bacteria | 29989 |
| 429 | Ga0373947_0346379 | 3300035725 | Bacteria | 996 |
| 430 | Ga0373925_0013258 | 3300037068 | Bacteria | 5965 |
| 431 | Ga0395899_0000014 | 3300037312 | Bacteria | 488813 |
| 432 | Ga0395900_0000007 | 3300037418 | Bacteria | 488860 |
| 433 | Ga0395898_0000011 | 3300037466 | Bacteria | 488860 |
| 434 | Ga0395905_0000008 | 3300037471 | Bacteria | 488860 |
| 435 | Ga0395905_0011842 | 3300037471 | Bacteria | 8419 |
| 436 | Ga0395905_0464233 | 3300037471 | Bacteria | 1165 |
| 437 | Ga0436364_0053004 | 3300037853 | Bacteria | 3170 |
| 438 | Ga0436364_0207431 | 3300037853 | Bacteria | 52858 |
| 439 | Ga0436364_0563011 | 3300037853 | Bacteria | 1123 |
| 440 | Ga0436364_0628381 | 3300037853 | Bacteria | 2046 |
| 441 | Ga0395901_0000020 | 3300038443 | Bacteria | 314918 |
| 442 | Ga0395901_0027330 | 3300038443 | Bacteria | 5861 |
| 443 | Ga0395901_0027701 | 3300038443 | Bacteria | 5826 |
| 444 | Ga0436365_0289217 | 3300039437 | Bacteria | 4910 |
| 445 | Ga0439438_036258 | 3300041405 | Bacteria | 1294 |
| 446 | Ga0439465_0001471 | 3300041413 | Bacteria | 7635 |
| 447 | Ga0439465_0004192 | 3300041413 | Bacteria | 4690 |
| 448 | Ga0439465_0031347 | 3300041413 | Bacteria | 1693 |
| 449 | Ga0439465_0053697 | 3300041413 | Bacteria | 1324 |
| 450 | Ga0451787_397122 | 3300041441 | Bacteria | 1529 |
| 451 | Ga0451807_0622738 | 3300041486 | Bacteria | 1282 |
| 452 | Ga0451837_1340741 | 3300041494 | Bacteria | 1512 |
| 453 | Ga0451839_1498607 | 3300041496 | Bacteria | 1125 |
| 454 | Ga0451841_1101904 | 3300041498 | Bacteria | 886 |
| 455 | Ga0451845_0022414 | 3300041501 | Bacteria | 2111 |
| 456 | Ga0451851_0106610 | 3300041507 | Bacteria | 1084 |
| 457 | Ga0451843_0615050 | 3300041509 | Bacteria | 1756 |
| 458 | Ga0451843_1153044 | 3300041509 | Bacteria | 889 |
| 459 | Ga0451853_4116506 | 3300041512 | Bacteria | 1047 |
| 460 | Ga0439432_022899 | 3300042006 | Bacteria | 2062 |
| 461 | Ga0439432_034204 | 3300042006 | Bacteria | 1633 |
| 462 | Ga0439449_0100599 | 3300042007 | Bacteria | 1069 |
| 463 | Ga0439457_020608 | 3300042014 | Bacteria | 1463 |
| 464 | Ga0450920_028507 | 3300042122 | Bacteria | 1094 |
| 465 | Ga0450906_029462 | 3300042145 | Bacteria | 970 |
| 466 | Ga0439434_0073404 | 3300042435 | Bacteria | 1079 |
| 467 | Ga0450918_001536 | 3300042531 | Bacteria | 4555 |
| 468 | Ga0451577_0048226 | 3300042876 | Bacteria | 3806 |
| 469 | Ga0466965_0240164 | 3300044683 | Bacteria | 970 |
| 470 | Ga0466960_0003639 | 3300044901 | Bacteria | 5950 |
| 471 | Ga0451576_0000457 | 3300045051 | Bacteria | 92619 |
| 472 | Ga0451576_0639612 | 3300045051 | Bacteria | 1118 |
| 473 | Ga0495627_083255 | 3300046453 | Bacteria | 925 |
| 474 | Ga0495638_0022249 | 3300046460 | Bacteria | 4163 |
| 475 | Ga0495638_0023748 | 3300046460 | Bacteria | 4005 |
| 476 | Ga0495638_0099707 | 3300046460 | Bacteria | 1738 |
| 477 | Ga0495638_0131159 | 3300046460 | Bacteria | 1472 |
| 478 | Ga0495650_0034324 | 3300046471 | Bacteria | 2247 |
| 479 | Ga0495580_0044198 | 3300046472 | Bacteria | 3170 |
| 480 | Ga0495605_0128815 | 3300046474 | Bacteria | 1142 |
| 481 | Ga0495585_0004077 | 3300046492 | Bacteria | 9595 |
| 482 | Ga0495585_0025667 | 3300046492 | Bacteria | 3372 |
| 483 | Ga0495585_0151849 | 3300046492 | Bacteria | 1207 |
| 484 | Ga0495596_0059795 | 3300046500 | Bacteria | 1485 |
| 485 | Ga0495607_0033186 | 3300046501 | Bacteria | 3142 |
| 486 | Ga0495583_0001709 | 3300046506 | Bacteria | 21089 |
| 487 | Ga0495583_0015869 | 3300046506 | Bacteria | 4076 |
| 488 | Ga0495583_0039945 | 3300046506 | Bacteria | 2207 |
| 489 | Ga0495610_0001297 | 3300046512 | Bacteria | 22270 |
| 490 | Ga0495610_0013489 | 3300046512 | Bacteria | 4854 |
| 491 | Ga0495616_0016614 | 3300046513 | Bacteria | 4070 |
| 492 | Ga0495616_0046111 | 3300046513 | Bacteria | 2202 |
| 493 | Ga0495616_0123801 | 3300046513 | Bacteria | 1191 |
| 494 | Ga0495618_0181186 | 3300046514 | Bacteria | 1338 |
| 495 | Ga0495620_0016232 | 3300046515 | Bacteria | 3743 |
| 496 | Ga0495620_0019139 | 3300046515 | Bacteria | 3375 |
| 497 | Ga0495630_0004618 | 3300046517 | Bacteria | 9656 |
| 498 | Ga0495631_0000651 | 3300046518 | Bacteria | 22509 |
| 499 | Ga0495631_0103618 | 3300046518 | Bacteria | 1224 |
| 500 | Ga0495632_0015871 | 3300046519 | Bacteria | 4206 |
| 501 | Ga0495632_0028828 | 3300046519 | Bacteria | 2896 |
| 502 | Ga0495643_0053111 | 3300046522 | Bacteria | 2173 |
| 503 | Ga0495648_0027504 | 3300046524 | Bacteria | 3805 |
| 504 | Ga0495648_0047779 | 3300046524 | Bacteria | 2642 |
| 505 | Ga0495666_0012120 | 3300046526 | Bacteria | 4304 |
| 506 | Ga0495654_0001032 | 3300046530 | Bacteria | 20404 |
| 507 | Ga0495654_0079010 | 3300046530 | Bacteria | 1546 |
| 508 | Ga0495654_0113723 | 3300046530 | Bacteria | 1232 |
| 509 | Ga0495665_0042485 | 3300046531 | Bacteria | 2419 |
| 510 | Ga0495640_0123195 | 3300046533 | Bacteria | 1683 |
| 511 | Ga0495609_0058088 | 3300046538 | Bacteria | 1711 |
| 512 | Ga0495597_0031888 | 3300046542 | Bacteria | 2394 |
| 513 | Ga0495633_0060660 | 3300046558 | Bacteria | 1772 |
| 514 | Ga0495668_0003018 | 3300046616 | Bacteria | 13127 |
| 515 | Ga0495668_0017367 | 3300046616 | Bacteria | 4174 |
| 516 | Ga0495668_0031652 | 3300046616 | Bacteria | 2981 |
| 517 | Ga0495611_0095065 | 3300046648 | Bacteria | 1379 |
| 518 | Ga0495625_0001384 | 3300046660 | Bacteria | 29779 |
| 519 | Ga0495625_0017986 | 3300046660 | Bacteria | 5524 |
| 520 | Ga0495625_0064023 | 3300046660 | Bacteria | 2595 |
| 521 | Ga0495625_0113690 | 3300046660 | Bacteria | 1848 |
| 522 | Ga0495625_0243837 | 3300046660 | Bacteria | 1169 |
| 523 | Ga0495661_0216745 | 3300046665 | Bacteria | 994 |
| 524 | Ga0495588_0002043 | 3300046674 | Bacteria | 8626 |
| 525 | Ga0495588_0137928 | 3300046674 | Bacteria | 1288 |
| 526 | Ga0495658_0047318 | 3300046683 | Bacteria | 2422 |
| 527 | Ga0495624_0007453 | 3300046690 | Bacteria | 7678 |
| 528 | Ga0495671_0041827 | 3300046692 | Bacteria | 2306 |
| 529 | Ga0495660_0023466 | 3300046810 | Bacteria | 3517 |
| 530 | Ga0495660_0029351 | 3300046810 | Bacteria | 3104 |
| 531 | Ga0495672_0024115 | 3300047320 | Bacteria | 3926 |
| 532 | Ga0495687_019134 | 3300047443 | Bacteria | 3367 |
| 533 | Ga0495673_0033885 | 3300047469 | Bacteria | 2365 |
| 534 | Ga0495681_0017611 | 3300047470 | Bacteria | 3959 |
| 535 | Ga0495684_0005376 | 3300047471 | Bacteria | 9971 |
| 536 | Ga0495684_0007110 | 3300047471 | Bacteria | 8688 |
| 537 | Ga0495686_0005372 | 3300047472 | Bacteria | 10128 |
| 538 | Ga0495686_0031564 | 3300047472 | Bacteria | 3435 |
| 539 | Ga0495686_0035111 | 3300047472 | Bacteria | 3225 |
| 540 | Ga0495686_0213673 | 3300047472 | Bacteria | 1101 |
| 541 | Ga0495593_0031816 | 3300047673 | Bacteria | 2879 |
| 542 | Ga0495615_0042369 | 3300048090 | Bacteria | 1142 |
| 543 | Ga0496100_0011359 | 3300048903 | Bacteria | 5067 |
| 544 | Ga0496101_0013345 | 3300048904 | Bacteria | 5500 |
| 545 | Ga0496101_0036946 | 3300048904 | Bacteria | 3462 |
| 546 | Ga0496101_0051851 | 3300048904 | Bacteria | 2957 |
| 547 | Ga0496101_0215314 | 3300048904 | Bacteria | 1489 |
| 548 | Ga0496102_0007685 | 3300048905 | Bacteria | 9209 |
| 549 | Ga0496102_0152186 | 3300048905 | Bacteria | 2174 |
| 550 | Ga0496102_0191113 | 3300048905 | Bacteria | 1929 |
| 551 | Ga0496103_0025599 | 3300048906 | Bacteria | 3567 |
| 552 | Ga0496103_0209709 | 3300048906 | Bacteria | 1253 |
| 553 | Ga0496104_0057690 | 3300048907 | Bacteria | 3674 |
| 554 | Ga0496104_0445266 | 3300048907 | Bacteria | 1207 |
| 555 | Ga0496105_0000392 | 3300048908 | Bacteria | 28815 |
| 556 | Ga0496106_0021532 | 3300048909 | Bacteria | 4787 |
| 557 | Ga0496106_0070794 | 3300048909 | Bacteria | 2664 |
| 558 | Ga0496106_0214127 | 3300048909 | Bacteria | 1535 |
| 559 | Ga0496106_0409951 | 3300048909 | Bacteria | 1089 |
| 560 | Ga0496107_0032993 | 3300048910 | Bacteria | 3703 |
| 561 | Ga0496108_0001992 | 3300048911 | Bacteria | 16351 |
| 562 | Ga0496109_0012017 | 3300048912 | Bacteria | 7456 |
| 563 | Ga0496110_0122735 | 3300048913 | Bacteria | 2342 |
| 564 | Ga0496111_0001116 | 3300048914 | Bacteria | 14864 |
| 565 | Ga0496111_0022364 | 3300048914 | Bacteria | 4426 |
| 566 | Ga0496112_0002870 | 3300048915 | Bacteria | 14007 |
| 567 | Ga0496112_0025119 | 3300048915 | Bacteria | 5717 |
| 568 | Ga0496112_0042420 | 3300048915 | Bacteria | 4451 |
| 569 | Ga0496113_0004045 | 3300048916 | Bacteria | 8930 |
| 570 | Ga0496113_0080376 | 3300048916 | Bacteria | 2497 |
| 571 | Ga0496113_0149293 | 3300048916 | Bacteria | 1843 |
| 572 | Ga0496113_0280657 | 3300048916 | Bacteria | 1332 |
| 573 | Ga0496114_0084239 | 3300048917 | Bacteria | 2691 |
| 574 | Ga0496114_0152441 | 3300048917 | Bacteria | 2006 |
| 575 | Ga0496115_0006960 | 3300048918 | Bacteria | 8305 |
| 576 | Ga0496115_0050412 | 3300048918 | Bacteria | 3335 |
| 577 | Ga0496115_0120401 | 3300048918 | Bacteria | 2160 |
| 578 | Ga0496116_0001443 | 3300048919 | Bacteria | 26678 |
| 579 | Ga0496116_0002283 | 3300048919 | Bacteria | 20327 |
| 580 | Ga0496116_0018419 | 3300048919 | Bacteria | 5385 |
| 581 | Ga0496116_0050161 | 3300048919 | Bacteria | 2783 |
| 582 | Ga0496116_0055920 | 3300048919 | Bacteria | 2589 |
| 583 | Ga0496116_0188455 | 3300048919 | Bacteria | 1095 |
| 584 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 585 | Ga0496117_0004761 | 3300048920 | Bacteria | 14728 |
| 586 | Ga0496117_0005892 | 3300048920 | Bacteria | 12664 |
| 587 | Ga0496117_0047517 | 3300048920 | Bacteria | 3076 |
| 588 | Ga0496117_0052840 | 3300048920 | Bacteria | 2859 |
| 589 | Ga0496117_0104866 | 3300048920 | Bacteria | 1778 |
| 590 | Ga0496118_0000233 | 3300048921 | Bacteria | 97731 |
| 591 | Ga0496118_0007687 | 3300048921 | Bacteria | 11337 |
| 592 | Ga0496118_0029929 | 3300048921 | Bacteria | 4556 |
| 593 | Ga0496118_0038968 | 3300048921 | Bacteria | 3800 |
| 594 | Ga0496119_0001089 | 3300048922 | Bacteria | 34251 |
| 595 | Ga0496119_0018827 | 3300048922 | Bacteria | 5116 |
| 596 | Ga0496119_0020869 | 3300048922 | Bacteria | 4755 |
| 597 | Ga0496119_0061517 | 3300048922 | Bacteria | 2241 |
| 598 | Ga0496119_0062517 | 3300048922 | Bacteria | 2218 |
| 599 | Ga0496119_0204399 | 3300048922 | Bacteria | 1020 |
| 600 | Ga0496120_0000021 | 3300048923 | Bacteria | 250966 |
| 601 | Ga0496120_0009069 | 3300048923 | Bacteria | 7105 |
| 602 | Ga0496120_0184618 | 3300048923 | Bacteria | 1021 |
| 603 | Ga0496121_0004125 | 3300048924 | Bacteria | 19907 |
| 604 | Ga0496121_0021858 | 3300048924 | Bacteria | 6246 |
| 605 | Ga0496121_0063365 | 3300048924 | Bacteria | 3021 |
| 606 | Ga0496121_0143804 | 3300048924 | Bacteria | 1765 |
| 607 | Ga0496121_0194844 | 3300048924 | Bacteria | 1449 |
| 608 | Ga0496121_0215073 | 3300048924 | Bacteria | 1358 |
| 609 | Ga0496121_0281058 | 3300048924 | Bacteria | 1138 |
| 610 | Ga0496121_0285018 | 3300048924 | Bacteria | 1128 |
| 611 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 612 | Ga0496122_0001050 | 3300048925 | Bacteria | 48341 |
| 613 | Ga0496122_0002105 | 3300048925 | Bacteria | 29496 |
| 614 | Ga0496122_0002628 | 3300048925 | Bacteria | 25114 |
| 615 | Ga0496122_0013396 | 3300048925 | Bacteria | 8030 |
| 616 | Ga0496122_0031795 | 3300048925 | Bacteria | 4381 |
| 617 | Ga0496122_0032728 | 3300048925 | Bacteria | 4293 |
| 618 | Ga0496122_0046656 | 3300048925 | Bacteria | 3352 |
| 619 | Ga0496122_0047999 | 3300048925 | Bacteria | 3289 |
| 620 | Ga0496122_0219559 | 3300048925 | Bacteria | 1092 |
| 621 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 622 | Ga0496123_0000158 | 3300048926 | Bacteria | 136078 |
| 623 | Ga0496123_0002010 | 3300048926 | Bacteria | 26259 |
| 624 | Ga0496123_0005487 | 3300048926 | Bacteria | 12754 |
| 625 | Ga0496123_0016492 | 3300048926 | Bacteria | 5996 |
| 626 | Ga0496123_0017583 | 3300048926 | Bacteria | 5741 |
| 627 | Ga0496123_0053756 | 3300048926 | Bacteria | 2658 |
| 628 | Ga0496124_0000743 | 3300048927 | Bacteria | 53428 |
| 629 | Ga0496124_0003963 | 3300048927 | Bacteria | 17651 |
| 630 | Ga0496124_0011436 | 3300048927 | Bacteria | 8874 |
| 631 | Ga0496124_0015389 | 3300048927 | Bacteria | 7332 |
| 632 | Ga0496124_0034825 | 3300048927 | Bacteria | 4412 |
| 633 | Ga0496124_0041399 | 3300048927 | Bacteria | 3975 |
| 634 | Ga0496124_0049494 | 3300048927 | Bacteria | 3585 |
| 635 | Ga0496124_0069924 | 3300048927 | Bacteria | 2913 |
| 636 | Ga0496124_0261566 | 3300048927 | Bacteria | 1273 |
| 637 | Ga0496125_0000695 | 3300048928 | Bacteria | 55563 |
| 638 | Ga0496125_0013510 | 3300048928 | Bacteria | 8022 |
| 639 | Ga0496125_0016113 | 3300048928 | Bacteria | 7192 |
| 640 | Ga0496125_0021027 | 3300048928 | Bacteria | 6100 |
| 641 | Ga0496125_0041633 | 3300048928 | Bacteria | 3924 |
| 642 | Ga0496125_0074229 | 3300048928 | Bacteria | 2638 |
| 643 | Ga0496125_0282926 | 3300048928 | Bacteria | 1026 |
| 644 | Ga0496126_0000195 | 3300048929 | Bacteria | 135582 |
| 645 | Ga0496126_0086852 | 3300048929 | Bacteria | 2757 |
| 646 | Ga0496126_0455450 | 3300048929 | Bacteria | 1029 |
| 647 | Ga0495678_011095 | 3300049459 | Bacteria | 4330 |
| 648 | Ga0495678_027883 | 3300049459 | Bacteria | 2390 |
| 649 | Ga0495678_077409 | 3300049459 | Bacteria | 1203 |
| 650 | Ga0501031_0000003 | 3300049568 | Bacteria | 206821 |
| 651 | Ga0501031_0123922 | 3300049568 | Bacteria | 1688 |
| 652 | Ga0501031_0169540 | 3300049568 | Bacteria | 1426 |
| 653 | Ga0501031_0217196 | 3300049568 | Bacteria | 1245 |
| 654 | Ga0501032_0000010 | 3300049569 | Bacteria | 206795 |
| 655 | Ga0501032_0000587 | 3300049569 | Bacteria | 29296 |
| 656 | Ga0501032_0012946 | 3300049569 | Bacteria | 5944 |
| 657 | Ga0501032_0028404 | 3300049569 | Bacteria | 3844 |
| 658 | Ga0501032_0049889 | 3300049569 | Bacteria | 2823 |
| 659 | Ga0501032_0068127 | 3300049569 | Bacteria | 2376 |
| 660 | Ga0501032_0081072 | 3300049569 | Bacteria | 2159 |
| 661 | Ga0501032_0097643 | 3300049569 | Bacteria | 1947 |
| 662 | Ga0501033_0000017 | 3300049570 | Bacteria | 206819 |
| 663 | Ga0501033_0000076 | 3300049570 | Bacteria | 93921 |
| 664 | Ga0501033_0000521 | 3300049570 | Bacteria | 36032 |
| 665 | Ga0501033_0003783 | 3300049570 | Bacteria | 12302 |
| 666 | Ga0501033_0005881 | 3300049570 | Bacteria | 9639 |
| 667 | Ga0501033_0011725 | 3300049570 | Bacteria | 6703 |
| 668 | Ga0501033_0016419 | 3300049570 | Bacteria | 5608 |
| 669 | Ga0501033_0141001 | 3300049570 | Bacteria | 1742 |
| 670 | Ga0501033_0223152 | 3300049570 | Bacteria | 1341 |
| 671 | Ga0501033_0236443 | 3300049570 | Bacteria | 1297 |
| 672 | Ga0501033_0244080 | 3300049570 | Bacteria | 1274 |
| 673 | Ga0501033_0396228 | 3300049570 | Bacteria | 963 |
| 674 | Ga0501034_0000053 | 3300049571 | Bacteria | 206821 |
| 675 | Ga0501034_0000077 | 3300049571 | Bacteria | 173873 |
| 676 | Ga0501034_0001873 | 3300049571 | Bacteria | 26689 |
| 677 | Ga0501034_0008667 | 3300049571 | Bacteria | 10724 |
| 678 | Ga0501034_0009703 | 3300049571 | Bacteria | 10066 |
| 679 | Ga0501034_0050206 | 3300049571 | Bacteria | 4207 |
| 680 | Ga0501034_0058149 | 3300049571 | Bacteria | 3886 |
| 681 | Ga0501034_0087591 | 3300049571 | Bacteria | 3113 |
| 682 | Ga0501034_0136949 | 3300049571 | Bacteria | 2429 |
| 683 | Ga0501034_0148265 | 3300049571 | Bacteria | 2322 |
| 684 | Ga0501034_0166741 | 3300049571 | Bacteria | 2171 |
| 685 | Ga0501034_0224552 | 3300049571 | Bacteria | 1829 |
| 686 | Ga0501034_0353748 | 3300049571 | Bacteria | 1397 |
| 687 | Ga0501034_0386069 | 3300049571 | Bacteria | 1325 |
| 688 | Ga0501034_0423857 | 3300049571 | Bacteria | 1251 |
| 689 | Ga0501034_0479686 | 3300049571 | Bacteria | 1159 |
| 690 | Ga0501034_0562339 | 3300049571 | Bacteria | 1049 |
| 691 | Ga0501036_0000009 | 3300049572 | Bacteria | 206821 |
| 692 | Ga0501036_0002844 | 3300049572 | Bacteria | 13723 |
| 693 | Ga0501036_0028303 | 3300049572 | Bacteria | 4736 |
| 694 | Ga0501036_0030433 | 3300049572 | Bacteria | 4559 |
| 695 | Ga0501036_0036991 | 3300049572 | Bacteria | 4129 |
| 696 | Ga0501036_0084228 | 3300049572 | Bacteria | 2688 |
| 697 | Ga0501036_0109061 | 3300049572 | Bacteria | 2339 |
| 698 | Ga0501036_0146725 | 3300049572 | Bacteria | 1990 |
| 699 | Ga0501036_0164430 | 3300049572 | Bacteria | 1871 |
| 700 | Ga0501036_0165501 | 3300049572 | Bacteria | 1864 |
| 701 | Ga0501037_0000008 | 3300049573 | Bacteria | 206812 |
| 702 | Ga0501037_0000224 | 3300049573 | Bacteria | 49243 |
| 703 | Ga0501037_0000812 | 3300049573 | Bacteria | 23359 |
| 704 | Ga0501037_0002684 | 3300049573 | Bacteria | 12837 |
| 705 | Ga0501037_0019672 | 3300049573 | Bacteria | 4981 |
| 706 | Ga0501037_0062874 | 3300049573 | Bacteria | 2706 |
| 707 | Ga0501037_0129370 | 3300049573 | Bacteria | 1811 |
| 708 | Ga0501037_0189083 | 3300049573 | Bacteria | 1458 |
| 709 | Ga0501038_0000008 | 3300049574 | Bacteria | 206821 |
| 710 | Ga0501038_0000241 | 3300049574 | Bacteria | 46177 |
| 711 | Ga0501038_0109237 | 3300049574 | Bacteria | 2292 |
| 712 | Ga0501038_0131033 | 3300049574 | Bacteria | 2059 |
| 713 | Ga0501038_0154162 | 3300049574 | Bacteria | 1871 |
| 714 | Ga0501038_0277545 | 3300049574 | Bacteria | 1320 |
| 715 | Ga0501038_0442920 | 3300049574 | Bacteria | 1000 |
| 716 | Ga0501039_0000021 | 3300049575 | Bacteria | 162552 |
| 717 | Ga0501039_0000131 | 3300049575 | Bacteria | 52205 |
| 718 | Ga0501039_0000196 | 3300049575 | Bacteria | 43498 |
| 719 | Ga0501039_0319359 | 3300049575 | Bacteria | 1221 |
| 720 | Ga0501039_0342868 | 3300049575 | Bacteria | 1174 |
| 721 | Ga0501040_0003914 | 3300049576 | Bacteria | 9662 |
| 722 | Ga0501040_0074137 | 3300049576 | Bacteria | 2352 |
| 723 | Ga0501040_0271701 | 3300049576 | Bacteria | 1210 |
| 724 | Ga0501041_0087680 | 3300049577 | Bacteria | 1921 |
| 725 | Ga0501042_0011075 | 3300049578 | Bacteria | 6074 |
| 726 | Ga0501042_0304709 | 3300049578 | Bacteria | 1151 |
| 727 | Ga0501043_0000005 | 3300049579 | Bacteria | 254466 |
| 728 | Ga0501043_0000043 | 3300049579 | Bacteria | 115410 |
| 729 | Ga0501043_0000405 | 3300049579 | Bacteria | 38778 |
| 730 | Ga0501043_0010702 | 3300049579 | Bacteria | 7186 |
| 731 | Ga0501043_0210303 | 3300049579 | Bacteria | 1508 |
| 732 | Ga0501043_0372383 | 3300049579 | Bacteria | 1082 |
| 733 | Ga0501043_0379472 | 3300049579 | Bacteria | 1070 |
| 734 | Ga0501046_0001156 | 3300049580 | Bacteria | 25669 |
| 735 | Ga0501046_0026209 | 3300049580 | Bacteria | 4762 |
| 736 | Ga0501046_0038328 | 3300049580 | Bacteria | 3848 |
| 737 | Ga0501047_0000129 | 3300049581 | Bacteria | 91572 |
| 738 | Ga0501047_0000894 | 3300049581 | Bacteria | 30442 |
| 739 | Ga0501047_0005104 | 3300049581 | Bacteria | 12319 |
| 740 | Ga0501047_0020856 | 3300049581 | Bacteria | 6294 |
| 741 | Ga0501047_0030968 | 3300049581 | Bacteria | 5158 |
| 742 | Ga0501047_0046886 | 3300049581 | Bacteria | 4175 |
| 743 | Ga0501047_0049610 | 3300049581 | Bacteria | 4053 |
| 744 | Ga0501047_0052545 | 3300049581 | Bacteria | 3939 |
| 745 | Ga0501047_0056209 | 3300049581 | Bacteria | 3805 |
| 746 | Ga0501047_0087523 | 3300049581 | Bacteria | 2992 |
| 747 | Ga0501047_0212705 | 3300049581 | Bacteria | 1791 |
| 748 | Ga0501047_0481443 | 3300049581 | Bacteria | 1069 |
| 749 | Ga0501047_0686654 | 3300049581 | Bacteria | 842 |
| 750 | Ga0501048_0000282 | 3300049582 | Bacteria | 34461 |
| 751 | Ga0501048_0004455 | 3300049582 | Bacteria | 10658 |
| 752 | Ga0501048_0020443 | 3300049582 | Bacteria | 4852 |
| 753 | Ga0501067_0000213 | 3300049583 | Bacteria | 32191 |
| 754 | Ga0501067_0001197 | 3300049583 | Bacteria | 14101 |
| 755 | Ga0501067_0028159 | 3300049583 | Bacteria | 3112 |
| 756 | Ga0501067_0036197 | 3300049583 | Bacteria | 2741 |
| 757 | Ga0501067_0042891 | 3300049583 | Bacteria | 2512 |
| 758 | Ga0501067_0045622 | 3300049583 | Bacteria | 2433 |
| 759 | Ga0501068_0005249 | 3300049584 | Bacteria | 7072 |
| 760 | Ga0501068_0027596 | 3300049584 | Bacteria | 3353 |
| 761 | Ga0501069_0000011 | 3300049585 | Bacteria | 153214 |
| 762 | Ga0501069_0025402 | 3300049585 | Bacteria | 3238 |
| 763 | Ga0501069_0055908 | 3300049585 | Bacteria | 2198 |
| 764 | Ga0501069_0076670 | 3300049585 | Bacteria | 1880 |
| 765 | Ga0501069_0159404 | 3300049585 | Bacteria | 1299 |
| 766 | Ga0501069_0196147 | 3300049585 | Bacteria | 1169 |
| 767 | Ga0501069_0367186 | 3300049585 | Bacteria | 849 |
| 768 | Ga0501070_0000117 | 3300049586 | Bacteria | 70793 |
| 769 | Ga0501070_0001936 | 3300049586 | Bacteria | 18277 |
| 770 | Ga0501070_0004936 | 3300049586 | Bacteria | 11386 |
| 771 | Ga0501070_0005238 | 3300049586 | Bacteria | 11055 |
| 772 | Ga0501070_0006463 | 3300049586 | Bacteria | 9977 |
| 773 | Ga0501070_0107545 | 3300049586 | Bacteria | 2305 |
| 774 | Ga0501070_0120810 | 3300049586 | Bacteria | 2165 |
| 775 | Ga0501070_0136845 | 3300049586 | Bacteria | 2022 |
| 776 | Ga0501071_0005058 | 3300049587 | Bacteria | 8437 |
| 777 | Ga0501071_0238175 | 3300049587 | Bacteria | 1372 |
| 778 | Ga0501072_0386210 | 3300049588 | Bacteria | 1111 |
| 779 | Ga0501072_0503666 | 3300049588 | Bacteria | 958 |
| 780 | Ga0501073_0011311 | 3300049589 | Bacteria | 6530 |
| 781 | Ga0501073_0015653 | 3300049589 | Bacteria | 5500 |
| 782 | Ga0501073_0027903 | 3300049589 | Bacteria | 4034 |
| 783 | Ga0501073_0067096 | 3300049589 | Bacteria | 2501 |
| 784 | Ga0501073_0073448 | 3300049589 | Bacteria | 2381 |
| 785 | Ga0501073_0096224 | 3300049589 | Bacteria | 2056 |
| 786 | Ga0501073_0100118 | 3300049589 | Bacteria | 2012 |
| 787 | Ga0501073_0146464 | 3300049589 | Bacteria | 1636 |
| 788 | Ga0501073_0176648 | 3300049589 | Bacteria | 1478 |
| 789 | Ga0501073_0197845 | 3300049589 | Bacteria | 1390 |
| 790 | Ga0501073_0256299 | 3300049589 | Bacteria | 1208 |
| 791 | Ga0501073_0425378 | 3300049589 | Bacteria | 918 |
| 792 | Ga0501074_0002555 | 3300049590 | Bacteria | 12701 |
| 793 | Ga0501074_0016136 | 3300049590 | Bacteria | 5428 |
| 794 | Ga0501074_0033856 | 3300049590 | Bacteria | 3704 |
| 795 | Ga0501075_0171117 | 3300049591 | Bacteria | 1657 |
| 796 | Ga0501076_0008864 | 3300049592 | Bacteria | 7398 |
| 797 | Ga0501076_0070351 | 3300049592 | Bacteria | 2797 |
| 798 | Ga0501077_0043446 | 3300049593 | Bacteria | 2856 |
| 799 | Ga0501079_0337543 | 3300049741 | Bacteria | 1180 |
| 800 | Ga0501080_0000053 | 3300049742 | Bacteria | 74409 |
| 801 | Ga0501080_0005693 | 3300049742 | Bacteria | 11145 |
| 802 | Ga0501080_0014905 | 3300049742 | Bacteria | 7157 |
| 803 | Ga0501080_0018576 | 3300049742 | Bacteria | 6434 |
| 804 | Ga0501080_0050494 | 3300049742 | Bacteria | 3871 |
| 805 | Ga0501080_0065574 | 3300049742 | Bacteria | 3377 |
| 806 | Ga0501080_0071736 | 3300049742 | Bacteria | 3221 |
| 807 | Ga0501080_0077400 | 3300049742 | Bacteria | 3093 |
| 808 | Ga0501080_0455512 | 3300049742 | Bacteria | 1146 |
| 809 | Ga0501080_0525103 | 3300049742 | Bacteria | 1056 |
| 810 | Ga0501081_0003348 | 3300049743 | Bacteria | 10196 |
| 811 | Ga0501081_0262315 | 3300049743 | Bacteria | 1263 |
| 812 | Ga0501083_0000406 | 3300049744 | Bacteria | 27431 |
| 813 | Ga0501083_0017663 | 3300049744 | Bacteria | 4973 |
| 814 | Ga0501083_0090776 | 3300049744 | Bacteria | 2017 |
| 815 | Ga0501083_0181102 | 3300049744 | Bacteria | 1376 |
| 816 | Ga0501280_003795 | 3300049776 | Bacteria | 2278 |
| 817 | Ga0501035_0000010 | 3300049822 | Bacteria | 309349 |
| 818 | Ga0501035_0000023 | 3300049822 | Bacteria | 206821 |
| 819 | Ga0501035_0000107 | 3300049822 | Bacteria | 103130 |
| 820 | Ga0501035_0000449 | 3300049822 | Bacteria | 46083 |
| 821 | Ga0501035_0001177 | 3300049822 | Bacteria | 27251 |
| 822 | Ga0501035_0003419 | 3300049822 | Bacteria | 15188 |
| 823 | Ga0501035_0003519 | 3300049822 | Bacteria | 14970 |
| 824 | Ga0501035_0007710 | 3300049822 | Bacteria | 10052 |
| 825 | Ga0501035_0065014 | 3300049822 | Bacteria | 3241 |
| 826 | Ga0501035_0156239 | 3300049822 | Bacteria | 1977 |
| 827 | Ga0501035_0342862 | 3300049822 | Bacteria | 1251 |
| 828 | Ga0501035_0469443 | 3300049822 | Bacteria | 1039 |
| 829 | Ga0501044_0000006 | 3300049823 | Bacteria | 291413 |
| 830 | Ga0501044_0000021 | 3300049823 | Bacteria | 206821 |
| 831 | Ga0501044_0000154 | 3300049823 | Bacteria | 85407 |
| 832 | Ga0501044_0008423 | 3300049823 | Bacteria | 11307 |
| 833 | Ga0501044_0010150 | 3300049823 | Bacteria | 10235 |
| 834 | Ga0501044_0032199 | 3300049823 | Bacteria | 5513 |
| 835 | Ga0501044_0036530 | 3300049823 | Bacteria | 5140 |
| 836 | Ga0501044_0053659 | 3300049823 | Bacteria | 4146 |
| 837 | Ga0501044_0085982 | 3300049823 | Bacteria | 3177 |
| 838 | Ga0501044_0087274 | 3300049823 | Bacteria | 3151 |
| 839 | Ga0501044_0091619 | 3300049823 | Bacteria | 3066 |
| 840 | Ga0501044_0098638 | 3300049823 | Bacteria | 2941 |
| 841 | Ga0501044_0126201 | 3300049823 | Bacteria | 2556 |
| 842 | Ga0501044_0280465 | 3300049823 | Bacteria | 1600 |
| 843 | Ga0501045_0007088 | 3300049824 | Bacteria | 7770 |
| 844 | Ga0501045_0140475 | 3300049824 | Bacteria | 1796 |
| 845 | Ga0501045_0141357 | 3300049824 | Bacteria | 1790 |
| 846 | nmdc:mga03683_51889_c1 | 3300050489 | Bacteria | 1713 |
| 847 | nmdc:mga03683_91461_c1 | 3300050489 | Bacteria | 1327 |
| 848 | nmdc:mga03n38_3995_c1 | 3300050490 | Bacteria | 4818 |
| 849 | nmdc:mga00v17_132932_c1 | 3300050491 | Bacteria | 1591 |
| 850 | nmdc:mga00v17_211366_c1 | 3300050491 | Bacteria | 1255 |
| 851 | nmdc:mga00v17_3192_c1 | 3300050491 | Bacteria | 8448 |
| 852 | nmdc:mga00v17_72_c1 | 3300050491 | Bacteria | 60922 |
| 853 | nmdc:mga0yw44_166453_c1 | 3300050492 | Bacteria | 1446 |
| 854 | nmdc:mga0yw44_1917_c1 | 3300050492 | Bacteria | 8593 |
| 855 | nmdc:mga0yw44_96982_c1 | 3300050492 | Bacteria | 1872 |
| 856 | nmdc:mga0k408_37840_c1 | 3300050493 | Bacteria | 2770 |
| 857 | nmdc:mga0k408_68174_c1 | 3300050493 | Bacteria | 2075 |
| 858 | nmdc:mga0k408_82874_c1 | 3300050493 | Bacteria | 1880 |
| 859 | nmdc:mga06z11_11753_c1 | 3300050494 | Bacteria | 3786 |
| 860 | nmdc:mga06z11_260156_c1 | 3300050494 | Bacteria | 1024 |
| 861 | nmdc:mga06z11_52758_c1 | 3300050494 | Bacteria | 2088 |
| 862 | nmdc:mga06z11_62571_c1 | 3300050494 | Bacteria | 1944 |
| 863 | nmdc:mga06z11_91541_c1 | 3300050494 | Bacteria | 1652 |
| 864 | nmdc:mga04h51_11247_c1 | 3300050495 | Bacteria | 2480 |
| 865 | nmdc:mga04h51_56754_c1 | 3300050495 | Bacteria | 1330 |
| 866 | nmdc:mga07m45_123910_c1 | 3300050496 | Bacteria | 1109 |
| 867 | nmdc:mga07m45_50268_c1 | 3300050496 | Bacteria | 2349 |
| 868 | nmdc:mga0rr50_41028_c1 | 3300050513 | Bacteria | 3369 |
| 869 | nmdc:mga08x19_22_c1 | 3300050514 | Bacteria | 297462 |
| 870 | nmdc:mga0sz30_119851_c1 | 3300050516 | Bacteria | 1156 |
| 871 | nmdc:mga0sz30_13611_c1 | 3300050516 | Bacteria | 3188 |
| 872 | nmdc:mga0sz30_175615_c1 | 3300050516 | Bacteria | 950 |
| 873 | nmdc:mga0sz30_26730_c1 | 3300050516 | Bacteria | 2367 |
| 874 | nmdc:mga0sz30_609_c1 | 3300050516 | Bacteria | 13266 |
| 875 | Ga0500610_0064816 | 3300053079 | Bacteria | 1906 |
| 876 | Ga0495619_0105390 | 3300053085 | Bacteria | 1922 |
| 877 | Ga0500578_0109792 | 3300053086 | Bacteria | 1739 |
| 878 | Ga0500651_0167214 | 3300053093 | Bacteria | 1313 |
| 879 | Ga0500556_0000033 | 3300053104 | Bacteria | 147801 |
| 880 | Ga0500560_018504 | 3300053107 | Bacteria | 1943 |
| 881 | Ga0500569_001278 | 3300053109 | Bacteria | 4689 |
| 882 | Ga0500569_021263 | 3300053109 | Bacteria | 1713 |
| 883 | Ga0500594_0002582 | 3300053118 | Bacteria | 3934 |
| 884 | Ga0500618_001151 | 3300053125 | Bacteria | 12825 |
| 885 | Ga0500642_0019133 | 3300053130 | Bacteria | 2665 |
| 886 | Ga0500658_0000230 | 3300053134 | Bacteria | 26381 |
| 887 | Ga0500658_0141410 | 3300053134 | Bacteria | 1080 |
| 888 | Ga0500561_0000123 | 3300053137 | Bacteria | 14866 |
| 889 | Ga0500568_0000205 | 3300053139 | Bacteria | 51687 |
| 890 | Ga0500568_0000924 | 3300053139 | Bacteria | 20259 |
| 891 | Ga0500568_0004782 | 3300053139 | Bacteria | 7160 |
| 892 | Ga0500568_0066844 | 3300053139 | Bacteria | 1382 |
| 893 | Ga0500573_0007042 | 3300053140 | Bacteria | 6113 |
| 894 | Ga0500604_0050123 | 3300053151 | Bacteria | 1286 |
| 895 | Ga0500616_0002449 | 3300053153 | Bacteria | 15425 |
| 896 | Ga0500616_0017030 | 3300053153 | Bacteria | 4127 |
| 897 | Ga0500616_0068987 | 3300053153 | Bacteria | 1809 |
| 898 | Ga0500616_0080810 | 3300053153 | Bacteria | 1634 |
| 899 | Ga0500620_029555 | 3300053155 | Bacteria | 1723 |
| 900 | Ga0500622_0001035 | 3300053156 | Bacteria | 23258 |
| 901 | Ga0500622_0132185 | 3300053156 | Bacteria | 1198 |
| 902 | Ga0500624_000320 | 3300053157 | Bacteria | 16425 |
| 903 | Ga0500627_0052506 | 3300053158 | Bacteria | 1779 |
| 904 | Ga0500627_0101530 | 3300053158 | Bacteria | 1291 |
| 905 | Ga0500633_0009280 | 3300053160 | Bacteria | 2579 |
| 906 | Ga0501084_0238511 | 3300054114 | Bacteria | 1535 |
| 907 | Ga0501084_0453913 | 3300054114 | Bacteria | 1083 |
| 908 | Ga0587072_023137 | 3300059643 | Bacteria | 1114 |
| 909 | Ga0501082_0048193 | 3300060353 | Bacteria | 3672 |
| 910 | Ga0530510_0239918 | 3300061734 | Bacteria | 1349 |
| 911 | Ga0530510_0558227 | 3300061734 | Bacteria | 870 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048927 | Ga0496124_0069924 | Ga0496124_0069924_1422_2237 | 222 |
| 2 | iso_pu_bacteria | 2906393657 | 2906394515 | 222 |
| 3 | 3300049571 | Ga0501034_0050206 | Ga0501034_0050206_3345_4163 | 225 |
| 4 | 3300049571 | Ga0501034_0562339 | Ga0501034_0562339_254_1039 | 225 |
| 5 | 3300049581 | Ga0501047_0030968 | Ga0501047_0030968_2654_3472 | 226 |
| 6 | 3300061734 | Ga0530510_0558227 | Ga0530510_0558227_17_826 | 227 |
| 7 | 3300037853 | Ga0436364_0053004 | Ga0436364_0053004_561_1310 | 228 |
| 8 | 3300049572 | Ga0501036_0164430 | Ga0501036_0164430_165_983 | 228 |
| 9 | 3300049581 | Ga0501047_0212705 | Ga0501047_0212705_106_924 | 228 |
| 10 | 3300049583 | Ga0501067_0042891 | Ga0501067_0042891_946_1764 | 228 |
| 11 | 3300049588 | Ga0501072_0503666 | Ga0501072_0503666_83_901 | 228 |
| 12 | 3300049589 | Ga0501073_0073448 | Ga0501073_0073448_844_1662 | 228 |
| 13 | 3300049590 | Ga0501074_0016136 | Ga0501074_0016136_3968_4786 | 228 |
| 14 | 3300049742 | Ga0501080_0077400 | Ga0501080_0077400_871_1689 | 228 |
| 15 | iso_pu_bacteria | 2958137437 | 2958143854 | 228 |
| 16 | iso_pu_bacteria | 8004727605 | 8004729883 | 228 |
| 17 | iso_pu_bacteria | 2906386501 | 2906393385 | 230 |
| 18 | iso_pu_bacteria | 2924718760 | 2924722625 | 230 |
| 19 | iso_pu_bacteria | 2965089291 | 2965093465 | 230 |
| 20 | 3300049589 | Ga0501073_0176648 | Ga0501073_0176648_496_1314 | 231 |
| 21 | 3300049744 | Ga0501083_0017663 | Ga0501083_0017663_2515_3333 | 231 |
| 22 | 3300005937 | Ga0081455_10107875 | Ga0081455_101078752 | 234 |
| 23 | 3300006173 | Ga0070716_100072389 | Ga0070716_1000723892 | 234 |
| 24 | 3300007788 | Ga0099795_10055087 | Ga0099795_100550872 | 234 |
| 25 | 3300045051 | Ga0451576_0639612 | Ga0451576_0639612_218_1042 | 234 |
| 26 | 3300049822 | Ga0501035_0003519 | Ga0501035_0003519_8767_9591 | 234 |
| 27 | 3300009094 | Ga0111539_10309258 | Ga0111539_103092582 | 236 |
| 28 | 3300041413 | Ga0439465_0031347 | Ga0439465_0031347_713_1531 | 236 |
| 29 | 3300049589 | Ga0501073_0100118 | Ga0501073_0100118_426_1247 | 236 |
| 30 | 3300005434 | Ga0070709_10052912 | Ga0070709_100529121 | 237 |
| 31 | 3300006028 | Ga0070717_10173981 | Ga0070717_101739813 | 237 |
| 32 | 3300025906 | Ga0207699_10007510 | Ga0207699_100075106 | 237 |
| 33 | 3300037853 | Ga0436364_0628381 | Ga0436364_0628381_11_829 | 237 |
| 34 | 3300025915 | Ga0207693_10162802 | Ga0207693_101628022 | 238 |
| 35 | 3300031239 | Ga0265328_10016074 | Ga0265328_100160742 | 238 |
| 36 | 3300031242 | Ga0265329_10062820 | Ga0265329_100628202 | 238 |
| 37 | 3300031250 | Ga0265331_10003656 | Ga0265331_100036562 | 238 |
| 38 | 3300031251 | Ga0265327_10015085 | Ga0265327_100150855 | 238 |
| 39 | 3300031344 | Ga0265316_10059448 | Ga0265316_100594482 | 238 |
| 40 | 3300041441 | Ga0451787_397122 | Ga0451787_397122_85_903 | 238 |
| 41 | 3300041501 | Ga0451845_0022414 | Ga0451845_0022414_1269_2087 | 238 |
| 42 | 3300041507 | Ga0451851_0106610 | Ga0451851_0106610_101_919 | 238 |
| 43 | 3300041509 | Ga0451843_1153044 | Ga0451843_1153044_29_847 | 238 |
| 44 | 3300041512 | Ga0451853_4116506 | Ga0451853_4116506_185_1003 | 238 |
| 45 | 3300046492 | Ga0495585_0025667 | Ga0495585_0025667_2249_3067 | 238 |
| 46 | 3300046500 | Ga0495596_0059795 | Ga0495596_0059795_278_1096 | 238 |
| 47 | 3300046518 | Ga0495631_0103618 | Ga0495631_0103618_325_1143 | 238 |
| 48 | 3300046524 | Ga0495648_0027504 | Ga0495648_0027504_1522_2340 | 238 |
| 49 | 3300046660 | Ga0495625_0113690 | Ga0495625_0113690_900_1718 | 238 |
| 50 | 3300049579 | Ga0501043_0379472 | Ga0501043_0379472_15_758 | 238 |
| 51 | 3300039437 | Ga0436365_0289217 | Ga0436365_0289217_3312_4106 | 239 |
| 52 | 3300048922 | Ga0496119_0020869 | Ga0496119_0020869_1045_1866 | 239 |
| 53 | 3300048925 | Ga0496122_0032728 | Ga0496122_0032728_2301_3122 | 239 |
| 54 | 3300048925 | Ga0496122_0047999 | Ga0496122_0047999_211_1032 | 239 |
| 55 | 3300048926 | Ga0496123_0016492 | Ga0496123_0016492_968_1789 | 239 |
| 56 | 3300048928 | Ga0496125_0074229 | Ga0496125_0074229_1707_2528 | 239 |
| 57 | 3300049569 | Ga0501032_0068127 | Ga0501032_0068127_1377_2198 | 239 |
| 58 | 3300049570 | Ga0501033_0011725 | Ga0501033_0011725_2617_3438 | 239 |
| 59 | 3300049571 | Ga0501034_0058149 | Ga0501034_0058149_396_1217 | 239 |
| 60 | 3300049572 | Ga0501036_0036991 | Ga0501036_0036991_751_1572 | 239 |
| 61 | 3300049573 | Ga0501037_0129370 | Ga0501037_0129370_112_933 | 239 |
| 62 | 3300049581 | Ga0501047_0046886 | Ga0501047_0046886_1917_2738 | 239 |
| 63 | 3300049823 | Ga0501044_0036530 | Ga0501044_0036530_2730_3551 | 239 |
| 64 | 3300003187 | JGI25151J46595_10000346 | JGI25151J46595_100003464 | 241 |
| 65 | 3300003215 | JGI25153J46596_10003250 | JGI25153J46596_100032504 | 241 |
| 66 | 3300003215 | JGI25153J46596_10007980 | JGI25153J46596_100079803 | 241 |
| 67 | 3300003374 | JGI25161J50226_1006024 | JGI25161J50226_10060242 | 241 |
| 68 | 3300003771 | Ga0055526_1001675 | Ga0055526_10016755 | 241 |
| 69 | 3300003771 | Ga0055526_1003766 | Ga0055526_10037662 | 241 |
| 70 | 3300003775 | Ga0055524_1006985 | Ga0055524_10069852 | 241 |
| 71 | 3300003792 | Ga0055540_1018350 | Ga0055540_10183502 | 241 |
| 72 | 3300004625 | Ga0055543_1001242 | Ga0055543_10012424 | 241 |
| 73 | 3300006042 | Ga0075368_10024940 | Ga0075368_100249402 | 241 |
| 74 | 3300006051 | Ga0075364_10152227 | Ga0075364_101522272 | 241 |
| 75 | 3300006177 | Ga0075362_10090892 | Ga0075362_100908922 | 241 |
| 76 | 3300006178 | Ga0075367_10010369 | Ga0075367_100103692 | 241 |
| 77 | 3300006186 | Ga0075369_10007695 | Ga0075369_100076954 | 241 |
| 78 | 3300006195 | Ga0075366_10085442 | Ga0075366_100854422 | 241 |
| 79 | 3300006353 | Ga0075370_10188242 | Ga0075370_101882422 | 241 |
| 80 | 3300025245 | Ga0207425_1003710 | Ga0207425_10037104 | 241 |
| 81 | 3300025258 | Ga0209129_1019425 | Ga0209129_10194252 | 241 |
| 82 | 3300025273 | Ga0209673_1001964 | Ga0209673_10019645 | 241 |
| 83 | 3300025294 | Ga0209025_1000970 | Ga0209025_10009703 | 241 |
| 84 | 3300025295 | Ga0209564_1000091 | Ga0209564_1000091175 | 241 |
| 85 | 3300025295 | Ga0209564_1001931 | Ga0209564_10019314 | 241 |
| 86 | 3300025297 | Ga0209758_1001962 | Ga0209758_100196211 | 241 |
| 87 | 3300025297 | Ga0209758_1002450 | Ga0209758_10024507 | 241 |
| 88 | 3300025299 | Ga0209256_1000541 | Ga0209256_10005419 | 241 |
| 89 | 3300025299 | Ga0209256_1005494 | Ga0209256_10054942 | 241 |
| 90 | 3300025302 | Ga0207426_1000063 | Ga0207426_1000063224 | 241 |
| 91 | 3300025304 | Ga0209257_1007835 | Ga0209257_10078354 | 241 |
| 92 | 3300027866 | Ga0209813_10012420 | Ga0209813_100124203 | 241 |
| 93 | 3300037853 | Ga0436364_0563011 | Ga0436364_0563011_304_1053 | 241 |
| 94 | 3300041496 | Ga0451839_1498607 | Ga0451839_1498607_235_1053 | 241 |
| 95 | 3300041498 | Ga0451841_1101904 | Ga0451841_1101904_25_843 | 241 |
| 96 | 3300041509 | Ga0451843_0615050 | Ga0451843_0615050_665_1483 | 241 |
| 97 | 3300046460 | Ga0495638_0023748 | Ga0495638_0023748_242_1060 | 241 |
| 98 | 3300046501 | Ga0495607_0033186 | Ga0495607_0033186_1521_2339 | 241 |
| 99 | 3300046506 | Ga0495583_0039945 | Ga0495583_0039945_27_845 | 241 |
| 100 | 3300046512 | Ga0495610_0013489 | Ga0495610_0013489_3146_3964 | 241 |
| 101 | 3300046513 | Ga0495616_0046111 | Ga0495616_0046111_196_1014 | 241 |
| 102 | 3300046515 | Ga0495620_0016232 | Ga0495620_0016232_534_1352 | 241 |
| 103 | 3300046522 | Ga0495643_0053111 | Ga0495643_0053111_755_1573 | 241 |
| 104 | 3300046530 | Ga0495654_0079010 | Ga0495654_0079010_473_1291 | 241 |
| 105 | 3300046542 | Ga0495597_0031888 | Ga0495597_0031888_1170_1988 | 241 |
| 106 | 3300046616 | Ga0495668_0031652 | Ga0495668_0031652_693_1511 | 241 |
| 107 | 3300046810 | Ga0495660_0023466 | Ga0495660_0023466_818_1636 | 241 |
| 108 | 3300047443 | Ga0495687_019134 | Ga0495687_019134_2514_3332 | 241 |
| 109 | 3300047472 | Ga0495686_0035111 | Ga0495686_0035111_2066_2884 | 241 |
| 110 | 3300048922 | Ga0496119_0001089 | Ga0496119_0001089_3800_4621 | 241 |
| 111 | 3300048925 | Ga0496122_0002105 | Ga0496122_0002105_23355_24176 | 241 |
| 112 | 3300048926 | Ga0496123_0002010 | Ga0496123_0002010_5001_5822 | 241 |
| 113 | 3300049459 | Ga0495678_027883 | Ga0495678_027883_1515_2333 | 241 |
| 114 | 3300050489 | nmdc:mga03683_91461_c1 | nmdc:mga03683_91461_c1_120_938 | 241 |
| 115 | 3300050516 | nmdc:mga0sz30_119851_c1 | nmdc:mga0sz30_119851_c1_223_1041 | 241 |
| 116 | 3300053086 | Ga0500578_0109792 | Ga0500578_0109792_854_1672 | 241 |
| 117 | 3300053104 | Ga0500556_0000033 | Ga0500556_0000033_101118_101939 | 241 |
| 118 | 3300053109 | Ga0500569_021263 | Ga0500569_021263_447_1265 | 241 |
| 119 | 3300053134 | Ga0500658_0000230 | Ga0500658_0000230_3146_3964 | 241 |
| 120 | 3300025299 | Ga0209256_1018895 | Ga0209256_10188952 | 242 |
| 121 | 3300049570 | Ga0501033_0236443 | Ga0501033_0236443_423_1211 | 242 |
| 122 | 3300049571 | Ga0501034_0087591 | Ga0501034_0087591_1986_2774 | 242 |
| 123 | 3300049585 | Ga0501069_0025402 | Ga0501069_0025402_208_996 | 242 |
| 124 | 3300049822 | Ga0501035_0156239 | Ga0501035_0156239_834_1622 | 242 |
| 125 | 3300042876 | Ga0451577_0048226 | Ga0451577_0048226_1370_2161 | 243 |
| 126 | 3300045051 | Ga0451576_0000457 | Ga0451576_0000457_57647_58531 | 243 |
| 127 | 3300048907 | Ga0496104_0057690 | Ga0496104_0057690_108_905 | 243 |
| 128 | 3300049569 | Ga0501032_0028404 | Ga0501032_0028404_2861_3685 | 244 |
| 129 | 3300049571 | Ga0501034_0000077 | Ga0501034_0000077_42907_43731 | 244 |
| 130 | 3300049572 | Ga0501036_0109061 | Ga0501036_0109061_280_1104 | 244 |
| 131 | 3300049573 | Ga0501037_0019672 | Ga0501037_0019672_936_1760 | 244 |
| 132 | 3300049574 | Ga0501038_0154162 | Ga0501038_0154162_717_1541 | 244 |
| 133 | 3300049575 | Ga0501039_0000131 | Ga0501039_0000131_2822_3646 | 244 |
| 134 | 3300049576 | Ga0501040_0074137 | Ga0501040_0074137_758_1582 | 244 |
| 135 | 3300049580 | Ga0501046_0001156 | Ga0501046_0001156_5471_6295 | 244 |
| 136 | 3300049581 | Ga0501047_0000129 | Ga0501047_0000129_78723_79547 | 244 |
| 137 | 3300049583 | Ga0501067_0000213 | Ga0501067_0000213_24293_25117 | 244 |
| 138 | 3300049586 | Ga0501070_0136845 | Ga0501070_0136845_634_1458 | 244 |
| 139 | 3300049589 | Ga0501073_0011311 | Ga0501073_0011311_5516_6340 | 244 |
| 140 | 3300049742 | Ga0501080_0000053 | Ga0501080_0000053_5949_6773 | 244 |
| 141 | 3300049822 | Ga0501035_0000010 | Ga0501035_0000010_179227_180051 | 244 |
| 142 | 3300049823 | Ga0501044_0000006 | Ga0501044_0000006_33183_34007 | 244 |
| 143 | 3300049824 | Ga0501045_0140475 | Ga0501045_0140475_744_1568 | 244 |
| 144 | iso_pu_bacteria | 2878788777 | 2878791401 | 244 |
| 145 | 3300021388 | Ga0213875_10000030 | Ga0213875_10000030158 | 245 |
| 146 | 3300032126 | Ga0307415_100510670 | Ga0307415_1005106702 | 245 |
| 147 | 3300037853 | Ga0436364_0207431 | Ga0436364_0207431_18590_19381 | 245 |
| 148 | 3300048905 | Ga0496102_0152186 | Ga0496102_0152186_18_776 | 245 |
| 149 | 3300009101 | Ga0105247_10347259 | Ga0105247_103472592 | 246 |
| 150 | 3300049568 | Ga0501031_0123922 | Ga0501031_0123922_766_1584 | 246 |
| 151 | 3300002773 | JGI25152J39213_1005371 | JGI25152J39213_10053713 | 247 |
| 152 | 3300003187 | JGI25151J46595_10005499 | JGI25151J46595_100054993 | 247 |
| 153 | 3300025258 | Ga0209129_1000123 | Ga0209129_100012352 | 247 |
| 154 | 3300025294 | Ga0209025_1003063 | Ga0209025_10030634 | 247 |
| 155 | 3300031241 | Ga0265325_10002414 | Ga0265325_100024146 | 247 |
| 156 | 3300031249 | Ga0265339_10040311 | Ga0265339_100403113 | 247 |
| 157 | 3300031344 | Ga0265316_10040084 | Ga0265316_100400843 | 247 |
| 158 | 3300049744 | Ga0501083_0181102 | Ga0501083_0181102_384_1142 | 247 |
| 159 | 3300003187 | JGI25151J46595_10017127 | JGI25151J46595_100171272 | 248 |
| 160 | 3300005347 | Ga0070668_100074040 | Ga0070668_1000740401 | 248 |
| 161 | 3300006948 | Ga0099826_10000423 | Ga0099826_1000042313 | 248 |
| 162 | 3300025284 | Ga0209130_1011836 | Ga0209130_10118362 | 248 |
| 163 | 3300025294 | Ga0209025_1000441 | Ga0209025_100044154 | 248 |
| 164 | 3300027666 | Ga0209282_1000224 | Ga0209282_100022413 | 248 |
| 165 | 3300028577 | Ga0265318_10143745 | Ga0265318_101437451 | 248 |
| 166 | 3300031247 | Ga0265340_10044194 | Ga0265340_100441942 | 248 |
| 167 | 3300031344 | Ga0265316_10031264 | Ga0265316_100312642 | 248 |
| 168 | 3300031711 | Ga0265314_10010850 | Ga0265314_100108507 | 248 |
| 169 | 3300031712 | Ga0265342_10084702 | Ga0265342_100847022 | 248 |
| 170 | 3300031995 | Ga0307409_100529568 | Ga0307409_1005295682 | 248 |
| 171 | 3300041486 | Ga0451807_0622738 | Ga0451807_0622738_113_916 | 248 |
| 172 | 3300048919 | Ga0496116_0050161 | Ga0496116_0050161_1097_1909 | 248 |
| 173 | 3300048920 | Ga0496117_0104866 | Ga0496117_0104866_632_1444 | 248 |
| 174 | 3300048928 | Ga0496125_0021027 | Ga0496125_0021027_424_1236 | 248 |
| 175 | 3300005548 | Ga0070665_100025086 | Ga0070665_1000250863 | 249 |
| 176 | 3300009147 | Ga0114129_10675954 | Ga0114129_106759542 | 249 |
| 177 | 3300028379 | Ga0268266_10015355 | Ga0268266_100153554 | 249 |
| 178 | 3300003203 | JGI25406J46586_10003471 | JGI25406J46586_100034716 | 250 |
| 179 | 3300003203 | JGI25406J46586_10004531 | JGI25406J46586_100045314 | 250 |
| 180 | 3300003771 | Ga0055526_1016134 | Ga0055526_10161343 | 250 |
| 181 | 3300003775 | Ga0055524_1000384 | Ga0055524_100038415 | 250 |
| 182 | 3300003775 | Ga0055524_1011084 | Ga0055524_10110843 | 250 |
| 183 | 3300003790 | Ga0055528_1000866 | Ga0055528_10008662 | 250 |
| 184 | 3300005985 | Ga0081539_10000881 | Ga0081539_1000088141 | 250 |
| 185 | 3300013249 | Ga0171463_1001 | Ga0171463_1001688 | 250 |
| 186 | 3300015690 | Ga0183363_1012 | Ga0183363_101231 | 250 |
| 187 | 3300025273 | Ga0209673_1000015 | Ga0209673_1000015362 | 250 |
| 188 | 3300025294 | Ga0209025_1003049 | Ga0209025_10030494 | 250 |
| 189 | 3300025295 | Ga0209564_1005067 | Ga0209564_10050674 | 250 |
| 190 | 3300025299 | Ga0209256_1000180 | Ga0209256_100018062 | 250 |
| 191 | 3300025299 | Ga0209256_1001340 | Ga0209256_100134018 | 250 |
| 192 | 3300031911 | Ga0307412_10078925 | Ga0307412_100789253 | 250 |
| 193 | 3300041405 | Ga0439438_036258 | Ga0439438_036258_189_1004 | 250 |
| 194 | 3300042014 | Ga0439457_020608 | Ga0439457_020608_442_1257 | 250 |
| 195 | 3300042122 | Ga0450920_028507 | Ga0450920_028507_124_939 | 250 |
| 196 | 3300042145 | Ga0450906_029462 | Ga0450906_029462_67_882 | 250 |
| 197 | 3300042435 | Ga0439434_0073404 | Ga0439434_0073404_101_916 | 250 |
| 198 | 3300042531 | Ga0450918_001536 | Ga0450918_001536_2155_2970 | 250 |
| 199 | 3300046460 | Ga0495638_0099707 | Ga0495638_0099707_524_1342 | 250 |
| 200 | 3300053153 | Ga0500616_0080810 | Ga0500616_0080810_325_1149 | 250 |
| 201 | 3300005445 | Ga0070708_100764056 | Ga0070708_1007640561 | 251 |
| 202 | 3300030878 | Ga0265770_1017861 | Ga0265770_10178612 | 251 |
| 203 | 3300032004 | Ga0307414_10287044 | Ga0307414_102870441 | 251 |
| 204 | 3300035170 | Ga0373943_0000613 | Ga0373943_0000613_7185_7997 | 251 |
| 205 | 3300035692 | Ga0373935_0005946 | Ga0373935_0005946_1938_2750 | 251 |
| 206 | 3300035725 | Ga0373947_0000256 | Ga0373947_0000256_21993_22805 | 251 |
| 207 | 3300046472 | Ga0495580_0044198 | Ga0495580_0044198_46_858 | 251 |
| 208 | 3300046514 | Ga0495618_0181186 | Ga0495618_0181186_130_942 | 251 |
| 209 | 3300046517 | Ga0495630_0004618 | Ga0495630_0004618_6721_7533 | 251 |
| 210 | 3300046526 | Ga0495666_0012120 | Ga0495666_0012120_1243_2055 | 251 |
| 211 | 3300046531 | Ga0495665_0042485 | Ga0495665_0042485_1510_2322 | 251 |
| 212 | 3300046533 | Ga0495640_0123195 | Ga0495640_0123195_111_923 | 251 |
| 213 | 3300046683 | Ga0495658_0047318 | Ga0495658_0047318_20_832 | 251 |
| 214 | 3300046690 | Ga0495624_0007453 | Ga0495624_0007453_252_1064 | 251 |
| 215 | 3300047471 | Ga0495684_0005376 | Ga0495684_0005376_1708_2520 | 251 |
| 216 | 3300047471 | Ga0495684_0007110 | Ga0495684_0007110_6757_7569 | 251 |
| 217 | 3300047673 | Ga0495593_0031816 | Ga0495593_0031816_901_1713 | 251 |
| 218 | 3300049571 | Ga0501034_0353748 | Ga0501034_0353748_131_949 | 251 |
| 219 | 3300049591 | Ga0501075_0171117 | Ga0501075_0171117_308_1108 | 251 |
| 220 | 3300049592 | Ga0501076_0008864 | Ga0501076_0008864_6499_7299 | 251 |
| 221 | 3300049593 | Ga0501077_0043446 | Ga0501077_0043446_2015_2815 | 251 |
| 222 | 3300049743 | Ga0501081_0003348 | Ga0501081_0003348_5401_6201 | 251 |
| 223 | 3300053085 | Ga0495619_0105390 | Ga0495619_0105390_347_1159 | 251 |
| 224 | 3300060353 | Ga0501082_0048193 | Ga0501082_0048193_1304_2104 | 251 |
| 225 | 3300061734 | Ga0530510_0239918 | Ga0530510_0239918_521_1321 | 251 |
| 226 | iso_pu_bacteria | 2643221598 | 2644001280 | 251 |
| 227 | iso_pu_bacteria | 2643221614 | 2644086002 | 251 |
| 228 | iso_pu_bacteria | 2643221661 | 2644345331 | 251 |
| 229 | iso_pu_bacteria | 2643221666 | 2644369605 | 251 |
| 230 | iso_pu_bacteria | 2891088606 | 2891093155 | 251 |
| 231 | 3300005535 | Ga0070684_100134267 | Ga0070684_1001342672 | 252 |
| 232 | 3300005564 | Ga0070664_100173555 | Ga0070664_1001735552 | 252 |
| 233 | 3300005843 | Ga0068860_100783811 | Ga0068860_1007838111 | 252 |
| 234 | 3300014325 | Ga0163163_10009574 | Ga0163163_100095748 | 252 |
| 235 | 3300026078 | Ga0207702_10863996 | Ga0207702_108639961 | 252 |
| 236 | 3300031239 | Ga0265328_10010982 | Ga0265328_100109823 | 252 |
| 237 | 3300035725 | Ga0373947_0346379 | Ga0373947_0346379_186_968 | 252 |
| 238 | 3300037471 | Ga0395905_0464233 | Ga0395905_0464233_294_1112 | 252 |
| 239 | 3300038443 | Ga0395901_0027330 | Ga0395901_0027330_1965_2783 | 252 |
| 240 | 3300048904 | Ga0496101_0036946 | Ga0496101_0036946_1822_2604 | 252 |
| 241 | 3300048905 | Ga0496102_0191113 | Ga0496102_0191113_522_1304 | 252 |
| 242 | 3300048908 | Ga0496105_0000392 | Ga0496105_0000392_14656_15438 | 252 |
| 243 | 3300048911 | Ga0496108_0001992 | Ga0496108_0001992_14291_15073 | 252 |
| 244 | 3300048912 | Ga0496109_0012017 | Ga0496109_0012017_1552_2334 | 252 |
| 245 | 3300048914 | Ga0496111_0001116 | Ga0496111_0001116_13798_14580 | 252 |
| 246 | 3300048915 | Ga0496112_0002870 | Ga0496112_0002870_8559_9341 | 252 |
| 247 | 3300048916 | Ga0496113_0004045 | Ga0496113_0004045_3525_4307 | 252 |
| 248 | 3300048918 | Ga0496115_0006960 | Ga0496115_0006960_1779_2561 | 252 |
| 249 | 3300049572 | Ga0501036_0028303 | Ga0501036_0028303_1279_2079 | 252 |
| 250 | 3300049577 | Ga0501041_0087680 | Ga0501041_0087680_218_1018 | 252 |
| 251 | 3300049578 | Ga0501042_0304709 | Ga0501042_0304709_229_1029 | 252 |
| 252 | 3300049582 | Ga0501048_0000282 | Ga0501048_0000282_8478_9302 | 252 |
| 253 | 3300049582 | Ga0501048_0020443 | Ga0501048_0020443_1878_2678 | 252 |
| 254 | 3300049586 | Ga0501070_0107545 | Ga0501070_0107545_1468_2286 | 252 |
| 255 | 3300049587 | Ga0501071_0238175 | Ga0501071_0238175_332_1132 | 252 |
| 256 | 3300049588 | Ga0501072_0386210 | Ga0501072_0386210_180_980 | 252 |
| 257 | 3300049592 | Ga0501076_0070351 | Ga0501076_0070351_1141_1941 | 252 |
| 258 | 3300049824 | Ga0501045_0141357 | Ga0501045_0141357_365_1165 | 252 |
| 259 | 3300050491 | nmdc:mga00v17_3192_c1 | nmdc:mga00v17_3192_c1_4420_5232 | 252 |
| 260 | 3300002739 | JGI25158J39367_1002742 | JGI25158J39367_10027423 | 253 |
| 261 | 3300002987 | JGI25159J45721_1000016 | JGI25159J45721_100001649 | 253 |
| 262 | 3300003354 | JGI25160J50197_1000002 | JGI25160J50197_1000002486 | 253 |
| 263 | 3300003374 | JGI25161J50226_1000397 | JGI25161J50226_100039714 | 253 |
| 264 | 3300004625 | Ga0055543_1000022 | Ga0055543_100002261 | 253 |
| 265 | 3300005262 | Ga0065165_1000058 | Ga0065165_1000058111 | 253 |
| 266 | 3300005330 | Ga0070690_100004984 | Ga0070690_1000049842 | 253 |
| 267 | 3300005340 | Ga0070689_100001622 | Ga0070689_1000016226 | 253 |
| 268 | 3300005347 | Ga0070668_100084250 | Ga0070668_1000842502 | 253 |
| 269 | 3300005353 | Ga0070669_100113247 | Ga0070669_1001132472 | 253 |
| 270 | 3300005354 | Ga0070675_100162214 | Ga0070675_1001622142 | 253 |
| 271 | 3300005355 | Ga0070671_100130128 | Ga0070671_1001301282 | 253 |
| 272 | 3300005365 | Ga0070688_100003117 | Ga0070688_1000031172 | 253 |
| 273 | 3300005456 | Ga0070678_100098451 | Ga0070678_1000984513 | 253 |
| 274 | 3300005615 | Ga0070702_100066993 | Ga0070702_1000669932 | 253 |
| 275 | 3300005617 | Ga0068859_100071069 | Ga0068859_1000710692 | 253 |
| 276 | 3300005618 | Ga0068864_100025873 | Ga0068864_1000258733 | 253 |
| 277 | 3300005718 | Ga0068866_10163645 | Ga0068866_101636452 | 253 |
| 278 | 3300005844 | Ga0068862_100307554 | Ga0068862_1003075541 | 253 |
| 279 | 3300006237 | Ga0097621_100436463 | Ga0097621_1004364631 | 253 |
| 280 | 3300006931 | Ga0097620_100071067 | Ga0097620_1000710672 | 253 |
| 281 | 3300009148 | Ga0105243_10012317 | Ga0105243_100123172 | 253 |
| 282 | 3300009177 | Ga0105248_10020676 | Ga0105248_100206766 | 253 |
| 283 | 3300013306 | Ga0163162_10254260 | Ga0163162_102542602 | 253 |
| 284 | 3300013308 | Ga0157375_10195734 | Ga0157375_101957342 | 253 |
| 285 | 3300014325 | Ga0163163_10128427 | Ga0163163_101284272 | 253 |
| 286 | 3300017792 | Ga0163161_10388757 | Ga0163161_103887572 | 253 |
| 287 | 3300025208 | Ga0209436_100737 | Ga0209436_1007373 | 253 |
| 288 | 3300025284 | Ga0209130_1000008 | Ga0209130_100000860 | 253 |
| 289 | 3300025294 | Ga0209025_1000631 | Ga0209025_10006313 | 253 |
| 290 | 3300025302 | Ga0207426_1000016 | Ga0207426_1000016501 | 253 |
| 291 | 3300025303 | Ga0209051_1028922 | Ga0209051_10289222 | 253 |
| 292 | 3300025907 | Ga0207645_10019613 | Ga0207645_100196132 | 253 |
| 293 | 3300025936 | Ga0207670_10001231 | Ga0207670_100012316 | 253 |
| 294 | 3300025938 | Ga0207704_10086021 | Ga0207704_100860212 | 253 |
| 295 | 3300025941 | Ga0207711_10153095 | Ga0207711_101530953 | 253 |
| 296 | 3300026089 | Ga0207648_10216168 | Ga0207648_102161682 | 253 |
| 297 | 3300026095 | Ga0207676_10007593 | Ga0207676_100075934 | 253 |
| 298 | 3300026121 | Ga0207683_10025771 | Ga0207683_100257713 | 253 |
| 299 | 3300028380 | Ga0268265_10272616 | Ga0268265_102726161 | 253 |
| 300 | 3300031251 | Ga0265327_10001660 | Ga0265327_1000166020 | 253 |
| 301 | 3300031456 | Ga0307513_10016341 | Ga0307513_100163418 | 253 |
| 302 | 3300034816 | Ga0373930_0011195 | Ga0373930_0011195_120_905 | 253 |
| 303 | 3300035084 | Ga0373928_0032115 | Ga0373928_0032115_361_1146 | 253 |
| 304 | 3300035091 | Ga0373951_0007101 | Ga0373951_0007101_1361_2146 | 253 |
| 305 | 3300035691 | Ga0373931_0070810 | Ga0373931_0070810_57_842 | 253 |
| 306 | 3300048903 | Ga0496100_0011359 | Ga0496100_0011359_986_1771 | 253 |
| 307 | 3300048904 | Ga0496101_0013345 | Ga0496101_0013345_1099_1884 | 253 |
| 308 | 3300048906 | Ga0496103_0209709 | Ga0496103_0209709_320_1105 | 253 |
| 309 | 3300048909 | Ga0496106_0214127 | Ga0496106_0214127_668_1453 | 253 |
| 310 | 3300048909 | Ga0496106_0409951 | Ga0496106_0409951_13_831 | 253 |
| 311 | 3300048914 | Ga0496111_0022364 | Ga0496111_0022364_2927_3712 | 253 |
| 312 | 3300048915 | Ga0496112_0042420 | Ga0496112_0042420_25_810 | 253 |
| 313 | 3300048916 | Ga0496113_0149293 | Ga0496113_0149293_152_937 | 253 |
| 314 | 3300048917 | Ga0496114_0084239 | Ga0496114_0084239_1690_2475 | 253 |
| 315 | 3300048924 | Ga0496121_0194844 | Ga0496121_0194844_413_1231 | 253 |
| 316 | 3300048924 | Ga0496121_0215073 | Ga0496121_0215073_322_1140 | 253 |
| 317 | 3300048924 | Ga0496121_0281058 | Ga0496121_0281058_240_1058 | 253 |
| 318 | 3300048925 | Ga0496122_0219559 | Ga0496122_0219559_257_1075 | 253 |
| 319 | 3300048927 | Ga0496124_0049494 | Ga0496124_0049494_1881_2699 | 253 |
| 320 | 3300048929 | Ga0496126_0455450 | Ga0496126_0455450_157_975 | 253 |
| 321 | 3300049568 | Ga0501031_0000003 | Ga0501031_0000003_111347_112165 | 253 |
| 322 | 3300049569 | Ga0501032_0000010 | Ga0501032_0000010_111347_112165 | 253 |
| 323 | 3300049570 | Ga0501033_0000017 | Ga0501033_0000017_111347_112165 | 253 |
| 324 | 3300049570 | Ga0501033_0244080 | Ga0501033_0244080_271_1092 | 253 |
| 325 | 3300049571 | Ga0501034_0000053 | Ga0501034_0000053_94657_95475 | 253 |
| 326 | 3300049572 | Ga0501036_0000009 | Ga0501036_0000009_111347_112165 | 253 |
| 327 | 3300049573 | Ga0501037_0000008 | Ga0501037_0000008_94648_95466 | 253 |
| 328 | 3300049574 | Ga0501038_0000008 | Ga0501038_0000008_94657_95475 | 253 |
| 329 | 3300049575 | Ga0501039_0000021 | Ga0501039_0000021_67078_67896 | 253 |
| 330 | 3300049576 | Ga0501040_0003914 | Ga0501040_0003914_2633_3451 | 253 |
| 331 | 3300049579 | Ga0501043_0000405 | Ga0501043_0000405_22112_22930 | 253 |
| 332 | 3300049581 | Ga0501047_0000894 | Ga0501047_0000894_7689_8507 | 253 |
| 333 | 3300049585 | Ga0501069_0367186 | Ga0501069_0367186_28_828 | 253 |
| 334 | 3300049586 | Ga0501070_0005238 | Ga0501070_0005238_3287_4105 | 253 |
| 335 | 3300049589 | Ga0501073_0256299 | Ga0501073_0256299_309_1109 | 253 |
| 336 | 3300049742 | Ga0501080_0018576 | Ga0501080_0018576_2717_3517 | 253 |
| 337 | 3300049742 | Ga0501080_0071736 | Ga0501080_0071736_2415_3197 | 253 |
| 338 | 3300049822 | Ga0501035_0000023 | Ga0501035_0000023_111347_112165 | 253 |
| 339 | 3300049823 | Ga0501044_0000021 | Ga0501044_0000021_94657_95475 | 253 |
| 340 | iso_pu_bacteria | 2671180139 | 2671694879 | 253 |
| 341 | 3300005337 | Ga0070682_100164415 | Ga0070682_1001644152 | 254 |
| 342 | 3300005347 | Ga0070668_100006623 | Ga0070668_1000066233 | 254 |
| 343 | 3300005347 | Ga0070668_100008269 | Ga0070668_1000082698 | 254 |
| 344 | 3300005347 | Ga0070668_100014191 | Ga0070668_1000141916 | 254 |
| 345 | 3300005436 | Ga0070713_100385128 | Ga0070713_1003851282 | 254 |
| 346 | 3300005617 | Ga0068859_100348761 | Ga0068859_1003487612 | 254 |
| 347 | 3300005617 | Ga0068859_100383314 | Ga0068859_1003833141 | 254 |
| 348 | 3300005843 | Ga0068860_100000083 | Ga0068860_100000083138 | 254 |
| 349 | 3300005843 | Ga0068860_100087672 | Ga0068860_1000876723 | 254 |
| 350 | 3300005844 | Ga0068862_100050812 | Ga0068862_1000508122 | 254 |
| 351 | 3300005844 | Ga0068862_100155563 | Ga0068862_1001555632 | 254 |
| 352 | 3300005844 | Ga0068862_100222386 | Ga0068862_1002223863 | 254 |
| 353 | 3300006931 | Ga0097620_100348769 | Ga0097620_1003487692 | 254 |
| 354 | 3300006931 | Ga0097620_100383329 | Ga0097620_1003833291 | 254 |
| 355 | 3300009098 | Ga0105245_10445948 | Ga0105245_104459482 | 254 |
| 356 | 3300025972 | Ga0207668_10004893 | Ga0207668_100048933 | 254 |
| 357 | 3300025972 | Ga0207668_10023824 | Ga0207668_100238243 | 254 |
| 358 | 3300025972 | Ga0207668_10146336 | Ga0207668_101463363 | 254 |
| 359 | 3300026118 | Ga0207675_100305961 | Ga0207675_1003059611 | 254 |
| 360 | 3300028380 | Ga0268265_10002598 | Ga0268265_100025988 | 254 |
| 361 | 3300028380 | Ga0268265_10039627 | Ga0268265_100396275 | 254 |
| 362 | 3300028381 | Ga0268264_10000055 | Ga0268264_10000055271 | 254 |
| 363 | 3300028381 | Ga0268264_10462787 | Ga0268264_104627872 | 254 |
| 364 | 3300031824 | Ga0307413_10183526 | Ga0307413_101835261 | 254 |
| 365 | 3300031911 | Ga0307412_10150819 | Ga0307412_101508192 | 254 |
| 366 | 3300048928 | Ga0496125_0282926 | Ga0496125_0282926_192_980 | 254 |
| 367 | 3300049822 | Ga0501035_0065014 | Ga0501035_0065014_898_1716 | 254 |
| 368 | 3300003203 | JGI25406J46586_10051175 | JGI25406J46586_100511752 | 255 |
| 369 | 3300003203 | JGI25406J46586_10064206 | JGI25406J46586_100642061 | 255 |
| 370 | 3300003775 | Ga0055524_1050089 | Ga0055524_10500891 | 255 |
| 371 | 3300005985 | Ga0081539_10016778 | Ga0081539_100167782 | 255 |
| 372 | 3300006038 | Ga0075365_10058029 | Ga0075365_100580293 | 255 |
| 373 | 3300006948 | Ga0099826_10101545 | Ga0099826_101015451 | 255 |
| 374 | 3300011119 | Ga0105246_10467859 | Ga0105246_104678591 | 255 |
| 375 | 3300014969 | Ga0157376_10679045 | Ga0157376_106790451 | 255 |
| 376 | 3300022739 | Ga0228711_1000019 | Ga0228711_10000195 | 255 |
| 377 | 3300022740 | Ga0228710_1000022 | Ga0228710_10000225 | 255 |
| 378 | 3300027111 | Ga0209281_1000227 | Ga0209281_100022711 | 255 |
| 379 | 3300027666 | Ga0209282_1000042 | Ga0209282_100004211 | 255 |
| 380 | 3300031967 | Ga0315914_1000009 | Ga0315914_1000009116 | 255 |
| 381 | 3300033430 | Ga0315913_1000015 | Ga0315913_100001511 | 255 |
| 382 | 3300033464 | Ga0315915_1000013 | Ga0315915_100001372 | 255 |
| 383 | 3300035115 | Ga0373941_0147295 | Ga0373941_0147295_21_812 | 255 |
| 384 | 3300049571 | Ga0501034_0423857 | Ga0501034_0423857_246_1067 | 255 |
| 385 | 3300049581 | Ga0501047_0481443 | Ga0501047_0481443_94_885 | 255 |
| 386 | 3300050491 | nmdc:mga00v17_211366_c1 | nmdc:mga00v17_211366_c1_122_913 | 255 |
| 387 | 3300053130 | Ga0500642_0019133 | Ga0500642_0019133_565_1356 | 255 |
| 388 | 3300005331 | Ga0070670_100135511 | Ga0070670_1001355112 | 256 |
| 389 | 3300005347 | Ga0070668_100023623 | Ga0070668_1000236233 | 256 |
| 390 | 3300005367 | Ga0070667_100016097 | Ga0070667_1000160972 | 256 |
| 391 | 3300005617 | Ga0068859_100021694 | Ga0068859_1000216944 | 256 |
| 392 | 3300005618 | Ga0068864_100025900 | Ga0068864_1000259004 | 256 |
| 393 | 3300005719 | Ga0068861_100032017 | Ga0068861_1000320172 | 256 |
| 394 | 3300005843 | Ga0068860_100138148 | Ga0068860_1001381482 | 256 |
| 395 | 3300005844 | Ga0068862_100070545 | Ga0068862_1000705453 | 256 |
| 396 | 3300005844 | Ga0068862_100204986 | Ga0068862_1002049862 | 256 |
| 397 | 3300006051 | Ga0075364_10273369 | Ga0075364_102733692 | 256 |
| 398 | 3300006177 | Ga0075362_10162958 | Ga0075362_101629582 | 256 |
| 399 | 3300006931 | Ga0097620_100021695 | Ga0097620_1000216953 | 256 |
| 400 | 3300014969 | Ga0157376_10177241 | Ga0157376_101772412 | 256 |
| 401 | 3300025295 | Ga0209564_1025178 | Ga0209564_10251782 | 256 |
| 402 | 3300025925 | Ga0207650_10255069 | Ga0207650_102550692 | 256 |
| 403 | 3300025972 | Ga0207668_10096720 | Ga0207668_100967202 | 256 |
| 404 | 3300025986 | Ga0207658_10329177 | Ga0207658_103291772 | 256 |
| 405 | 3300026118 | Ga0207675_100031839 | Ga0207675_1000318393 | 256 |
| 406 | 3300028381 | Ga0268264_10033405 | Ga0268264_100334053 | 256 |
| 407 | 3300031247 | Ga0265340_10064914 | Ga0265340_100649142 | 256 |
| 408 | 3300046674 | Ga0495588_0137928 | Ga0495588_0137928_254_1057 | 256 |
| 409 | 3300049589 | Ga0501073_0425378 | Ga0501073_0425378_83_901 | 256 |
| 410 | 3300050494 | nmdc:mga06z11_260156_c1 | nmdc:mga06z11_260156_c1_159_953 | 256 |
| 411 | 3300053153 | Ga0500616_0068987 | Ga0500616_0068987_771_1565 | 256 |
| 412 | iso_pu_bacteria | 2537561587 | 2537872806 | 256 |
| 413 | iso_pu_bacteria | 2554235003 | 2554246643 | 256 |
| 414 | iso_pu_bacteria | 2558860242 | 2559293871 | 256 |
| 415 | iso_pu_bacteria | 2599185210 | 2599605420 | 256 |
| 416 | iso_pu_bacteria | 2600255279 | 2601609156 | 256 |
| 417 | iso_pu_bacteria | 2600255308 | 2601745931 | 256 |
| 418 | iso_pu_bacteria | 2643221582 | 2643921141 | 256 |
| 419 | iso_pu_bacteria | 2643221693 | 2644519215 | 256 |
| 420 | iso_pu_bacteria | 2808606387 | 2808986353 | 256 |
| 421 | iso_pu_bacteria | 2818991439 | 2819556484 | 256 |
| 422 | iso_pu_bacteria | 2838675328 | 2838677213 | 256 |
| 423 | iso_pu_bacteria | 2838714209 | 2838716101 | 256 |
| 424 | iso_pu_bacteria | 2838719591 | 2838720099 | 256 |
| 425 | iso_pu_bacteria | 2838724970 | 2838726853 | 256 |
| 426 | iso_pu_bacteria | 2841846520 | 2841847032 | 256 |
| 427 | iso_pu_bacteria | 2841859092 | 2841860438 | 256 |
| 428 | iso_pu_bacteria | 2842124991 | 2842126939 | 256 |
| 429 | iso_pu_bacteria | 2842130223 | 2842132106 | 256 |
| 430 | iso_pu_bacteria | 2842152218 | 2842152725 | 256 |
| 431 | iso_pu_bacteria | 2842170452 | 2842172346 | 256 |
| 432 | iso_pu_bacteria | 2842175837 | 2842176344 | 256 |
| 433 | iso_pu_bacteria | 2842187318 | 2842189208 | 256 |
| 434 | iso_pu_bacteria | 2842211629 | 2842213522 | 256 |
| 435 | iso_pu_bacteria | 2842224351 | 2842224860 | 256 |
| 436 | iso_pu_bacteria | 2842515876 | 2842517223 | 256 |
| 437 | iso_pu_bacteria | 2899792073 | 2899792504 | 256 |
| 438 | iso_pu_bacteria | 2899845264 | 2899847906 | 256 |
| 439 | iso_pu_bacteria | 2919114240 | 2919116304 | 256 |
| 440 | iso_pu_bacteria | 2926754445 | 2926757258 | 256 |
| 441 | iso_pu_bacteria | 2926760298 | 2926761473 | 256 |
| 442 | iso_pu_bacteria | 2933006813 | 2933007370 | 256 |
| 443 | iso_pu_bacteria | 2933011516 | 2933012134 | 256 |
| 444 | iso_pu_bacteria | 2933594066 | 2933594578 | 256 |
| 445 | iso_pu_bacteria | 2978969890 | 2978973314 | 256 |
| 446 | iso_pu_bacteria | 2979089926 | 2979093239 | 256 |
| 447 | iso_pu_bacteria | 2979095461 | 2979099376 | 256 |
| 448 | iso_pu_bacteria | 2979100975 | 2979105210 | 256 |
| 449 | iso_pu_bacteria | 2984509177 | 2984512934 | 256 |
| 450 | iso_pu_bacteria | 2984518228 | 2984520702 | 256 |
| 451 | iso_pu_bacteria | 2984537506 | 2984539994 | 256 |
| 452 | iso_pu_bacteria | 2984587000 | 2984591595 | 256 |
| 453 | iso_pu_bacteria | 2984601300 | 2984602185 | 256 |
| 454 | iso_pu_bacteria | 650716007 | 650739062 | 256 |
| 455 | iso_pu_bacteria | 8003570095 | 8003572694 | 256 |
| 456 | 3300049571 | Ga0501034_0386069 | Ga0501034_0386069_211_1029 | 257 |
| 457 | 3300049583 | Ga0501067_0001197 | Ga0501067_0001197_106_924 | 257 |
| 458 | 3300049589 | Ga0501073_0067096 | Ga0501073_0067096_217_1035 | 257 |
| 459 | 3300054114 | Ga0501084_0453913 | Ga0501084_0453913_88_906 | 257 |
| 460 | iso_pu_bacteria | 2558860983 | 2561466895 | 257 |
| 461 | iso_pu_bacteria | 2889914905 | 2889916061 | 257 |
| 462 | iso_pu_bacteria | 2965047637 | 2965050726 | 257 |
| 463 | 3300049568 | Ga0501031_0169540 | Ga0501031_0169540_427_1245 | 258 |
| 464 | 3300049569 | Ga0501032_0012946 | Ga0501032_0012946_1103_1921 | 258 |
| 465 | 3300049570 | Ga0501033_0003783 | Ga0501033_0003783_2157_2975 | 258 |
| 466 | 3300049570 | Ga0501033_0005881 | Ga0501033_0005881_1497_2315 | 258 |
| 467 | 3300049570 | Ga0501033_0396228 | Ga0501033_0396228_20_844 | 258 |
| 468 | 3300049571 | Ga0501034_0009703 | Ga0501034_0009703_8628_9446 | 258 |
| 469 | 3300049571 | Ga0501034_0136949 | Ga0501034_0136949_49_849 | 258 |
| 470 | 3300049572 | Ga0501036_0030433 | Ga0501036_0030433_693_1511 | 258 |
| 471 | 3300049573 | Ga0501037_0002684 | Ga0501037_0002684_5359_6177 | 258 |
| 472 | 3300049576 | Ga0501040_0271701 | Ga0501040_0271701_209_1027 | 258 |
| 473 | 3300049578 | Ga0501042_0011075 | Ga0501042_0011075_3439_4257 | 258 |
| 474 | 3300049581 | Ga0501047_0020856 | Ga0501047_0020856_1270_2088 | 258 |
| 475 | 3300049581 | Ga0501047_0686654 | Ga0501047_0686654_23_823 | 258 |
| 476 | 3300049582 | Ga0501048_0004455 | Ga0501048_0004455_157_975 | 258 |
| 477 | 3300049584 | Ga0501068_0005249 | Ga0501068_0005249_254_1072 | 258 |
| 478 | 3300049585 | Ga0501069_0196147 | Ga0501069_0196147_320_1138 | 258 |
| 479 | 3300049586 | Ga0501070_0006463 | Ga0501070_0006463_6098_6916 | 258 |
| 480 | 3300049589 | Ga0501073_0146464 | Ga0501073_0146464_688_1506 | 258 |
| 481 | 3300049742 | Ga0501080_0065574 | Ga0501080_0065574_1497_2315 | 258 |
| 482 | 3300049822 | Ga0501035_0003419 | Ga0501035_0003419_7419_8237 | 258 |
| 483 | 3300049822 | Ga0501035_0469443 | Ga0501035_0469443_28_846 | 258 |
| 484 | 3300049824 | Ga0501045_0007088 | Ga0501045_0007088_5616_6434 | 258 |
| 485 | iso_pu_bacteria | 2513237159 | 2513996768 | 258 |
| 486 | iso_pu_bacteria | 2582581283 | 2585165003 | 258 |
| 487 | iso_pu_bacteria | 2582581306 | 2585269547 | 258 |
| 488 | iso_pu_bacteria | 2582581865 | 2585385485 | 258 |
| 489 | iso_pu_bacteria | 2582581866 | 2585391905 | 258 |
| 490 | iso_pu_bacteria | 2599185236 | 2599719550 | 258 |
| 491 | iso_pu_bacteria | 2643221607 | 2644047122 | 258 |
| 492 | iso_pu_bacteria | 2643221618 | 2644103236 | 258 |
| 493 | iso_pu_bacteria | 2643221626 | 2644151892 | 258 |
| 494 | iso_pu_bacteria | 2643221636 | 2644203439 | 258 |
| 495 | iso_pu_bacteria | 2643221637 | 2644206701 | 258 |
| 496 | iso_pu_bacteria | 2643221655 | 2644306164 | 258 |
| 497 | iso_pu_bacteria | 2643221659 | 2644330414 | 258 |
| 498 | iso_pu_bacteria | 2643221686 | 2644479911 | 258 |
| 499 | iso_pu_bacteria | 2643221688 | 2644492247 | 258 |
| 500 | iso_pu_bacteria | 2643221689 | 2644496750 | 258 |
| 501 | iso_pu_bacteria | 2643221698 | 2644542840 | 258 |
| 502 | iso_pu_bacteria | 2643221712 | 2644618886 | 258 |
| 503 | iso_pu_bacteria | 2643221718 | 2644650348 | 258 |
| 504 | iso_pu_bacteria | 2837678835 | 2837683332 | 258 |
| 505 | iso_pu_bacteria | 2842205361 | 2842206954 | 258 |
| 506 | iso_pu_bacteria | 2842278818 | 2842280353 | 258 |
| 507 | iso_pu_bacteria | 2842285085 | 2842286835 | 258 |
| 508 | iso_pu_bacteria | 2842402390 | 2842403612 | 258 |
| 509 | iso_pu_bacteria | 2842409023 | 2842410686 | 258 |
| 510 | iso_pu_bacteria | 2842415677 | 2842417332 | 258 |
| 511 | iso_pu_bacteria | 2842521101 | 2842521699 | 258 |
| 512 | iso_pu_bacteria | 2844163670 | 2844170748 | 258 |
| 513 | iso_pu_bacteria | 2889790730 | 2889795369 | 258 |
| 514 | iso_pu_bacteria | 2941499720 | 2941500709 | 258 |
| 515 | iso_pu_bacteria | 8005301065 | 8005301550 | 258 |
| 516 | iso_pu_bacteria | 8005688590 | 8005690266 | 258 |
| 517 | iso_pu_bacteria | 8018150411 | 8018153603 | 258 |
| 518 | iso_pu_bacteria | 8054558443 | 8054559212 | 258 |
| 519 | iso_pu_bacteria | 8056875544 | 8056879034 | 258 |
| 520 | 3300005548 | Ga0070665_100004421 | Ga0070665_1000044215 | 259 |
| 521 | 3300006042 | Ga0075368_10000355 | Ga0075368_100003551 | 259 |
| 522 | 3300006178 | Ga0075367_10002714 | Ga0075367_100027143 | 259 |
| 523 | 3300006186 | Ga0075369_10025016 | Ga0075369_100250162 | 259 |
| 524 | 3300006186 | Ga0075369_10043510 | Ga0075369_100435101 | 259 |
| 525 | 3300006195 | Ga0075366_10115249 | Ga0075366_101152492 | 259 |
| 526 | 3300006353 | Ga0075370_10025169 | Ga0075370_100251693 | 259 |
| 527 | 3300006948 | Ga0099826_10006813 | Ga0099826_100068135 | 259 |
| 528 | 3300013100 | Ga0157373_10001801 | Ga0157373_100018018 | 259 |
| 529 | 3300013102 | Ga0157371_10000058 | Ga0157371_1000005816 | 259 |
| 530 | 3300013104 | Ga0157370_10000792 | Ga0157370_1000079222 | 259 |
| 531 | 3300027312 | Ga0209371_1000009 | Ga0209371_1000009426 | 259 |
| 532 | 3300027312 | Ga0209371_1000547 | Ga0209371_100054723 | 259 |
| 533 | 3300027666 | Ga0209282_1003866 | Ga0209282_10038663 | 259 |
| 534 | 3300027866 | Ga0209813_10000358 | Ga0209813_100003583 | 259 |
| 535 | 3300028379 | Ga0268266_10006291 | Ga0268266_100062913 | 259 |
| 536 | 3300030500 | Ga0268256_1000010 | Ga0268256_1000010425 | 259 |
| 537 | 3300030500 | Ga0268256_1016656 | Ga0268256_10166562 | 259 |
| 538 | 3300046558 | Ga0495633_0060660 | Ga0495633_0060660_124_936 | 259 |
| 539 | 3300046674 | Ga0495588_0002043 | Ga0495588_0002043_341_1153 | 259 |
| 540 | 3300046692 | Ga0495671_0041827 | Ga0495671_0041827_27_839 | 259 |
| 541 | 3300047470 | Ga0495681_0017611 | Ga0495681_0017611_2627_3439 | 259 |
| 542 | 3300048916 | Ga0496113_0080376 | Ga0496113_0080376_1318_2130 | 259 |
| 543 | 3300048917 | Ga0496114_0152441 | Ga0496114_0152441_233_1051 | 259 |
| 544 | 3300048919 | Ga0496116_0018419 | Ga0496116_0018419_4116_4928 | 259 |
| 545 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_1955701_1956513 | 259 |
| 546 | 3300048921 | Ga0496118_0000233 | Ga0496118_0000233_53591_54403 | 259 |
| 547 | 3300048922 | Ga0496119_0061517 | Ga0496119_0061517_509_1321 | 259 |
| 548 | 3300048923 | Ga0496120_0000021 | Ga0496120_0000021_110062_110874 | 259 |
| 549 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_1326491_1327303 | 259 |
| 550 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_1330222_1331034 | 259 |
| 551 | 3300048927 | Ga0496124_0015389 | Ga0496124_0015389_4381_5193 | 259 |
| 552 | 3300048928 | Ga0496125_0041633 | Ga0496125_0041633_1185_1997 | 259 |
| 553 | 3300050491 | nmdc:mga00v17_72_c1 | nmdc:mga00v17_72_c1_21618_22430 | 259 |
| 554 | 3300050492 | nmdc:mga0yw44_166453_c1 | nmdc:mga0yw44_166453_c1_563_1375 | 259 |
| 555 | 3300050493 | nmdc:mga0k408_82874_c1 | nmdc:mga0k408_82874_c1_432_1244 | 259 |
| 556 | 3300050494 | nmdc:mga06z11_11753_c1 | nmdc:mga06z11_11753_c1_2637_3449 | 259 |
| 557 | 3300050495 | nmdc:mga04h51_11247_c1 | nmdc:mga04h51_11247_c1_1237_2049 | 259 |
| 558 | 3300050496 | nmdc:mga07m45_50268_c1 | nmdc:mga07m45_50268_c1_394_1206 | 259 |
| 559 | 3300050516 | nmdc:mga0sz30_13611_c1 | nmdc:mga0sz30_13611_c1_129_941 | 259 |
| 560 | 3300050516 | nmdc:mga0sz30_26730_c1 | nmdc:mga0sz30_26730_c1_271_1083 | 259 |
| 561 | 3300050516 | nmdc:mga0sz30_609_c1 | nmdc:mga0sz30_609_c1_9845_10657 | 259 |
| 562 | 3300053107 | Ga0500560_018504 | Ga0500560_018504_983_1795 | 259 |
| 563 | 3300053137 | Ga0500561_0000123 | Ga0500561_0000123_11956_12768 | 259 |
| 564 | 3300053157 | Ga0500624_000320 | Ga0500624_000320_11997_12809 | 259 |
| 565 | 3300059643 | Ga0587072_023137 | Ga0587072_023137_218_1030 | 259 |
| 566 | iso_pu_bacteria | 2509276021 | 2509388439 | 259 |
| 567 | iso_pu_bacteria | 2509276033 | 2509443987 | 259 |
| 568 | iso_pu_bacteria | 2510065019 | 2510131414 | 259 |
| 569 | iso_pu_bacteria | 2510461076 | 2510897768 | 259 |
| 570 | iso_pu_bacteria | 2510917028 | 2511184788 | 259 |
| 571 | iso_pu_bacteria | 2510917030 | 2511196816 | 259 |
| 572 | iso_pu_bacteria | 2513237084 | 2513570633 | 259 |
| 573 | iso_pu_bacteria | 2513237085 | 2513580214 | 259 |
| 574 | iso_pu_bacteria | 2513237087 | 2513591482 | 259 |
| 575 | iso_pu_bacteria | 2513237088 | 2513596735 | 259 |
| 576 | iso_pu_bacteria | 2513237093 | 2513634261 | 259 |
| 577 | iso_pu_bacteria | 2513237103 | 2513713190 | 259 |
| 578 | iso_pu_bacteria | 2513237138 | 2513864850 | 259 |
| 579 | iso_pu_bacteria | 2513237144 | 2513910356 | 259 |
| 580 | iso_pu_bacteria | 2513237146 | 2513928304 | 259 |
| 581 | iso_pu_bacteria | 2513237162 | 2514020246 | 259 |
| 582 | iso_pu_bacteria | 2515075009 | 2515110375 | 259 |
| 583 | iso_pu_bacteria | 2515154113 | 2515634575 | 259 |
| 584 | iso_pu_bacteria | 2515154114 | 2515643800 | 259 |
| 585 | iso_pu_bacteria | 2515154116 | 2515657198 | 259 |
| 586 | iso_pu_bacteria | 2515154134 | 2515743301 | 259 |
| 587 | iso_pu_bacteria | 2516653077 | 2517039062 | 259 |
| 588 | iso_pu_bacteria | 2516653085 | 2517079318 | 259 |
| 589 | iso_pu_bacteria | 2517093000 | 2517093259 | 259 |
| 590 | iso_pu_bacteria | 2517287029 | 2517409526 | 259 |
| 591 | iso_pu_bacteria | 2519899620 | 2520375540 | 259 |
| 592 | iso_pu_bacteria | 2529292951 | 2530647821 | 259 |
| 593 | iso_pu_bacteria | 2534681796 | 2535515095 | 259 |
| 594 | iso_pu_bacteria | 2582581294 | 2585203673 | 259 |
| 595 | iso_pu_bacteria | 2582581298 | 2585227077 | 259 |
| 596 | iso_pu_bacteria | 2582581299 | 2585233195 | 259 |
| 597 | iso_pu_bacteria | 2582581304 | 2585255914 | 259 |
| 598 | iso_pu_bacteria | 2582581867 | 2585398550 | 259 |
| 599 | iso_pu_bacteria | 2585427526 | 2585529265 | 259 |
| 600 | iso_pu_bacteria | 2585427528 | 2585539684 | 259 |
| 601 | iso_pu_bacteria | 2585427529 | 2585550498 | 259 |
| 602 | iso_pu_bacteria | 2585427590 | 2585819300 | 259 |
| 603 | iso_pu_bacteria | 2585427593 | 2585837641 | 259 |
| 604 | iso_pu_bacteria | 2585427594 | 2585844653 | 259 |
| 605 | iso_pu_bacteria | 2599185156 | 2599333005 | 259 |
| 606 | iso_pu_bacteria | 2599185170 | 2599419186 | 259 |
| 607 | iso_pu_bacteria | 2599185352 | 2600191457 | 259 |
| 608 | iso_pu_bacteria | 2615840624 | 2616297117 | 259 |
| 609 | iso_pu_bacteria | 2643221557 | 2643806297 | 259 |
| 610 | iso_pu_bacteria | 2643221599 | 2644007319 | 259 |
| 611 | iso_pu_bacteria | 2643221610 | 2644070101 | 259 |
| 612 | iso_pu_bacteria | 2643221634 | 2644190587 | 259 |
| 613 | iso_pu_bacteria | 2643221643 | 2644241547 | 259 |
| 614 | iso_pu_bacteria | 2643221668 | 2644381072 | 259 |
| 615 | iso_pu_bacteria | 2643221675 | 2644414978 | 259 |
| 616 | iso_pu_bacteria | 2643221680 | 2644448635 | 259 |
| 617 | iso_pu_bacteria | 2643221723 | 2644674023 | 259 |
| 618 | iso_pu_bacteria | 2643221726 | 2644689057 | 259 |
| 619 | iso_pu_bacteria | 2718217882 | 2719179570 | 259 |
| 620 | iso_pu_bacteria | 2718217927 | 2719384123 | 259 |
| 621 | iso_pu_bacteria | 2718217997 | 2719663916 | 259 |
| 622 | iso_pu_bacteria | 2718218009 | 2719730240 | 259 |
| 623 | iso_pu_bacteria | 2718218199 | 2720490335 | 259 |
| 624 | iso_pu_bacteria | 2718218232 | 2720611710 | 259 |
| 625 | iso_pu_bacteria | 2718218233 | 2720618559 | 259 |
| 626 | iso_pu_bacteria | 2718218235 | 2720629967 | 259 |
| 627 | iso_pu_bacteria | 2718218269 | 2720773662 | 259 |
| 628 | iso_pu_bacteria | 2718218363 | 2721145663 | 259 |
| 629 | iso_pu_bacteria | 2718218365 | 2721157179 | 259 |
| 630 | iso_pu_bacteria | 2718218366 | 2721162542 | 259 |
| 631 | iso_pu_bacteria | 2718218423 | 2721397893 | 259 |
| 632 | iso_pu_bacteria | 2721755514 | 2722838712 | 259 |
| 633 | iso_pu_bacteria | 2721755556 | 2723025335 | 259 |
| 634 | iso_pu_bacteria | 2721755684 | 2723558918 | 259 |
| 635 | iso_pu_bacteria | 2721755685 | 2723565488 | 259 |
| 636 | iso_pu_bacteria | 2721755809 | 2724036703 | 259 |
| 637 | iso_pu_bacteria | 2721755810 | 2724042996 | 259 |
| 638 | iso_pu_bacteria | 2721755819 | 2724088269 | 259 |
| 639 | iso_pu_bacteria | 2721755822 | 2724102753 | 259 |
| 640 | iso_pu_bacteria | 2721755823 | 2724108653 | 259 |
| 641 | iso_pu_bacteria | 2724679232 | 2725948993 | 259 |
| 642 | iso_pu_bacteria | 2728369352 | 2730106271 | 259 |
| 643 | iso_pu_bacteria | 2728369365 | 2730162807 | 259 |
| 644 | iso_pu_bacteria | 2728369397 | 2730296811 | 259 |
| 645 | iso_pu_bacteria | 2738541293 | 2738801241 | 259 |
| 646 | iso_pu_bacteria | 2738541333 | 2739037074 | 259 |
| 647 | iso_pu_bacteria | 2765235942 | 2766066567 | 259 |
| 648 | iso_pu_bacteria | 2791355256 | 2793295210 | 259 |
| 649 | iso_pu_bacteria | 2791355259 | 2793316330 | 259 |
| 650 | iso_pu_bacteria | 2791355260 | 2793323438 | 259 |
| 651 | iso_pu_bacteria | 2791355261 | 2793326168 | 259 |
| 652 | iso_pu_bacteria | 2791355262 | 2793334228 | 259 |
| 653 | iso_pu_bacteria | 2791355263 | 2793341806 | 259 |
| 654 | iso_pu_bacteria | 2791355264 | 2793348143 | 259 |
| 655 | iso_pu_bacteria | 2791355265 | 2793357235 | 259 |
| 656 | iso_pu_bacteria | 2791355266 | 2793361512 | 259 |
| 657 | iso_pu_bacteria | 2791355267 | 2793364674 | 259 |
| 658 | iso_pu_bacteria | 2802429605 | 2805929369 | 259 |
| 659 | iso_pu_bacteria | 2802429606 | 2805932372 | 259 |
| 660 | iso_pu_bacteria | 2802429633 | 2806047544 | 259 |
| 661 | iso_pu_bacteria | 2802429634 | 2806054963 | 259 |
| 662 | iso_pu_bacteria | 2802429635 | 2806062135 | 259 |
| 663 | iso_pu_bacteria | 2802429636 | 2806067139 | 259 |
| 664 | iso_pu_bacteria | 2802429637 | 2806076460 | 259 |
| 665 | iso_pu_bacteria | 2828305725 | 2828307785 | 259 |
| 666 | iso_pu_bacteria | 2838016132 | 2838020284 | 259 |
| 667 | iso_pu_bacteria | 2838022645 | 2838028180 | 259 |
| 668 | iso_pu_bacteria | 2838035591 | 2838037130 | 259 |
| 669 | iso_pu_bacteria | 2838042994 | 2838044424 | 259 |
| 670 | iso_pu_bacteria | 2838048938 | 2838051500 | 259 |
| 671 | iso_pu_bacteria | 2838061910 | 2838063974 | 259 |
| 672 | iso_pu_bacteria | 2838068647 | 2838071108 | 259 |
| 673 | iso_pu_bacteria | 2838661181 | 2838663694 | 259 |
| 674 | iso_pu_bacteria | 2838668709 | 2838672397 | 259 |
| 675 | iso_pu_bacteria | 2838680041 | 2838680582 | 259 |
| 676 | iso_pu_bacteria | 2838686498 | 2838691585 | 259 |
| 677 | iso_pu_bacteria | 2838694306 | 2838695385 | 259 |
| 678 | iso_pu_bacteria | 2838701080 | 2838703861 | 259 |
| 679 | iso_pu_bacteria | 2838707686 | 2838708761 | 259 |
| 680 | iso_pu_bacteria | 2838729681 | 2838733931 | 259 |
| 681 | iso_pu_bacteria | 2838742623 | 2838747005 | 259 |
| 682 | iso_pu_bacteria | 2841851746 | 2841856146 | 259 |
| 683 | iso_pu_bacteria | 2841864319 | 2841866815 | 259 |
| 684 | iso_pu_bacteria | 2842077413 | 2842080004 | 259 |
| 685 | iso_pu_bacteria | 2842118031 | 2842120623 | 259 |
| 686 | iso_pu_bacteria | 2842146304 | 2842148347 | 259 |
| 687 | iso_pu_bacteria | 2842156927 | 2842161934 | 259 |
| 688 | iso_pu_bacteria | 2842163707 | 2842169690 | 259 |
| 689 | iso_pu_bacteria | 2842180545 | 2842185776 | 259 |
| 690 | iso_pu_bacteria | 2842192696 | 2842192883 | 259 |
| 691 | iso_pu_bacteria | 2842198810 | 2842205173 | 259 |
| 692 | iso_pu_bacteria | 2842217011 | 2842218797 | 259 |
| 693 | iso_pu_bacteria | 2842229732 | 2842235304 | 259 |
| 694 | iso_pu_bacteria | 2842237096 | 2842238173 | 259 |
| 695 | iso_pu_bacteria | 2842243621 | 2842248241 | 259 |
| 696 | iso_pu_bacteria | 2842250916 | 2842253413 | 259 |
| 697 | iso_pu_bacteria | 2842257432 | 2842262165 | 259 |
| 698 | iso_pu_bacteria | 2842264693 | 2842268762 | 259 |
| 699 | iso_pu_bacteria | 2842271015 | 2842276558 | 259 |
| 700 | iso_pu_bacteria | 2842291075 | 2842293664 | 259 |
| 701 | iso_pu_bacteria | 2842304105 | 2842306505 | 259 |
| 702 | iso_pu_bacteria | 2842311132 | 2842312622 | 259 |
| 703 | iso_pu_bacteria | 2842317721 | 2842322511 | 259 |
| 704 | iso_pu_bacteria | 2842341865 | 2842343076 | 259 |
| 705 | iso_pu_bacteria | 2842363717 | 2842367198 | 259 |
| 706 | iso_pu_bacteria | 2842370503 | 2842371045 | 259 |
| 707 | iso_pu_bacteria | 2842377471 | 2842380061 | 259 |
| 708 | iso_pu_bacteria | 2842384541 | 2842387132 | 259 |
| 709 | iso_pu_bacteria | 2842395702 | 2842399245 | 259 |
| 710 | iso_pu_bacteria | 2842422224 | 2842424724 | 259 |
| 711 | iso_pu_bacteria | 2842428310 | 2842433038 | 259 |
| 712 | iso_pu_bacteria | 2842434925 | 2842439343 | 259 |
| 713 | iso_pu_bacteria | 2842441272 | 2842445972 | 259 |
| 714 | iso_pu_bacteria | 2842447887 | 2842451847 | 259 |
| 715 | iso_pu_bacteria | 2842462802 | 2842467158 | 259 |
| 716 | iso_pu_bacteria | 2842469257 | 2842473814 | 259 |
| 717 | iso_pu_bacteria | 2842489311 | 2842492463 | 259 |
| 718 | iso_pu_bacteria | 2842495871 | 2842500043 | 259 |
| 719 | iso_pu_bacteria | 2842922631 | 2842923311 | 259 |
| 720 | iso_pu_bacteria | 2844454524 | 2844455994 | 259 |
| 721 | iso_pu_bacteria | 2857516855 | 2857523442 | 259 |
| 722 | iso_pu_bacteria | 2891373044 | 2891374936 | 259 |
| 723 | iso_pu_bacteria | 2919100787 | 2919101350 | 259 |
| 724 | iso_pu_bacteria | 2919450847 | 2919454236 | 259 |
| 725 | iso_pu_bacteria | 2920822456 | 2920823377 | 259 |
| 726 | iso_pu_bacteria | 2923556063 | 2923557143 | 259 |
| 727 | iso_pu_bacteria | 2933016740 | 2933017682 | 259 |
| 728 | iso_pu_bacteria | 2933570622 | 2933573574 | 259 |
| 729 | iso_pu_bacteria | 2933586486 | 2933593995 | 259 |
| 730 | iso_pu_bacteria | 2933599457 | 2933601907 | 259 |
| 731 | iso_pu_bacteria | 2935894831 | 2935895908 | 259 |
| 732 | iso_pu_bacteria | 2935901341 | 2935907167 | 259 |
| 733 | iso_pu_bacteria | 2936367885 | 2936368931 | 259 |
| 734 | iso_pu_bacteria | 2936375103 | 2936378454 | 259 |
| 735 | iso_pu_bacteria | 2936381700 | 2936383741 | 259 |
| 736 | iso_pu_bacteria | 2989349275 | 2989351407 | 259 |
| 737 | iso_pu_bacteria | 2989771324 | 2989772789 | 259 |
| 738 | iso_pu_bacteria | 2996887358 | 2996892174 | 259 |
| 739 | iso_pu_bacteria | 2996893221 | 2996893431 | 259 |
| 740 | iso_pu_bacteria | 3003930520 | 3003931953 | 259 |
| 741 | iso_pu_bacteria | 3005409236 | 3005411231 | 259 |
| 742 | iso_pu_bacteria | 3005445848 | 3005446182 | 259 |
| 743 | iso_pu_bacteria | 3005452660 | 3005452839 | 259 |
| 744 | iso_pu_bacteria | 639633055 | 639646644 | 259 |
| 745 | iso_pu_bacteria | 8001845381 | 8001848076 | 259 |
| 746 | iso_pu_bacteria | 8005258706 | 8005263476 | 259 |
| 747 | iso_pu_bacteria | 8005275841 | 8005278834 | 259 |
| 748 | iso_pu_bacteria | 8005282627 | 8005289012 | 259 |
| 749 | iso_pu_bacteria | 8005289223 | 8005291086 | 259 |
| 750 | iso_pu_bacteria | 8005307578 | 8005309197 | 259 |
| 751 | iso_pu_bacteria | 8005321885 | 8005326701 | 259 |
| 752 | iso_pu_bacteria | 8005376324 | 8005377437 | 259 |
| 753 | iso_pu_bacteria | 8005382845 | 8005387300 | 259 |
| 754 | iso_pu_bacteria | 8005395548 | 8005400123 | 259 |
| 755 | iso_pu_bacteria | 8005430974 | 8005432930 | 259 |
| 756 | iso_pu_bacteria | 8005460587 | 8005461014 | 259 |
| 757 | iso_pu_bacteria | 8005497431 | 8005498658 | 259 |
| 758 | iso_pu_bacteria | 8005542996 | 8005543768 | 259 |
| 759 | iso_pu_bacteria | 8005556819 | 8005560629 | 259 |
| 760 | iso_pu_bacteria | 8005563573 | 8005563912 | 259 |
| 761 | iso_pu_bacteria | 8005570704 | 8005576919 | 259 |
| 762 | iso_pu_bacteria | 8005619151 | 8005619852 | 259 |
| 763 | iso_pu_bacteria | 8005626139 | 8005628424 | 259 |
| 764 | iso_pu_bacteria | 8005668836 | 8005670069 | 259 |
| 765 | iso_pu_bacteria | 8005695170 | 8005699257 | 259 |
| 766 | iso_pu_bacteria | 8018127388 | 8018133121 | 259 |
| 767 | iso_pu_bacteria | 8018163183 | 8018169022 | 259 |
| 768 | iso_pu_bacteria | 8018176218 | 8018179460 | 259 |
| 769 | iso_pu_bacteria | 8023680758 | 8023684234 | 259 |
| 770 | iso_pu_bacteria | 8024479707 | 8024480273 | 259 |
| 771 | iso_pu_bacteria | 8024486573 | 8024491417 | 259 |
| 772 | iso_pu_bacteria | 8024501048 | 8024501606 | 259 |
| 773 | iso_pu_bacteria | 8056375014 | 8056375631 | 259 |
| 774 | iso_pu_bacteria | 8056382006 | 8056385945 | 259 |
| 775 | iso_pu_bacteria | 8057874678 | 8057876045 | 259 |
| 776 | 3300005340 | Ga0070689_100445583 | Ga0070689_1004455832 | 260 |
| 777 | 3300005354 | Ga0070675_100635039 | Ga0070675_1006350391 | 260 |
| 778 | 3300031241 | Ga0265325_10003327 | Ga0265325_100033275 | 260 |
| 779 | 3300049570 | Ga0501033_0223152 | Ga0501033_0223152_298_1116 | 260 |
| 780 | 3300049589 | Ga0501073_0015653 | Ga0501073_0015653_633_1451 | 260 |
| 781 | 3300053140 | Ga0500573_0007042 | Ga0500573_0007042_4083_4898 | 260 |
| 782 | iso_pu_bacteria | 2508501122 | 2509107042 | 260 |
| 783 | iso_pu_bacteria | 2509276019 | 2509375002 | 260 |
| 784 | iso_pu_bacteria | 2510065057 | 2510305154 | 260 |
| 785 | iso_pu_bacteria | 2511231052 | 2511500536 | 260 |
| 786 | iso_pu_bacteria | 2512047086 | 2512531995 | 260 |
| 787 | iso_pu_bacteria | 2512875026 | 2512972687 | 260 |
| 788 | iso_pu_bacteria | 2513237086 | 2513584162 | 260 |
| 789 | iso_pu_bacteria | 2513237089 | 2513602924 | 260 |
| 790 | iso_pu_bacteria | 2513237091 | 2513620441 | 260 |
| 791 | iso_pu_bacteria | 2513237140 | 2513880611 | 260 |
| 792 | iso_pu_bacteria | 2513237143 | 2513903341 | 260 |
| 793 | iso_pu_bacteria | 2513237156 | 2513986333 | 260 |
| 794 | iso_pu_bacteria | 2513237160 | 2514005176 | 260 |
| 795 | iso_pu_bacteria | 2515154107 | 2515607724 | 260 |
| 796 | iso_pu_bacteria | 2516143018 | 2516204337 | 260 |
| 797 | iso_pu_bacteria | 2516653046 | 2516891858 | 260 |
| 798 | iso_pu_bacteria | 2517487022 | 2517568654 | 260 |
| 799 | iso_pu_bacteria | 2551306084 | 2551679337 | 260 |
| 800 | iso_pu_bacteria | 2551306085 | 2551686158 | 260 |
| 801 | iso_pu_bacteria | 2551306086 | 2551692118 | 260 |
| 802 | iso_pu_bacteria | 2551306087 | 2551699805 | 260 |
| 803 | iso_pu_bacteria | 2551306089 | 2551710541 | 260 |
| 804 | iso_pu_bacteria | 2551306089 | 2551712287 | 260 |
| 805 | iso_pu_bacteria | 2551306090 | 2551723203 | 260 |
| 806 | iso_pu_bacteria | 2551306091 | 2551729900 | 260 |
| 807 | iso_pu_bacteria | 2551306092 | 2551733414 | 260 |
| 808 | iso_pu_bacteria | 2551306093 | 2551743530 | 260 |
| 809 | iso_pu_bacteria | 2558860100 | 2558866004 | 260 |
| 810 | iso_pu_bacteria | 2657244999 | 2657681898 | 260 |
| 811 | iso_pu_bacteria | 2690316117 | 2692317253 | 260 |
| 812 | iso_pu_bacteria | 2751185821 | 2753461347 | 260 |
| 813 | iso_pu_bacteria | 2757320392 | 2757569210 | 260 |
| 814 | iso_pu_bacteria | 2791355082 | 2792582919 | 260 |
| 815 | iso_pu_bacteria | 2791355091 | 2792623808 | 260 |
| 816 | iso_pu_bacteria | 2791355092 | 2792629812 | 260 |
| 817 | iso_pu_bacteria | 2791355094 | 2792638147 | 260 |
| 818 | iso_pu_bacteria | 2791355253 | 2793283344 | 260 |
| 819 | iso_pu_bacteria | 2802428858 | 2802720313 | 260 |
| 820 | iso_pu_bacteria | 2802428859 | 2802726132 | 260 |
| 821 | iso_pu_bacteria | 2802428860 | 2802731703 | 260 |
| 822 | iso_pu_bacteria | 2802428861 | 2802739454 | 260 |
| 823 | iso_pu_bacteria | 2802428862 | 2802742596 | 260 |
| 824 | iso_pu_bacteria | 2802428863 | 2802749301 | 260 |
| 825 | iso_pu_bacteria | 2802429268 | 2804750917 | 260 |
| 826 | iso_pu_bacteria | 2838074704 | 2838075375 | 260 |
| 827 | iso_pu_bacteria | 2847417321 | 2847417680 | 260 |
| 828 | iso_pu_bacteria | 2848992105 | 2848992485 | 260 |
| 829 | iso_pu_bacteria | 2850079185 | 2850079978 | 260 |
| 830 | iso_pu_bacteria | 2855825444 | 2855831775 | 260 |
| 831 | iso_pu_bacteria | 2855839649 | 2855840006 | 260 |
| 832 | iso_pu_bacteria | 2855872281 | 2855874533 | 260 |
| 833 | iso_pu_bacteria | 2858800743 | 2858803970 | 260 |
| 834 | iso_pu_bacteria | 2896384573 | 2896391552 | 260 |
| 835 | iso_pu_bacteria | 2913295892 | 2913297990 | 260 |
| 836 | iso_pu_bacteria | 2915980308 | 2915980785 | 260 |
| 837 | iso_pu_bacteria | 2915986958 | 2915992627 | 260 |
| 838 | iso_pu_bacteria | 2915993759 | 2915999677 | 260 |
| 839 | iso_pu_bacteria | 2916000859 | 2916001999 | 260 |
| 840 | iso_pu_bacteria | 2916007675 | 2916011985 | 260 |
| 841 | iso_pu_bacteria | 2916014648 | 2916016049 | 260 |
| 842 | iso_pu_bacteria | 2916021584 | 2916022537 | 260 |
| 843 | iso_pu_bacteria | 2916028427 | 2916033363 | 260 |
| 844 | iso_pu_bacteria | 2916035215 | 2916038811 | 260 |
| 845 | iso_pu_bacteria | 2916041962 | 2916042794 | 260 |
| 846 | iso_pu_bacteria | 2916048683 | 2916050252 | 260 |
| 847 | iso_pu_bacteria | 2916055098 | 2916057718 | 260 |
| 848 | iso_pu_bacteria | 2916061851 | 2916063648 | 260 |
| 849 | iso_pu_bacteria | 2920760137 | 2920763391 | 260 |
| 850 | iso_pu_bacteria | 2921201388 | 2921207177 | 260 |
| 851 | iso_pu_bacteria | 2921244191 | 2921245201 | 260 |
| 852 | iso_pu_bacteria | 2921250672 | 2921257157 | 260 |
| 853 | iso_pu_bacteria | 2921257292 | 2921260347 | 260 |
| 854 | iso_pu_bacteria | 2921263974 | 2921266488 | 260 |
| 855 | iso_pu_bacteria | 2921282425 | 2921287562 | 260 |
| 856 | iso_pu_bacteria | 2921289301 | 2921291941 | 260 |
| 857 | iso_pu_bacteria | 2921296804 | 2921299139 | 260 |
| 858 | iso_pu_bacteria | 2924144063 | 2924146051 | 260 |
| 859 | iso_pu_bacteria | 2924150972 | 2924154446 | 260 |
| 860 | iso_pu_bacteria | 2924158325 | 2924163504 | 260 |
| 861 | iso_pu_bacteria | 2924165586 | 2924165983 | 260 |
| 862 | iso_pu_bacteria | 2924172951 | 2924174664 | 260 |
| 863 | iso_pu_bacteria | 2924179722 | 2924180863 | 260 |
| 864 | iso_pu_bacteria | 2924186466 | 2924191817 | 260 |
| 865 | iso_pu_bacteria | 2924193448 | 2924194292 | 260 |
| 866 | iso_pu_bacteria | 2924200457 | 2924202437 | 260 |
| 867 | iso_pu_bacteria | 2924207177 | 2924209669 | 260 |
| 868 | iso_pu_bacteria | 2924214083 | 2924218018 | 260 |
| 869 | iso_pu_bacteria | 2924221636 | 2924224272 | 260 |
| 870 | iso_pu_bacteria | 2924228884 | 2924232994 | 260 |
| 871 | iso_pu_bacteria | 2936996657 | 2936999120 | 260 |
| 872 | iso_pu_bacteria | 2937002841 | 2937005046 | 260 |
| 873 | iso_pu_bacteria | 2937009748 | 2937011327 | 260 |
| 874 | iso_pu_bacteria | 2937016420 | 2937018766 | 260 |
| 875 | iso_pu_bacteria | 2937023124 | 2937023820 | 260 |
| 876 | iso_pu_bacteria | 2937029754 | 2937034528 | 260 |
| 877 | iso_pu_bacteria | 2937036028 | 2937041311 | 260 |
| 878 | iso_pu_bacteria | 2937042894 | 2937049482 | 260 |
| 879 | iso_pu_bacteria | 2937049772 | 2937053987 | 260 |
| 880 | iso_pu_bacteria | 2937056579 | 2937060448 | 260 |
| 881 | iso_pu_bacteria | 2937063883 | 2937070044 | 260 |
| 882 | iso_pu_bacteria | 2937071275 | 2937071519 | 260 |
| 883 | iso_pu_bacteria | 2937078374 | 2937078739 | 260 |
| 884 | iso_pu_bacteria | 2937084907 | 2937086070 | 260 |
| 885 | iso_pu_bacteria | 2937098957 | 2937103439 | 260 |
| 886 | iso_pu_bacteria | 2937106411 | 2937110368 | 260 |
| 887 | iso_pu_bacteria | 2937113482 | 2937114676 | 260 |
| 888 | iso_pu_bacteria | 2937119839 | 2937122586 | 260 |
| 889 | iso_pu_bacteria | 2937126314 | 2937128464 | 260 |
| 890 | iso_pu_bacteria | 2939669807 | 2939672847 | 260 |
| 891 | iso_pu_bacteria | 2957375807 | 2957382056 | 260 |
| 892 | iso_pu_bacteria | 2957382221 | 2957383664 | 260 |
| 893 | iso_pu_bacteria | 2957388812 | 2957394077 | 260 |
| 894 | iso_pu_bacteria | 2957395598 | 2957399558 | 260 |
| 895 | iso_pu_bacteria | 2957402308 | 2957403712 | 260 |
| 896 | iso_pu_bacteria | 2957408893 | 2957411037 | 260 |
| 897 | iso_pu_bacteria | 2957415311 | 2957421564 | 260 |
| 898 | iso_pu_bacteria | 2957422303 | 2957426227 | 260 |
| 899 | iso_pu_bacteria | 2957430029 | 2957435414 | 260 |
| 900 | iso_pu_bacteria | 2957437181 | 2957439532 | 260 |
| 901 | iso_pu_bacteria | 2957443900 | 2957447117 | 260 |
| 902 | iso_pu_bacteria | 2957450854 | 2957457329 | 260 |
| 903 | iso_pu_bacteria | 2957457609 | 2957464401 | 260 |
| 904 | iso_pu_bacteria | 2957464669 | 2957466183 | 260 |
| 905 | iso_pu_bacteria | 2957471148 | 2957471753 | 260 |
| 906 | iso_pu_bacteria | 2957478035 | 2957480326 | 260 |
| 907 | iso_pu_bacteria | 2957484790 | 2957489018 | 260 |
| 908 | iso_pu_bacteria | 2957491536 | 2957494601 | 260 |
| 909 | iso_pu_bacteria | 2957498199 | 2957499058 | 260 |
| 910 | iso_pu_bacteria | 2957505466 | 2957508619 | 260 |
| 911 | iso_pu_bacteria | 2960584000 | 2960585708 | 260 |
| 912 | iso_pu_bacteria | 2960591022 | 2960594767 | 260 |
| 913 | iso_pu_bacteria | 2960597568 | 2960599738 | 260 |
| 914 | iso_pu_bacteria | 2960603979 | 2960605544 | 260 |
| 915 | iso_pu_bacteria | 2960610863 | 2960616934 | 260 |
| 916 | iso_pu_bacteria | 2960617483 | 2960621705 | 260 |
| 917 | iso_pu_bacteria | 2960624210 | 2960629192 | 260 |
| 918 | iso_pu_bacteria | 2960631154 | 2960637456 | 260 |
| 919 | iso_pu_bacteria | 2960637947 | 2960644790 | 260 |
| 920 | iso_pu_bacteria | 2960645483 | 2960647694 | 260 |
| 921 | iso_pu_bacteria | 2960652885 | 2960657207 | 260 |
| 922 | iso_pu_bacteria | 2960660292 | 2960660401 | 260 |
| 923 | iso_pu_bacteria | 2960667422 | 2960668425 | 260 |
| 924 | iso_pu_bacteria | 2960674078 | 2960675592 | 260 |
| 925 | iso_pu_bacteria | 2960680706 | 2960686612 | 260 |
| 926 | iso_pu_bacteria | 2960687367 | 2960690335 | 260 |
| 927 | iso_pu_bacteria | 2960693952 | 2960698823 | 260 |
| 928 | iso_pu_bacteria | 2964607997 | 2964609375 | 260 |
| 929 | iso_pu_bacteria | 2964615318 | 2964619809 | 260 |
| 930 | iso_pu_bacteria | 2964621998 | 2964622434 | 260 |
| 931 | iso_pu_bacteria | 2964628898 | 2964634318 | 260 |
| 932 | iso_pu_bacteria | 2964636051 | 2964636408 | 260 |
| 933 | iso_pu_bacteria | 2964643177 | 2964646967 | 260 |
| 934 | iso_pu_bacteria | 2964649959 | 2964650342 | 260 |
| 935 | iso_pu_bacteria | 2964656573 | 2964659475 | 260 |
| 936 | iso_pu_bacteria | 2964663802 | 2964665802 | 260 |
| 937 | iso_pu_bacteria | 2964670856 | 2964674982 | 260 |
| 938 | iso_pu_bacteria | 2964678106 | 2964680620 | 260 |
| 939 | iso_pu_bacteria | 2964685014 | 2964691101 | 260 |
| 940 | iso_pu_bacteria | 2964691889 | 2964693040 | 260 |
| 941 | iso_pu_bacteria | 2964698721 | 2964704133 | 260 |
| 942 | iso_pu_bacteria | 2964705432 | 2964707185 | 260 |
| 943 | iso_pu_bacteria | 2964712639 | 2964718573 | 260 |
| 944 | iso_pu_bacteria | 2964719344 | 2964719890 | 260 |
| 945 | iso_pu_bacteria | 2967664464 | 2967669776 | 260 |
| 946 | iso_pu_bacteria | 2967671571 | 2967678178 | 260 |
| 947 | iso_pu_bacteria | 2967678726 | 2967684968 | 260 |
| 948 | iso_pu_bacteria | 2967686174 | 2967691526 | 260 |
| 949 | iso_pu_bacteria | 2967693043 | 2967695080 | 260 |
| 950 | iso_pu_bacteria | 2967699805 | 2967700359 | 260 |
| 951 | iso_pu_bacteria | 2967706974 | 2967712776 | 260 |
| 952 | iso_pu_bacteria | 2967714385 | 2967714674 | 260 |
| 953 | iso_pu_bacteria | 2967728569 | 2967730559 | 260 |
| 954 | iso_pu_bacteria | 2967735183 | 2967736321 | 260 |
| 955 | iso_pu_bacteria | 2967742019 | 2967747814 | 260 |
| 956 | iso_pu_bacteria | 2967748971 | 2967751846 | 260 |
| 957 | iso_pu_bacteria | 2967755722 | 2967761298 | 260 |
| 958 | iso_pu_bacteria | 2967762386 | 2967762678 | 260 |
| 959 | iso_pu_bacteria | 2967769361 | 2967771303 | 260 |
| 960 | iso_pu_bacteria | 2967775926 | 2967776734 | 260 |
| 961 | iso_pu_bacteria | 2970019648 | 2970023311 | 260 |
| 962 | iso_pu_bacteria | 2970026789 | 2970030580 | 260 |
| 963 | iso_pu_bacteria | 2970033650 | 2970034021 | 260 |
| 964 | iso_pu_bacteria | 2970040964 | 2970045500 | 260 |
| 965 | iso_pu_bacteria | 2970047711 | 2970052617 | 260 |
| 966 | iso_pu_bacteria | 2970054988 | 2970057420 | 260 |
| 967 | iso_pu_bacteria | 2970061556 | 2970063963 | 260 |
| 968 | iso_pu_bacteria | 2970068827 | 2970071369 | 260 |
| 969 | iso_pu_bacteria | 2970076120 | 2970080401 | 260 |
| 970 | iso_pu_bacteria | 2970082768 | 2970087338 | 260 |
| 971 | iso_pu_bacteria | 2970088815 | 2970095376 | 260 |
| 972 | iso_pu_bacteria | 2970095765 | 2970101514 | 260 |
| 973 | iso_pu_bacteria | 2970102677 | 2970103366 | 260 |
| 974 | iso_pu_bacteria | 2970109326 | 2970116048 | 260 |
| 975 | iso_pu_bacteria | 2970116247 | 2970121902 | 260 |
| 976 | iso_pu_bacteria | 2970122695 | 2970126298 | 260 |
| 977 | iso_pu_bacteria | 2970129317 | 2970131578 | 260 |
| 978 | iso_pu_bacteria | 2970136068 | 2970143474 | 260 |
| 979 | iso_pu_bacteria | 2970143518 | 2970148541 | 260 |
| 980 | iso_pu_bacteria | 2970149975 | 2970153264 | 260 |
| 981 | iso_pu_bacteria | 2970156795 | 2970159522 | 260 |
| 982 | iso_pu_bacteria | 2970164137 | 2970167708 | 260 |
| 983 | iso_pu_bacteria | 2970170962 | 2970177018 | 260 |
| 984 | iso_pu_bacteria | 2970177841 | 2970181887 | 260 |
| 985 | iso_pu_bacteria | 2970184632 | 2970188446 | 260 |
| 986 | iso_pu_bacteria | 2970191845 | 2970196435 | 260 |
| 987 | iso_pu_bacteria | 2977516862 | 2977517728 | 260 |
| 988 | iso_pu_bacteria | 2977523885 | 2977529133 | 260 |
| 989 | iso_pu_bacteria | 2977530762 | 2977535862 | 260 |
| 990 | iso_pu_bacteria | 2977537788 | 2977539988 | 260 |
| 991 | iso_pu_bacteria | 2977544691 | 2977549464 | 260 |
| 992 | iso_pu_bacteria | 2977551784 | 2977552920 | 260 |
| 993 | iso_pu_bacteria | 2977558990 | 2977559279 | 260 |
| 994 | iso_pu_bacteria | 2977565890 | 2977567521 | 260 |
| 995 | iso_pu_bacteria | 2977572785 | 2977573169 | 260 |
| 996 | iso_pu_bacteria | 2977579622 | 2977580448 | 260 |
| 997 | iso_pu_bacteria | 643692032 | 643824539 | 260 |
| 998 | iso_pu_bacteria | 648276728 | 648739372 | 260 |
| 999 | iso_pu_bacteria | 8003992118 | 8003992449 | 260 |
| 1000 | iso_pu_bacteria | 8003999396 | 8003999777 | 260 |
| 1001 | iso_pu_bacteria | 8045864390 | 8045866279 | 260 |
| 1002 | iso_pu_bacteria | 8049293176 | 8049293475 | 260 |
| 1003 | 3300003215 | JGI25153J46596_10001067 | JGI25153J46596_100010673 | 261 |
| 1004 | 3300006195 | Ga0075366_10021892 | Ga0075366_100218923 | 261 |
| 1005 | 3300025297 | Ga0209758_1001507 | Ga0209758_10015072 | 261 |
| 1006 | 3300025936 | Ga0207670_10460986 | Ga0207670_104609862 | 261 |
| 1007 | 3300028794 | Ga0307515_10000023 | Ga0307515_10000023127 | 261 |
| 1008 | 3300031456 | Ga0307513_10006014 | Ga0307513_100060144 | 261 |
| 1009 | 3300035695 | Ga0373927_0000806 | Ga0373927_0000806_7498_8313 | 261 |
| 1010 | 3300037068 | Ga0373925_0013258 | Ga0373925_0013258_3474_4289 | 261 |
| 1011 | 3300046660 | Ga0495625_0064023 | Ga0495625_0064023_1729_2544 | 261 |
| 1012 | 3300049743 | Ga0501081_0262315 | Ga0501081_0262315_175_984 | 261 |
| 1013 | 3300050493 | nmdc:mga0k408_37840_c1 | nmdc:mga0k408_37840_c1_1385_2197 | 261 |
| 1014 | 3300050493 | nmdc:mga0k408_68174_c1 | nmdc:mga0k408_68174_c1_1172_1984 | 261 |
| 1015 | 3300050513 | nmdc:mga0rr50_41028_c1 | nmdc:mga0rr50_41028_c1_1254_2072 | 261 |
| 1016 | 3300050514 | nmdc:mga08x19_22_c1 | nmdc:mga08x19_22_c1_50137_50955 | 261 |
| 1017 | 3300053139 | Ga0500568_0000205 | Ga0500568_0000205_20520_21338 | 261 |
| 1018 | 3300053139 | Ga0500568_0066844 | Ga0500568_0066844_49_858 | 261 |
| 1019 | iso_pu_bacteria | 2503198000 | 2503200587 | 261 |
| 1020 | iso_pu_bacteria | 2508501123 | 2509116880 | 261 |
| 1021 | iso_pu_bacteria | 2508501127 | 2509141882 | 261 |
| 1022 | iso_pu_bacteria | 2509276018 | 2509373983 | 261 |
| 1023 | iso_pu_bacteria | 2509276022 | 2509395375 | 261 |
| 1024 | iso_pu_bacteria | 2510065059 | 2510316340 | 261 |
| 1025 | iso_pu_bacteria | 2511231027 | 2511389351 | 261 |
| 1026 | iso_pu_bacteria | 2512875016 | 2512928794 | 261 |
| 1027 | iso_pu_bacteria | 2512875024 | 2512963538 | 261 |
| 1028 | iso_pu_bacteria | 2513237090 | 2513612360 | 261 |
| 1029 | iso_pu_bacteria | 2513237164 | 2514038189 | 261 |
| 1030 | iso_pu_bacteria | 2513237305 | 2514422798 | 261 |
| 1031 | iso_pu_bacteria | 2513237351 | 2514590767 | 261 |
| 1032 | iso_pu_bacteria | 2534681786 | 2535485290 | 261 |
| 1033 | iso_pu_bacteria | 2588253730 | 2588514338 | 261 |
| 1034 | iso_pu_bacteria | 2597489875 | 2597811165 | 261 |
| 1035 | iso_pu_bacteria | 2599185301 | 2599940577 | 261 |
| 1036 | iso_pu_bacteria | 2643221550 | 2643770262 | 261 |
| 1037 | iso_pu_bacteria | 2643221551 | 2643778057 | 261 |
| 1038 | iso_pu_bacteria | 2643221555 | 2643796505 | 261 |
| 1039 | iso_pu_bacteria | 2643221564 | 2643840341 | 261 |
| 1040 | iso_pu_bacteria | 2643221595 | 2643989854 | 261 |
| 1041 | iso_pu_bacteria | 2643221623 | 2644132498 | 261 |
| 1042 | iso_pu_bacteria | 2643221627 | 2644153506 | 261 |
| 1043 | iso_pu_bacteria | 2687453392 | 2688597754 | 261 |
| 1044 | iso_pu_bacteria | 2693429783 | 2694629152 | 261 |
| 1045 | iso_pu_bacteria | 2693429784 | 2694636934 | 261 |
| 1046 | iso_pu_bacteria | 2721755686 | 2723578247 | 261 |
| 1047 | iso_pu_bacteria | 2738543024 | 2739309602 | 261 |
| 1048 | iso_pu_bacteria | 2751185800 | 2753358023 | 261 |
| 1049 | iso_pu_bacteria | 2756170246 | 2756676349 | 261 |
| 1050 | iso_pu_bacteria | 2758568016 | 2758638830 | 261 |
| 1051 | iso_pu_bacteria | 2765235802 | 2765464329 | 261 |
| 1052 | iso_pu_bacteria | 2767802442 | 2770194656 | 261 |
| 1053 | iso_pu_bacteria | 2775506902 | 2776272542 | 261 |
| 1054 | iso_pu_bacteria | 2775506904 | 2776284483 | 261 |
| 1055 | iso_pu_bacteria | 2791355123 | 2792750120 | 261 |
| 1056 | iso_pu_bacteria | 2837651117 | 2837651952 | 261 |
| 1057 | iso_pu_bacteria | 2839993093 | 2839994244 | 261 |
| 1058 | iso_pu_bacteria | 2840764183 | 2840769355 | 261 |
| 1059 | iso_pu_bacteria | 2841734538 | 2841735624 | 261 |
| 1060 | iso_pu_bacteria | 2842871566 | 2842873042 | 261 |
| 1061 | iso_pu_bacteria | 2844002411 | 2844004354 | 261 |
| 1062 | iso_pu_bacteria | 2844009547 | 2844009853 | 261 |
| 1063 | iso_pu_bacteria | 2847670302 | 2847672619 | 261 |
| 1064 | iso_pu_bacteria | 2847686936 | 2847691814 | 261 |
| 1065 | iso_pu_bacteria | 2854911287 | 2854916251 | 261 |
| 1066 | iso_pu_bacteria | 2856314179 | 2856315158 | 261 |
| 1067 | iso_pu_bacteria | 2856320880 | 2856328166 | 261 |
| 1068 | iso_pu_bacteria | 2856328259 | 2856329858 | 261 |
| 1069 | iso_pu_bacteria | 2856334872 | 2856338767 | 261 |
| 1070 | iso_pu_bacteria | 2856342000 | 2856346631 | 261 |
| 1071 | iso_pu_bacteria | 2856364286 | 2856367610 | 261 |
| 1072 | iso_pu_bacteria | 2857349434 | 2857353652 | 261 |
| 1073 | iso_pu_bacteria | 2857367948 | 2857371920 | 261 |
| 1074 | iso_pu_bacteria | 2869162929 | 2869166964 | 261 |
| 1075 | iso_pu_bacteria | 2869169390 | 2869172489 | 261 |
| 1076 | iso_pu_bacteria | 2869234852 | 2869235717 | 261 |
| 1077 | iso_pu_bacteria | 2869242130 | 2869244336 | 261 |
| 1078 | iso_pu_bacteria | 2869249662 | 2869256717 | 261 |
| 1079 | iso_pu_bacteria | 2869256925 | 2869258705 | 261 |
| 1080 | iso_pu_bacteria | 2869264136 | 2869266048 | 261 |
| 1081 | iso_pu_bacteria | 2869271264 | 2869276259 | 261 |
| 1082 | iso_pu_bacteria | 2869278585 | 2869284299 | 261 |
| 1083 | iso_pu_bacteria | 2869285874 | 2869286818 | 261 |
| 1084 | iso_pu_bacteria | 2871429161 | 2871434082 | 261 |
| 1085 | iso_pu_bacteria | 2871444079 | 2871451033 | 261 |
| 1086 | iso_pu_bacteria | 2871451962 | 2871454746 | 261 |
| 1087 | iso_pu_bacteria | 2871459585 | 2871462916 | 261 |
| 1088 | iso_pu_bacteria | 2871466892 | 2871474267 | 261 |
| 1089 | iso_pu_bacteria | 2871474448 | 2871475683 | 261 |
| 1090 | iso_pu_bacteria | 2871481445 | 2871483939 | 261 |
| 1091 | iso_pu_bacteria | 2871488783 | 2871490078 | 261 |
| 1092 | iso_pu_bacteria | 2871495908 | 2871501989 | 261 |
| 1093 | iso_pu_bacteria | 2874102143 | 2874107154 | 261 |
| 1094 | iso_pu_bacteria | 2874109183 | 2874111819 | 261 |
| 1095 | iso_pu_bacteria | 2874116593 | 2874118188 | 261 |
| 1096 | iso_pu_bacteria | 2874123672 | 2874126822 | 261 |
| 1097 | iso_pu_bacteria | 2874131515 | 2874132334 | 261 |
| 1098 | iso_pu_bacteria | 2874139085 | 2874139238 | 261 |
| 1099 | iso_pu_bacteria | 2874146452 | 2874147740 | 261 |
| 1100 | iso_pu_bacteria | 2874155637 | 2874156658 | 261 |
| 1101 | iso_pu_bacteria | 2874162495 | 2874163841 | 261 |
| 1102 | iso_pu_bacteria | 2874168670 | 2874170895 | 261 |
| 1103 | iso_pu_bacteria | 2876363079 | 2876369163 | 261 |
| 1104 | iso_pu_bacteria | 2876377896 | 2876378442 | 261 |
| 1105 | iso_pu_bacteria | 2876386047 | 2876386215 | 261 |
| 1106 | iso_pu_bacteria | 2876392853 | 2876393784 | 261 |
| 1107 | iso_pu_bacteria | 2876399893 | 2876401499 | 261 |
| 1108 | iso_pu_bacteria | 2876413966 | 2876414768 | 261 |
| 1109 | iso_pu_bacteria | 2876420981 | 2876421596 | 261 |
| 1110 | iso_pu_bacteria | 2878035449 | 2878041987 | 261 |
| 1111 | iso_pu_bacteria | 2878730984 | 2878736119 | 261 |
| 1112 | iso_pu_bacteria | 2878738818 | 2878740085 | 261 |
| 1113 | iso_pu_bacteria | 2878745973 | 2878746792 | 261 |
| 1114 | iso_pu_bacteria | 2878753008 | 2878753237 | 261 |
| 1115 | iso_pu_bacteria | 2878760144 | 2878765774 | 261 |
| 1116 | iso_pu_bacteria | 2878767105 | 2878772448 | 261 |
| 1117 | iso_pu_bacteria | 2878774303 | 2878775284 | 261 |
| 1118 | iso_pu_bacteria | 2878781027 | 2878781186 | 261 |
| 1119 | iso_pu_bacteria | 2881155292 | 2881158433 | 261 |
| 1120 | iso_pu_bacteria | 2881161766 | 2881164085 | 261 |
| 1121 | iso_pu_bacteria | 2881845957 | 2881847276 | 261 |
| 1122 | iso_pu_bacteria | 2881861095 | 2881867778 | 261 |
| 1123 | iso_pu_bacteria | 2882632389 | 2882634307 | 261 |
| 1124 | iso_pu_bacteria | 2882912400 | 2882912866 | 261 |
| 1125 | iso_pu_bacteria | 2885305155 | 2885308820 | 261 |
| 1126 | iso_pu_bacteria | 2885318864 | 2885319094 | 261 |
| 1127 | iso_pu_bacteria | 2885326080 | 2885332328 | 261 |
| 1128 | iso_pu_bacteria | 2885334103 | 2885335947 | 261 |
| 1129 | iso_pu_bacteria | 2885342637 | 2885349542 | 261 |
| 1130 | iso_pu_bacteria | 2885350715 | 2885354795 | 261 |
| 1131 | iso_pu_bacteria | 2888337043 | 2888342457 | 261 |
| 1132 | iso_pu_bacteria | 2888343758 | 2888346304 | 261 |
| 1133 | iso_pu_bacteria | 2888350351 | 2888351802 | 261 |
| 1134 | iso_pu_bacteria | 2889010040 | 2889013776 | 261 |
| 1135 | iso_pu_bacteria | 2889016732 | 2889021522 | 261 |
| 1136 | iso_pu_bacteria | 2894652903 | 2894655391 | 261 |
| 1137 | iso_pu_bacteria | 2894817345 | 2894819416 | 261 |
| 1138 | iso_pu_bacteria | 2903448605 | 2903449371 | 261 |
| 1139 | iso_pu_bacteria | 2903492973 | 2903497998 | 261 |
| 1140 | iso_pu_bacteria | 2903492973 | 2903500680 | 261 |
| 1141 | iso_pu_bacteria | 2903513507 | 2903515962 | 261 |
| 1142 | iso_pu_bacteria | 2903521522 | 2903526369 | 261 |
| 1143 | iso_pu_bacteria | 2903528002 | 2903529656 | 261 |
| 1144 | iso_pu_bacteria | 2903540706 | 2903546720 | 261 |
| 1145 | iso_pu_bacteria | 2904578770 | 2904579082 | 261 |
| 1146 | iso_pu_bacteria | 2904659560 | 2904660509 | 261 |
| 1147 | iso_pu_bacteria | 2906308376 | 2906309172 | 261 |
| 1148 | iso_pu_bacteria | 2906321335 | 2906326779 | 261 |
| 1149 | iso_pu_bacteria | 2906328253 | 2906328732 | 261 |
| 1150 | iso_pu_bacteria | 2906354277 | 2906357193 | 261 |
| 1151 | iso_pu_bacteria | 2906363423 | 2906365194 | 261 |
| 1152 | iso_pu_bacteria | 2906370794 | 2906372139 | 261 |
| 1153 | iso_pu_bacteria | 2906401398 | 2906406115 | 261 |
| 1154 | iso_pu_bacteria | 2906408224 | 2906412301 | 261 |
| 1155 | iso_pu_bacteria | 2906414383 | 2906415155 | 261 |
| 1156 | iso_pu_bacteria | 2915650412 | 2915652847 | 261 |
| 1157 | iso_pu_bacteria | 2917554339 | 2917555967 | 261 |
| 1158 | iso_pu_bacteria | 2919119836 | 2919122090 | 261 |
| 1159 | iso_pu_bacteria | 2922130491 | 2922136560 | 261 |
| 1160 | iso_pu_bacteria | 2922151315 | 2922157492 | 261 |
| 1161 | iso_pu_bacteria | 2922158528 | 2922160061 | 261 |
| 1162 | iso_pu_bacteria | 2922172374 | 2922174598 | 261 |
| 1163 | iso_pu_bacteria | 2922178524 | 2922183264 | 261 |
| 1164 | iso_pu_bacteria | 2922185730 | 2922189179 | 261 |
| 1165 | iso_pu_bacteria | 2924726620 | 2924728221 | 261 |
| 1166 | iso_pu_bacteria | 2924733363 | 2924738438 | 261 |
| 1167 | iso_pu_bacteria | 2924741084 | 2924747272 | 261 |
| 1168 | iso_pu_bacteria | 2924748358 | 2924754203 | 261 |
| 1169 | iso_pu_bacteria | 2924754689 | 2924757633 | 261 |
| 1170 | iso_pu_bacteria | 2924762789 | 2924765499 | 261 |
| 1171 | iso_pu_bacteria | 2924776078 | 2924777684 | 261 |
| 1172 | iso_pu_bacteria | 2924784321 | 2924791166 | 261 |
| 1173 | iso_pu_bacteria | 2928521798 | 2928521972 | 261 |
| 1174 | iso_pu_bacteria | 2937813078 | 2937813969 | 261 |
| 1175 | iso_pu_bacteria | 2937822353 | 2937828722 | 261 |
| 1176 | iso_pu_bacteria | 2937836603 | 2937837047 | 261 |
| 1177 | iso_pu_bacteria | 2937843397 | 2937845197 | 261 |
| 1178 | iso_pu_bacteria | 2937848649 | 2937850882 | 261 |
| 1179 | iso_pu_bacteria | 2937861824 | 2937863172 | 261 |
| 1180 | iso_pu_bacteria | 2937868953 | 2937874196 | 261 |
| 1181 | iso_pu_bacteria | 2937877337 | 2937883902 | 261 |
| 1182 | iso_pu_bacteria | 2937891427 | 2937892388 | 261 |
| 1183 | iso_pu_bacteria | 2937972304 | 2937976653 | 261 |
| 1184 | iso_pu_bacteria | 2937980651 | 2937981879 | 261 |
| 1185 | iso_pu_bacteria | 2937994558 | 2938000579 | 261 |
| 1186 | iso_pu_bacteria | 2938014810 | 2938015395 | 261 |
| 1187 | iso_pu_bacteria | 2954011201 | 2954014671 | 261 |
| 1188 | iso_pu_bacteria | 2958034702 | 2958038397 | 261 |
| 1189 | iso_pu_bacteria | 2958041894 | 2958056007 | 261 |
| 1190 | iso_pu_bacteria | 2958041894 | 2958056370 | 261 |
| 1191 | iso_pu_bacteria | 2958064165 | 2958066458 | 261 |
| 1192 | iso_pu_bacteria | 2958071322 | 2958075381 | 261 |
| 1193 | iso_pu_bacteria | 2958084443 | 2958091180 | 261 |
| 1194 | iso_pu_bacteria | 2958092219 | 2958098955 | 261 |
| 1195 | iso_pu_bacteria | 2958100919 | 2958102913 | 261 |
| 1196 | iso_pu_bacteria | 2958108152 | 2958114968 | 261 |
| 1197 | iso_pu_bacteria | 2958115193 | 2958121449 | 261 |
| 1198 | iso_pu_bacteria | 2958122699 | 2958125021 | 261 |
| 1199 | iso_pu_bacteria | 2958130278 | 2958131222 | 261 |
| 1200 | iso_pu_bacteria | 2958144490 | 2958151158 | 261 |
| 1201 | iso_pu_bacteria | 2958158011 | 2958163523 | 261 |
| 1202 | iso_pu_bacteria | 2958165035 | 2958170950 | 261 |
| 1203 | iso_pu_bacteria | 2958172287 | 2958174207 | 261 |
| 1204 | iso_pu_bacteria | 2958179912 | 2958180621 | 261 |
| 1205 | iso_pu_bacteria | 2961077736 | 2961078455 | 261 |
| 1206 | iso_pu_bacteria | 2961114664 | 2961120831 | 261 |
| 1207 | iso_pu_bacteria | 2961136820 | 2961137081 | 261 |
| 1208 | iso_pu_bacteria | 2961163497 | 2961169394 | 261 |
| 1209 | iso_pu_bacteria | 2961170736 | 2961177061 | 261 |
| 1210 | iso_pu_bacteria | 2961183825 | 2961184271 | 261 |
| 1211 | iso_pu_bacteria | 2963644680 | 2963650439 | 261 |
| 1212 | iso_pu_bacteria | 2965018300 | 2965023646 | 261 |
| 1213 | iso_pu_bacteria | 2965025482 | 2965031047 | 261 |
| 1214 | iso_pu_bacteria | 2965032056 | 2965035567 | 261 |
| 1215 | iso_pu_bacteria | 2965040258 | 2965040347 | 261 |
| 1216 | iso_pu_bacteria | 2965062239 | 2965067219 | 261 |
| 1217 | iso_pu_bacteria | 2965110997 | 2965115132 | 261 |
| 1218 | iso_pu_bacteria | 2965119406 | 2965121531 | 261 |
| 1219 | iso_pu_bacteria | 2967996073 | 2968002813 | 261 |
| 1220 | iso_pu_bacteria | 2968003550 | 2968005210 | 261 |
| 1221 | iso_pu_bacteria | 2968016561 | 2968021298 | 261 |
| 1222 | iso_pu_bacteria | 2968083720 | 2968085612 | 261 |
| 1223 | iso_pu_bacteria | 2968091066 | 2968095268 | 261 |
| 1224 | iso_pu_bacteria | 2968097103 | 2968101239 | 261 |
| 1225 | iso_pu_bacteria | 2968110612 | 2968111568 | 261 |
| 1226 | iso_pu_bacteria | 2968117919 | 2968120210 | 261 |
| 1227 | iso_pu_bacteria | 2968128360 | 2968128613 | 261 |
| 1228 | iso_pu_bacteria | 2968171901 | 2968177784 | 261 |
| 1229 | iso_pu_bacteria | 2970469710 | 2970476403 | 261 |
| 1230 | iso_pu_bacteria | 2970489779 | 2970491393 | 261 |
| 1231 | iso_pu_bacteria | 2970503327 | 2970509734 | 261 |
| 1232 | iso_pu_bacteria | 2970510686 | 2970516056 | 261 |
| 1233 | iso_pu_bacteria | 2970524798 | 2970527812 | 261 |
| 1234 | iso_pu_bacteria | 2970532167 | 2970532485 | 261 |
| 1235 | iso_pu_bacteria | 2970540015 | 2970541928 | 261 |
| 1236 | iso_pu_bacteria | 2970547951 | 2970554658 | 261 |
| 1237 | iso_pu_bacteria | 2970554993 | 2970560630 | 261 |
| 1238 | iso_pu_bacteria | 2970593180 | 2970598915 | 261 |
| 1239 | iso_pu_bacteria | 2970619444 | 2970620938 | 261 |
| 1240 | iso_pu_bacteria | 2970627176 | 2970628607 | 261 |
| 1241 | iso_pu_bacteria | 2977821940 | 2977822170 | 261 |
| 1242 | iso_pu_bacteria | 2977828996 | 2977835541 | 261 |
| 1243 | iso_pu_bacteria | 2977843712 | 2977846967 | 261 |
| 1244 | iso_pu_bacteria | 2977851361 | 2977854915 | 261 |
| 1245 | iso_pu_bacteria | 2977858184 | 2977859098 | 261 |
| 1246 | iso_pu_bacteria | 2977864932 | 2977865319 | 261 |
| 1247 | iso_pu_bacteria | 2977872689 | 2977879351 | 261 |
| 1248 | iso_pu_bacteria | 2977907340 | 2977913816 | 261 |
| 1249 | iso_pu_bacteria | 2977922695 | 2977923858 | 261 |
| 1250 | iso_pu_bacteria | 2977935797 | 2977937066 | 261 |
| 1251 | iso_pu_bacteria | 2977942078 | 2977945747 | 261 |
| 1252 | iso_pu_bacteria | 2977971508 | 2977979669 | 261 |
| 1253 | iso_pu_bacteria | 2977986579 | 2977989984 | 261 |
| 1254 | iso_pu_bacteria | 2979710463 | 2979710603 | 261 |
| 1255 | iso_pu_bacteria | 2979764755 | 2979764888 | 261 |
| 1256 | iso_pu_bacteria | 2979772303 | 2979774499 | 261 |
| 1257 | iso_pu_bacteria | 2979779861 | 2979780033 | 261 |
| 1258 | iso_pu_bacteria | 2979793036 | 2979797620 | 261 |
| 1259 | iso_pu_bacteria | 2979808191 | 2979814521 | 261 |
| 1260 | iso_pu_bacteria | 2987636660 | 2987642935 | 261 |
| 1261 | iso_pu_bacteria | 2987645492 | 2987645850 | 261 |
| 1262 | iso_pu_bacteria | 2987652177 | 2987654527 | 261 |
| 1263 | iso_pu_bacteria | 2987659509 | 2987665628 | 261 |
| 1264 | iso_pu_bacteria | 2987666974 | 2987671735 | 261 |
| 1265 | iso_pu_bacteria | 2987673487 | 2987680931 | 261 |
| 1266 | iso_pu_bacteria | 2996310559 | 2996312907 | 261 |
| 1267 | iso_pu_bacteria | 2996336353 | 2996337642 | 261 |
| 1268 | iso_pu_bacteria | 2996341866 | 2996346062 | 261 |
| 1269 | iso_pu_bacteria | 2996348954 | 2996356395 | 261 |
| 1270 | iso_pu_bacteria | 2996386984 | 2996393962 | 261 |
| 1271 | iso_pu_bacteria | 3000135777 | 3000142382 | 261 |
| 1272 | iso_pu_bacteria | 3002141150 | 3002142635 | 261 |
| 1273 | iso_pu_bacteria | 3004167301 | 3004172300 | 261 |
| 1274 | iso_pu_bacteria | 3004188549 | 3004194582 | 261 |
| 1275 | iso_pu_bacteria | 3004195979 | 3004197774 | 261 |
| 1276 | iso_pu_bacteria | 3004203850 | 3004210728 | 261 |
| 1277 | iso_pu_bacteria | 3004211236 | 3004213296 | 261 |
| 1278 | iso_pu_bacteria | 3004218560 | 3004221368 | 261 |
| 1279 | iso_pu_bacteria | 3004232784 | 3004236236 | 261 |
| 1280 | iso_pu_bacteria | 3004268573 | 3004271607 | 261 |
| 1281 | iso_pu_bacteria | 3004275668 | 3004282699 | 261 |
| 1282 | iso_pu_bacteria | 3004289098 | 3004294588 | 261 |
| 1283 | iso_pu_bacteria | 3004334049 | 3004338364 | 261 |
| 1284 | iso_pu_bacteria | 637000159 | 637078492 | 261 |
| 1285 | iso_pu_bacteria | 649633066 | 649872297 | 261 |
| 1286 | iso_pu_bacteria | 8002285264 | 8002288290 | 261 |
| 1287 | iso_pu_bacteria | 8004300914 | 8004307328 | 261 |
| 1288 | iso_pu_bacteria | 8004312739 | 8004320707 | 261 |
| 1289 | iso_pu_bacteria | 8004374579 | 8004374808 | 261 |
| 1290 | iso_pu_bacteria | 8004387939 | 8004388102 | 261 |
| 1291 | iso_pu_bacteria | 8004395343 | 8004403783 | 261 |
| 1292 | iso_pu_bacteria | 8004445564 | 8004447206 | 261 |
| 1293 | iso_pu_bacteria | 8004633249 | 8004639099 | 261 |
| 1294 | iso_pu_bacteria | 8004640170 | 8004644526 | 261 |
| 1295 | iso_pu_bacteria | 8004695233 | 8004697201 | 261 |
| 1296 | iso_pu_bacteria | 8004703790 | 8004713182 | 261 |
| 1297 | iso_pu_bacteria | 8004714634 | 8004715429 | 261 |
| 1298 | iso_pu_bacteria | 8055617313 | 8055619096 | 261 |
| 1299 | 3300002773 | JGI25152J39213_1001989 | JGI25152J39213_10019892 | 262 |
| 1300 | 3300002773 | JGI25152J39213_1003655 | JGI25152J39213_10036552 | 262 |
| 1301 | 3300002773 | JGI25152J39213_1003941 | JGI25152J39213_10039415 | 262 |
| 1302 | 3300002773 | JGI25152J39213_1006110 | JGI25152J39213_10061102 | 262 |
| 1303 | 3300002773 | JGI25152J39213_1006231 | JGI25152J39213_10062312 | 262 |
| 1304 | 3300002774 | JGI25150J39212_1000012 | JGI25150J39212_100001288 | 262 |
| 1305 | 3300002774 | JGI25150J39212_1000635 | JGI25150J39212_10006352 | 262 |
| 1306 | 3300002774 | JGI25150J39212_1004118 | JGI25150J39212_10041182 | 262 |
| 1307 | 3300002774 | JGI25150J39212_1013033 | JGI25150J39212_10130331 | 262 |
| 1308 | 3300002987 | JGI25159J45721_1000903 | JGI25159J45721_10009032 | 262 |
| 1309 | 3300003187 | JGI25151J46595_10000025 | JGI25151J46595_10000025128 | 262 |
| 1310 | 3300003187 | JGI25151J46595_10005451 | JGI25151J46595_100054512 | 262 |
| 1311 | 3300003215 | JGI25153J46596_10001672 | JGI25153J46596_100016722 | 262 |
| 1312 | 3300003215 | JGI25153J46596_10014039 | JGI25153J46596_100140392 | 262 |
| 1313 | 3300003215 | JGI25153J46596_10014326 | JGI25153J46596_100143262 | 262 |
| 1314 | 3300003374 | JGI25161J50226_1000074 | JGI25161J50226_100007425 | 262 |
| 1315 | 3300003771 | Ga0055526_1003529 | Ga0055526_10035292 | 262 |
| 1316 | 3300003771 | Ga0055526_1015038 | Ga0055526_10150383 | 262 |
| 1317 | 3300003775 | Ga0055524_1005796 | Ga0055524_10057962 | 262 |
| 1318 | 3300003775 | Ga0055524_1029125 | Ga0055524_10291252 | 262 |
| 1319 | 3300003775 | Ga0055524_1038230 | Ga0055524_10382302 | 262 |
| 1320 | 3300003790 | Ga0055528_1000642 | Ga0055528_100064214 | 262 |
| 1321 | 3300003790 | Ga0055528_1001522 | Ga0055528_10015229 | 262 |
| 1322 | 3300003790 | Ga0055528_1031997 | Ga0055528_10319971 | 262 |
| 1323 | 3300003792 | Ga0055540_1000471 | Ga0055540_100047122 | 262 |
| 1324 | 3300003792 | Ga0055540_1002010 | Ga0055540_10020105 | 262 |
| 1325 | 3300003792 | Ga0055540_1016068 | Ga0055540_10160682 | 262 |
| 1326 | 3300004625 | Ga0055543_1000141 | Ga0055543_10001414 | 262 |
| 1327 | 3300005331 | Ga0070670_100305429 | Ga0070670_1003054292 | 262 |
| 1328 | 3300005355 | Ga0070671_100005795 | Ga0070671_1000057952 | 262 |
| 1329 | 3300005367 | Ga0070667_100393777 | Ga0070667_1003937772 | 262 |
| 1330 | 3300006038 | Ga0075365_10003968 | Ga0075365_100039684 | 262 |
| 1331 | 3300006178 | Ga0075367_10000124 | Ga0075367_1000012416 | 262 |
| 1332 | 3300006186 | Ga0075369_10001413 | Ga0075369_100014134 | 262 |
| 1333 | 3300009011 | Ga0105251_10010361 | Ga0105251_100103613 | 262 |
| 1334 | 3300009177 | Ga0105248_10014988 | Ga0105248_100149883 | 262 |
| 1335 | 3300009763 | Ga0123340_1051759 | Ga0123340_10517592 | 262 |
| 1336 | 3300009766 | Ga0123342_1014771 | Ga0123342_10147714 | 262 |
| 1337 | 3300009766 | Ga0123342_1029482 | Ga0123342_10294822 | 262 |
| 1338 | 3300025208 | Ga0209436_100429 | Ga0209436_1004299 | 262 |
| 1339 | 3300025245 | Ga0207425_1000012 | Ga0207425_1000012290 | 262 |
| 1340 | 3300025245 | Ga0207425_1001525 | Ga0207425_10015254 | 262 |
| 1341 | 3300025245 | Ga0207425_1006553 | Ga0207425_10065532 | 262 |
| 1342 | 3300025258 | Ga0209129_1000081 | Ga0209129_100008171 | 262 |
| 1343 | 3300025258 | Ga0209129_1000726 | Ga0209129_10007264 | 262 |
| 1344 | 3300025258 | Ga0209129_1001366 | Ga0209129_100136612 | 262 |
| 1345 | 3300025258 | Ga0209129_1002322 | Ga0209129_10023222 | 262 |
| 1346 | 3300025258 | Ga0209129_1010413 | Ga0209129_10104132 | 262 |
| 1347 | 3300025273 | Ga0209673_1000967 | Ga0209673_10009678 | 262 |
| 1348 | 3300025273 | Ga0209673_1001074 | Ga0209673_100107419 | 262 |
| 1349 | 3300025273 | Ga0209673_1003197 | Ga0209673_10031974 | 262 |
| 1350 | 3300025273 | Ga0209673_1005594 | Ga0209673_10055943 | 262 |
| 1351 | 3300025284 | Ga0209130_1000002 | Ga0209130_100000257 | 262 |
| 1352 | 3300025292 | Ga0209676_1012908 | Ga0209676_10129082 | 262 |
| 1353 | 3300025294 | Ga0209025_1000024 | Ga0209025_1000024290 | 262 |
| 1354 | 3300025294 | Ga0209025_1000528 | Ga0209025_100052828 | 262 |
| 1355 | 3300025294 | Ga0209025_1003580 | Ga0209025_10035803 | 262 |
| 1356 | 3300025294 | Ga0209025_1007670 | Ga0209025_10076705 | 262 |
| 1357 | 3300025294 | Ga0209025_1014304 | Ga0209025_10143043 | 262 |
| 1358 | 3300025294 | Ga0209025_1022843 | Ga0209025_10228432 | 262 |
| 1359 | 3300025294 | Ga0209025_1052054 | Ga0209025_10520542 | 262 |
| 1360 | 3300025295 | Ga0209564_1000382 | Ga0209564_100038271 | 262 |
| 1361 | 3300025295 | Ga0209564_1000830 | Ga0209564_100083025 | 262 |
| 1362 | 3300025295 | Ga0209564_1016131 | Ga0209564_10161312 | 262 |
| 1363 | 3300025295 | Ga0209564_1051984 | Ga0209564_10519842 | 262 |
| 1364 | 3300025297 | Ga0209758_1000046 | Ga0209758_1000046252 | 262 |
| 1365 | 3300025297 | Ga0209758_1001048 | Ga0209758_100104820 | 262 |
| 1366 | 3300025297 | Ga0209758_1002458 | Ga0209758_100245812 | 262 |
| 1367 | 3300025297 | Ga0209758_1002490 | Ga0209758_10024906 | 262 |
| 1368 | 3300025297 | Ga0209758_1033320 | Ga0209758_10333202 | 262 |
| 1369 | 3300025299 | Ga0209256_1000874 | Ga0209256_100087425 | 262 |
| 1370 | 3300025299 | Ga0209256_1005579 | Ga0209256_10055792 | 262 |
| 1371 | 3300025299 | Ga0209256_1014814 | Ga0209256_10148142 | 262 |
| 1372 | 3300025299 | Ga0209256_1018807 | Ga0209256_10188072 | 262 |
| 1373 | 3300025302 | Ga0207426_1000013 | Ga0207426_100001357 | 262 |
| 1374 | 3300025302 | Ga0207426_1000172 | Ga0207426_1000172111 | 262 |
| 1375 | 3300025302 | Ga0207426_1001124 | Ga0207426_100112418 | 262 |
| 1376 | 3300025303 | Ga0209051_1000084 | Ga0209051_1000084136 | 262 |
| 1377 | 3300025303 | Ga0209051_1002801 | Ga0209051_10028014 | 262 |
| 1378 | 3300025303 | Ga0209051_1023790 | Ga0209051_10237901 | 262 |
| 1379 | 3300025304 | Ga0209257_1002194 | Ga0209257_10021945 | 262 |
| 1380 | 3300025304 | Ga0209257_1021726 | Ga0209257_10217262 | 262 |
| 1381 | 3300025904 | Ga0207647_10149812 | Ga0207647_101498122 | 262 |
| 1382 | 3300025941 | Ga0207711_10116001 | Ga0207711_101160012 | 262 |
| 1383 | 3300028794 | Ga0307515_10004227 | Ga0307515_1000422726 | 262 |
| 1384 | 3300031235 | Ga0265330_10083083 | Ga0265330_100830832 | 262 |
| 1385 | 3300031247 | Ga0265340_10012328 | Ga0265340_100123285 | 262 |
| 1386 | 3300031247 | Ga0265340_10045406 | Ga0265340_100454062 | 262 |
| 1387 | 3300031344 | Ga0265316_10057891 | Ga0265316_100578912 | 262 |
| 1388 | 3300031456 | Ga0307513_10192335 | Ga0307513_101923352 | 262 |
| 1389 | 3300031595 | Ga0265313_10003820 | Ga0265313_100038206 | 262 |
| 1390 | 3300031595 | Ga0265313_10029972 | Ga0265313_100299723 | 262 |
| 1391 | 3300031711 | Ga0265314_10036703 | Ga0265314_100367033 | 262 |
| 1392 | 3300031712 | Ga0265342_10018121 | Ga0265342_100181212 | 262 |
| 1393 | 3300031712 | Ga0265342_10207728 | Ga0265342_102077282 | 262 |
| 1394 | 3300031731 | Ga0307405_10015383 | Ga0307405_100153832 | 262 |
| 1395 | 3300031901 | Ga0307406_10046275 | Ga0307406_100462753 | 262 |
| 1396 | 3300031911 | Ga0307412_10027331 | Ga0307412_100273312 | 262 |
| 1397 | 3300041413 | Ga0439465_0001471 | Ga0439465_0001471_6765_7583 | 262 |
| 1398 | 3300041413 | Ga0439465_0004192 | Ga0439465_0004192_3130_3948 | 262 |
| 1399 | 3300041413 | Ga0439465_0053697 | Ga0439465_0053697_372_1190 | 262 |
| 1400 | 3300041494 | Ga0451837_1340741 | Ga0451837_1340741_439_1257 | 262 |
| 1401 | 3300042006 | Ga0439432_022899 | Ga0439432_022899_1189_2007 | 262 |
| 1402 | 3300042006 | Ga0439432_034204 | Ga0439432_034204_119_937 | 262 |
| 1403 | 3300042007 | Ga0439449_0100599 | Ga0439449_0100599_237_1058 | 262 |
| 1404 | 3300046453 | Ga0495627_083255 | Ga0495627_083255_38_856 | 262 |
| 1405 | 3300046471 | Ga0495650_0034324 | Ga0495650_0034324_16_834 | 262 |
| 1406 | 3300046474 | Ga0495605_0128815 | Ga0495605_0128815_303_1121 | 262 |
| 1407 | 3300046492 | Ga0495585_0004077 | Ga0495585_0004077_1067_1885 | 262 |
| 1408 | 3300046492 | Ga0495585_0151849 | Ga0495585_0151849_13_831 | 262 |
| 1409 | 3300046506 | Ga0495583_0001709 | Ga0495583_0001709_4969_5787 | 262 |
| 1410 | 3300046506 | Ga0495583_0015869 | Ga0495583_0015869_1128_1946 | 262 |
| 1411 | 3300046512 | Ga0495610_0001297 | Ga0495610_0001297_17959_18777 | 262 |
| 1412 | 3300046513 | Ga0495616_0016614 | Ga0495616_0016614_223_1041 | 262 |
| 1413 | 3300046513 | Ga0495616_0123801 | Ga0495616_0123801_175_993 | 262 |
| 1414 | 3300046515 | Ga0495620_0019139 | Ga0495620_0019139_589_1407 | 262 |
| 1415 | 3300046518 | Ga0495631_0000651 | Ga0495631_0000651_1540_2358 | 262 |
| 1416 | 3300046519 | Ga0495632_0015871 | Ga0495632_0015871_3168_3986 | 262 |
| 1417 | 3300046519 | Ga0495632_0028828 | Ga0495632_0028828_147_965 | 262 |
| 1418 | 3300046524 | Ga0495648_0047779 | Ga0495648_0047779_1787_2605 | 262 |
| 1419 | 3300046530 | Ga0495654_0001032 | Ga0495654_0001032_17031_17852 | 262 |
| 1420 | 3300046530 | Ga0495654_0113723 | Ga0495654_0113723_14_832 | 262 |
| 1421 | 3300046538 | Ga0495609_0058088 | Ga0495609_0058088_306_1124 | 262 |
| 1422 | 3300046616 | Ga0495668_0003018 | Ga0495668_0003018_12030_12848 | 262 |
| 1423 | 3300046648 | Ga0495611_0095065 | Ga0495611_0095065_537_1355 | 262 |
| 1424 | 3300046660 | Ga0495625_0001384 | Ga0495625_0001384_9875_10693 | 262 |
| 1425 | 3300046660 | Ga0495625_0243837 | Ga0495625_0243837_121_942 | 262 |
| 1426 | 3300046810 | Ga0495660_0029351 | Ga0495660_0029351_295_1113 | 262 |
| 1427 | 3300047320 | Ga0495672_0024115 | Ga0495672_0024115_1269_2087 | 262 |
| 1428 | 3300047469 | Ga0495673_0033885 | Ga0495673_0033885_864_1682 | 262 |
| 1429 | 3300047472 | Ga0495686_0005372 | Ga0495686_0005372_244_1062 | 262 |
| 1430 | 3300047472 | Ga0495686_0213673 | Ga0495686_0213673_49_867 | 262 |
| 1431 | 3300048090 | Ga0495615_0042369 | Ga0495615_0042369_180_998 | 262 |
| 1432 | 3300048904 | Ga0496101_0215314 | Ga0496101_0215314_549_1367 | 262 |
| 1433 | 3300048909 | Ga0496106_0021532 | Ga0496106_0021532_3563_4381 | 262 |
| 1434 | 3300048919 | Ga0496116_0001443 | Ga0496116_0001443_16893_17711 | 262 |
| 1435 | 3300048919 | Ga0496116_0002283 | Ga0496116_0002283_7120_7938 | 262 |
| 1436 | 3300048919 | Ga0496116_0055920 | Ga0496116_0055920_418_1236 | 262 |
| 1437 | 3300048919 | Ga0496116_0188455 | Ga0496116_0188455_15_833 | 262 |
| 1438 | 3300048920 | Ga0496117_0004761 | Ga0496117_0004761_8595_9413 | 262 |
| 1439 | 3300048920 | Ga0496117_0005892 | Ga0496117_0005892_5327_6145 | 262 |
| 1440 | 3300048920 | Ga0496117_0047517 | Ga0496117_0047517_2030_2848 | 262 |
| 1441 | 3300048920 | Ga0496117_0052840 | Ga0496117_0052840_1779_2597 | 262 |
| 1442 | 3300048921 | Ga0496118_0007687 | Ga0496118_0007687_5305_6123 | 262 |
| 1443 | 3300048921 | Ga0496118_0029929 | Ga0496118_0029929_1912_2730 | 262 |
| 1444 | 3300048921 | Ga0496118_0038968 | Ga0496118_0038968_762_1580 | 262 |
| 1445 | 3300048922 | Ga0496119_0204399 | Ga0496119_0204399_31_849 | 262 |
| 1446 | 3300048924 | Ga0496121_0004125 | Ga0496121_0004125_6700_7518 | 262 |
| 1447 | 3300048924 | Ga0496121_0021858 | Ga0496121_0021858_3255_4073 | 262 |
| 1448 | 3300048924 | Ga0496121_0063365 | Ga0496121_0063365_531_1349 | 262 |
| 1449 | 3300048924 | Ga0496121_0143804 | Ga0496121_0143804_886_1704 | 262 |
| 1450 | 3300048924 | Ga0496121_0285018 | Ga0496121_0285018_224_1042 | 262 |
| 1451 | 3300048925 | Ga0496122_0001050 | Ga0496122_0001050_19858_20676 | 262 |
| 1452 | 3300048925 | Ga0496122_0002628 | Ga0496122_0002628_15175_15993 | 262 |
| 1453 | 3300048925 | Ga0496122_0013396 | Ga0496122_0013396_5144_5962 | 262 |
| 1454 | 3300048925 | Ga0496122_0031795 | Ga0496122_0031795_3081_3899 | 262 |
| 1455 | 3300048925 | Ga0496122_0046656 | Ga0496122_0046656_2020_2838 | 262 |
| 1456 | 3300048926 | Ga0496123_0000158 | Ga0496123_0000158_27666_28484 | 262 |
| 1457 | 3300048926 | Ga0496123_0005487 | Ga0496123_0005487_1543_2361 | 262 |
| 1458 | 3300048926 | Ga0496123_0017583 | Ga0496123_0017583_2560_3378 | 262 |
| 1459 | 3300048926 | Ga0496123_0053756 | Ga0496123_0053756_1679_2497 | 262 |
| 1460 | 3300048927 | Ga0496124_0000743 | Ga0496124_0000743_34535_35353 | 262 |
| 1461 | 3300048927 | Ga0496124_0003963 | Ga0496124_0003963_7157_7975 | 262 |
| 1462 | 3300048927 | Ga0496124_0011436 | Ga0496124_0011436_1326_2144 | 262 |
| 1463 | 3300048927 | Ga0496124_0034825 | Ga0496124_0034825_567_1385 | 262 |
| 1464 | 3300048927 | Ga0496124_0041399 | Ga0496124_0041399_509_1327 | 262 |
| 1465 | 3300048927 | Ga0496124_0261566 | Ga0496124_0261566_179_997 | 262 |
| 1466 | 3300048928 | Ga0496125_0000695 | Ga0496125_0000695_42328_43146 | 262 |
| 1467 | 3300048928 | Ga0496125_0013510 | Ga0496125_0013510_3832_4650 | 262 |
| 1468 | 3300048928 | Ga0496125_0016113 | Ga0496125_0016113_193_1011 | 262 |
| 1469 | 3300048929 | Ga0496126_0000195 | Ga0496126_0000195_107026_107844 | 262 |
| 1470 | 3300049459 | Ga0495678_011095 | Ga0495678_011095_2917_3735 | 262 |
| 1471 | 3300049459 | Ga0495678_077409 | Ga0495678_077409_239_1060 | 262 |
| 1472 | 3300049568 | Ga0501031_0217196 | Ga0501031_0217196_25_843 | 262 |
| 1473 | 3300049569 | Ga0501032_0081072 | Ga0501032_0081072_1165_1983 | 262 |
| 1474 | 3300049569 | Ga0501032_0097643 | Ga0501032_0097643_147_965 | 262 |
| 1475 | 3300049571 | Ga0501034_0148265 | Ga0501034_0148265_494_1312 | 262 |
| 1476 | 3300049571 | Ga0501034_0224552 | Ga0501034_0224552_10_828 | 262 |
| 1477 | 3300049572 | Ga0501036_0146725 | Ga0501036_0146725_1153_1971 | 262 |
| 1478 | 3300049572 | Ga0501036_0165501 | Ga0501036_0165501_210_1031 | 262 |
| 1479 | 3300049573 | Ga0501037_0189083 | Ga0501037_0189083_378_1196 | 262 |
| 1480 | 3300049574 | Ga0501038_0131033 | Ga0501038_0131033_73_891 | 262 |
| 1481 | 3300049575 | Ga0501039_0342868 | Ga0501039_0342868_333_1154 | 262 |
| 1482 | 3300049579 | Ga0501043_0010702 | Ga0501043_0010702_3604_4422 | 262 |
| 1483 | 3300049579 | Ga0501043_0210303 | Ga0501043_0210303_283_1101 | 262 |
| 1484 | 3300049581 | Ga0501047_0056209 | Ga0501047_0056209_2946_3764 | 262 |
| 1485 | 3300049581 | Ga0501047_0087523 | Ga0501047_0087523_1471_2289 | 262 |
| 1486 | 3300049583 | Ga0501067_0036197 | Ga0501067_0036197_1089_1907 | 262 |
| 1487 | 3300049585 | Ga0501069_0076670 | Ga0501069_0076670_579_1400 | 262 |
| 1488 | 3300049586 | Ga0501070_0120810 | Ga0501070_0120810_205_1026 | 262 |
| 1489 | 3300049589 | Ga0501073_0096224 | Ga0501073_0096224_1053_1874 | 262 |
| 1490 | 3300049589 | Ga0501073_0197845 | Ga0501073_0197845_30_848 | 262 |
| 1491 | 3300049742 | Ga0501080_0050494 | Ga0501080_0050494_2095_2913 | 262 |
| 1492 | 3300049742 | Ga0501080_0455512 | Ga0501080_0455512_211_1032 | 262 |
| 1493 | 3300049744 | Ga0501083_0090776 | Ga0501083_0090776_228_1046 | 262 |
| 1494 | 3300049776 | Ga0501280_003795 | Ga0501280_003795_1319_2140 | 262 |
| 1495 | 3300049823 | Ga0501044_0053659 | Ga0501044_0053659_3140_3958 | 262 |
| 1496 | 3300049823 | Ga0501044_0098638 | Ga0501044_0098638_731_1549 | 262 |
| 1497 | 3300049823 | Ga0501044_0126201 | Ga0501044_0126201_918_1736 | 262 |
| 1498 | 3300053093 | Ga0500651_0167214 | Ga0500651_0167214_384_1202 | 262 |
| 1499 | 3300053109 | Ga0500569_001278 | Ga0500569_001278_996_1814 | 262 |
| 1500 | 3300053118 | Ga0500594_0002582 | Ga0500594_0002582_31_849 | 262 |
| 1501 | 3300053125 | Ga0500618_001151 | Ga0500618_001151_7547_8368 | 262 |
| 1502 | 3300053139 | Ga0500568_0000924 | Ga0500568_0000924_5250_6068 | 262 |
| 1503 | 3300053139 | Ga0500568_0004782 | Ga0500568_0004782_4960_5778 | 262 |
| 1504 | 3300053151 | Ga0500604_0050123 | Ga0500604_0050123_113_931 | 262 |
| 1505 | 3300053153 | Ga0500616_0002449 | Ga0500616_0002449_5611_6429 | 262 |
| 1506 | 3300053156 | Ga0500622_0001035 | Ga0500622_0001035_18705_19523 | 262 |
| 1507 | 3300053156 | Ga0500622_0132185 | Ga0500622_0132185_307_1125 | 262 |
| 1508 | 3300053160 | Ga0500633_0009280 | Ga0500633_0009280_128_946 | 262 |
| 1509 | 3300006038 | Ga0075365_10138288 | Ga0075365_101382882 | 263 |
| 1510 | 3300021320 | Ga0214544_1000012 | Ga0214544_1000012147 | 263 |
| 1511 | 3300021321 | Ga0214542_1000011 | Ga0214542_1000011141 | 263 |
| 1512 | 3300021321 | Ga0214542_1017282 | Ga0214542_10172825 | 263 |
| 1513 | 3300021327 | Ga0214543_1000004 | Ga0214543_1000004359 | 263 |
| 1514 | 3300021327 | Ga0214543_1000256 | Ga0214543_100025642 | 263 |
| 1515 | 3300027111 | Ga0209281_1000519 | Ga0209281_10005197 | 263 |
| 1516 | 3300032002 | Ga0307416_100603293 | Ga0307416_1006032932 | 263 |
| 1517 | 3300050494 | nmdc:mga06z11_62571_c1 | nmdc:mga06z11_62571_c1_38_856 | 263 |
| 1518 | 3300050516 | nmdc:mga0sz30_175615_c1 | nmdc:mga0sz30_175615_c1_103_921 | 263 |
| 1519 | 3300005336 | Ga0070680_100036295 | Ga0070680_1000362954 | 264 |
| 1520 | 3300005337 | Ga0070682_100040460 | Ga0070682_1000404601 | 264 |
| 1521 | 3300005339 | Ga0070660_100218298 | Ga0070660_1002182981 | 264 |
| 1522 | 3300005341 | Ga0070691_10158127 | Ga0070691_101581271 | 264 |
| 1523 | 3300005366 | Ga0070659_100032393 | Ga0070659_1000323932 | 264 |
| 1524 | 3300005440 | Ga0070705_100012932 | Ga0070705_1000129323 | 264 |
| 1525 | 3300005441 | Ga0070700_100267034 | Ga0070700_1002670341 | 264 |
| 1526 | 3300005455 | Ga0070663_100071387 | Ga0070663_1000713872 | 264 |
| 1527 | 3300005458 | Ga0070681_10006028 | Ga0070681_100060285 | 264 |
| 1528 | 3300005530 | Ga0070679_100014502 | Ga0070679_1000145022 | 264 |
| 1529 | 3300005539 | Ga0068853_100015631 | Ga0068853_1000156315 | 264 |
| 1530 | 3300005546 | Ga0070696_100032028 | Ga0070696_1000320282 | 264 |
| 1531 | 3300005548 | Ga0070665_100003769 | Ga0070665_1000037696 | 264 |
| 1532 | 3300005563 | Ga0068855_100288527 | Ga0068855_1002885272 | 264 |
| 1533 | 3300005564 | Ga0070664_100156462 | Ga0070664_1001564622 | 264 |
| 1534 | 3300005614 | Ga0068856_100479612 | Ga0068856_1004796121 | 264 |
| 1535 | 3300005615 | Ga0070702_100062629 | Ga0070702_1000626292 | 264 |
| 1536 | 3300005843 | Ga0068860_100461223 | Ga0068860_1004612232 | 264 |
| 1537 | 3300006038 | Ga0075365_10174103 | Ga0075365_101741032 | 264 |
| 1538 | 3300009101 | Ga0105247_10056622 | Ga0105247_100566222 | 264 |
| 1539 | 3300009148 | Ga0105243_10067473 | Ga0105243_100674732 | 264 |
| 1540 | 3300009174 | Ga0105241_10050610 | Ga0105241_100506103 | 264 |
| 1541 | 3300009545 | Ga0105237_10041352 | Ga0105237_100413523 | 264 |
| 1542 | 3300010375 | Ga0105239_10143028 | Ga0105239_101430283 | 264 |
| 1543 | 3300013296 | Ga0157374_10535891 | Ga0157374_105358912 | 264 |
| 1544 | 3300013297 | Ga0157378_10071978 | Ga0157378_100719782 | 264 |
| 1545 | 3300025900 | Ga0207710_10119331 | Ga0207710_101193312 | 264 |
| 1546 | 3300025904 | Ga0207647_10009890 | Ga0207647_100098902 | 264 |
| 1547 | 3300025914 | Ga0207671_10118463 | Ga0207671_101184632 | 264 |
| 1548 | 3300025917 | Ga0207660_10118213 | Ga0207660_101182133 | 264 |
| 1549 | 3300025919 | Ga0207657_10135462 | Ga0207657_101354622 | 264 |
| 1550 | 3300025921 | Ga0207652_10515267 | Ga0207652_105152671 | 264 |
| 1551 | 3300025945 | Ga0207679_10109678 | Ga0207679_101096782 | 264 |
| 1552 | 3300026067 | Ga0207678_10000100 | Ga0207678_1000010012 | 264 |
| 1553 | 3300026078 | Ga0207702_10446584 | Ga0207702_104465841 | 264 |
| 1554 | 3300028379 | Ga0268266_10003101 | Ga0268266_100031019 | 264 |
| 1555 | 3300028381 | Ga0268264_10051148 | Ga0268264_100511482 | 264 |
| 1556 | 3300046460 | Ga0495638_0022249 | Ga0495638_0022249_2609_3427 | 264 |
| 1557 | 3300047472 | Ga0495686_0031564 | Ga0495686_0031564_131_946 | 264 |
| 1558 | 3300048904 | Ga0496101_0051851 | Ga0496101_0051851_1613_2437 | 264 |
| 1559 | 3300048905 | Ga0496102_0007685 | Ga0496102_0007685_7920_8744 | 264 |
| 1560 | 3300048906 | Ga0496103_0025599 | Ga0496103_0025599_1475_2299 | 264 |
| 1561 | 3300048907 | Ga0496104_0445266 | Ga0496104_0445266_67_891 | 264 |
| 1562 | 3300048909 | Ga0496106_0070794 | Ga0496106_0070794_460_1284 | 264 |
| 1563 | 3300048910 | Ga0496107_0032993 | Ga0496107_0032993_778_1602 | 264 |
| 1564 | 3300048918 | Ga0496115_0050412 | Ga0496115_0050412_1180_2004 | 264 |
| 1565 | 3300048918 | Ga0496115_0120401 | Ga0496115_0120401_1185_2003 | 264 |
| 1566 | 3300049580 | Ga0501046_0026209 | Ga0501046_0026209_3580_4404 | 264 |
| 1567 | 3300049583 | Ga0501067_0028159 | Ga0501067_0028159_1016_1840 | 264 |
| 1568 | 3300049823 | Ga0501044_0032199 | Ga0501044_0032199_3179_4003 | 264 |
| 1569 | 3300053158 | Ga0500627_0052506 | Ga0500627_0052506_919_1734 | 264 |
| 1570 | 3300001979 | JGI24740J21852_10003648 | JGI24740J21852_100036482 | 265 |
| 1571 | 3300002705 | JGI25156J39149_1011633 | JGI25156J39149_10116333 | 265 |
| 1572 | 3300002741 | JGI25157J39369_1002049 | JGI25157J39369_10020495 | 265 |
| 1573 | 3300003763 | Ga0055529_1003391 | Ga0055529_10033912 | 265 |
| 1574 | 3300005548 | Ga0070665_100781846 | Ga0070665_1007818461 | 265 |
| 1575 | 3300005614 | Ga0068856_100246320 | Ga0068856_1002463202 | 265 |
| 1576 | 3300006038 | Ga0075365_10015283 | Ga0075365_100152832 | 265 |
| 1577 | 3300006042 | Ga0075368_10074969 | Ga0075368_100749692 | 265 |
| 1578 | 3300006048 | Ga0075363_100022130 | Ga0075363_1000221302 | 265 |
| 1579 | 3300006048 | Ga0075363_100112488 | Ga0075363_1001124882 | 265 |
| 1580 | 3300006051 | Ga0075364_10022542 | Ga0075364_100225422 | 265 |
| 1581 | 3300006051 | Ga0075364_10162493 | Ga0075364_101624932 | 265 |
| 1582 | 3300006177 | Ga0075362_10049994 | Ga0075362_100499942 | 265 |
| 1583 | 3300006177 | Ga0075362_10051585 | Ga0075362_100515852 | 265 |
| 1584 | 3300006178 | Ga0075367_10045731 | Ga0075367_100457313 | 265 |
| 1585 | 3300009093 | Ga0105240_10712829 | Ga0105240_107128292 | 265 |
| 1586 | 3300009174 | Ga0105241_10088427 | Ga0105241_100884272 | 265 |
| 1587 | 3300009174 | Ga0105241_10293398 | Ga0105241_102933982 | 265 |
| 1588 | 3300009545 | Ga0105237_10034925 | Ga0105237_100349253 | 265 |
| 1589 | 3300009545 | Ga0105237_10563059 | Ga0105237_105630592 | 265 |
| 1590 | 3300009545 | Ga0105237_10882249 | Ga0105237_108822491 | 265 |
| 1591 | 3300009553 | Ga0105249_10438761 | Ga0105249_104387612 | 265 |
| 1592 | 3300010375 | Ga0105239_10028240 | Ga0105239_100282404 | 265 |
| 1593 | 3300010375 | Ga0105239_10073717 | Ga0105239_100737172 | 265 |
| 1594 | 3300010375 | Ga0105239_10124983 | Ga0105239_101249831 | 265 |
| 1595 | 3300013105 | Ga0157369_10083884 | Ga0157369_100838842 | 265 |
| 1596 | 3300013306 | Ga0163162_10964457 | Ga0163162_109644572 | 265 |
| 1597 | 3300013307 | Ga0157372_10451691 | Ga0157372_104516912 | 265 |
| 1598 | 3300015261 | Ga0182006_1022618 | Ga0182006_10226183 | 265 |
| 1599 | 3300015262 | Ga0182007_10016195 | Ga0182007_100161952 | 265 |
| 1600 | 3300025246 | Ga0209646_1009151 | Ga0209646_10091512 | 265 |
| 1601 | 3300025250 | Ga0209026_1000116 | Ga0209026_100011655 | 265 |
| 1602 | 3300025254 | Ga0209148_1000256 | Ga0209148_100025611 | 265 |
| 1603 | 3300025256 | Ga0209759_1000153 | Ga0209759_100015369 | 265 |
| 1604 | 3300025261 | Ga0209233_1000047 | Ga0209233_1000047291 | 265 |
| 1605 | 3300025261 | Ga0209233_1006535 | Ga0209233_10065352 | 265 |
| 1606 | 3300025272 | Ga0209455_1000409 | Ga0209455_100040919 | 265 |
| 1607 | 3300025904 | Ga0207647_10015550 | Ga0207647_100155503 | 265 |
| 1608 | 3300025909 | Ga0207705_10138964 | Ga0207705_101389642 | 265 |
| 1609 | 3300025911 | Ga0207654_10075474 | Ga0207654_100754742 | 265 |
| 1610 | 3300025913 | Ga0207695_10147766 | Ga0207695_101477662 | 265 |
| 1611 | 3300025914 | Ga0207671_10032373 | Ga0207671_100323732 | 265 |
| 1612 | 3300025914 | Ga0207671_10187119 | Ga0207671_101871191 | 265 |
| 1613 | 3300025914 | Ga0207671_10334587 | Ga0207671_103345871 | 265 |
| 1614 | 3300025919 | Ga0207657_10105467 | Ga0207657_101054672 | 265 |
| 1615 | 3300025932 | Ga0207690_10259193 | Ga0207690_102591932 | 265 |
| 1616 | 3300025937 | Ga0207669_10141686 | Ga0207669_101416862 | 265 |
| 1617 | 3300025986 | Ga0207658_10208395 | Ga0207658_102083951 | 265 |
| 1618 | 3300026116 | Ga0207674_10106290 | Ga0207674_101062901 | 265 |
| 1619 | 3300026121 | Ga0207683_10111605 | Ga0207683_101116052 | 265 |
| 1620 | 3300026142 | Ga0207698_10630914 | Ga0207698_106309141 | 265 |
| 1621 | 3300026142 | Ga0207698_10678705 | Ga0207698_106787051 | 265 |
| 1622 | 3300027866 | Ga0209813_10021450 | Ga0209813_100214502 | 265 |
| 1623 | 3300028379 | Ga0268266_10515040 | Ga0268266_105150401 | 265 |
| 1624 | 3300028379 | Ga0268266_10801064 | Ga0268266_108010641 | 265 |
| 1625 | 3300037312 | Ga0395899_0000014 | Ga0395899_0000014_219422_220243 | 265 |
| 1626 | 3300037418 | Ga0395900_0000007 | Ga0395900_0000007_219441_220262 | 265 |
| 1627 | 3300037466 | Ga0395898_0000011 | Ga0395898_0000011_268599_269420 | 265 |
| 1628 | 3300037471 | Ga0395905_0000008 | Ga0395905_0000008_219441_220262 | 265 |
| 1629 | 3300037471 | Ga0395905_0011842 | Ga0395905_0011842_2180_2998 | 265 |
| 1630 | 3300038443 | Ga0395901_0000020 | Ga0395901_0000020_45499_46320 | 265 |
| 1631 | 3300038443 | Ga0395901_0027701 | Ga0395901_0027701_2420_3238 | 265 |
| 1632 | 3300044683 | Ga0466965_0240164 | Ga0466965_0240164_91_909 | 265 |
| 1633 | 3300044901 | Ga0466960_0003639 | Ga0466960_0003639_3581_4399 | 265 |
| 1634 | 3300046460 | Ga0495638_0131159 | Ga0495638_0131159_386_1204 | 265 |
| 1635 | 3300046616 | Ga0495668_0017367 | Ga0495668_0017367_1476_2294 | 265 |
| 1636 | 3300046660 | Ga0495625_0017986 | Ga0495625_0017986_397_1215 | 265 |
| 1637 | 3300046665 | Ga0495661_0216745 | Ga0495661_0216745_26_844 | 265 |
| 1638 | 3300048913 | Ga0496110_0122735 | Ga0496110_0122735_841_1659 | 265 |
| 1639 | 3300048915 | Ga0496112_0025119 | Ga0496112_0025119_3908_4726 | 265 |
| 1640 | 3300048916 | Ga0496113_0280657 | Ga0496113_0280657_121_939 | 265 |
| 1641 | 3300048922 | Ga0496119_0018827 | Ga0496119_0018827_3611_4429 | 265 |
| 1642 | 3300048922 | Ga0496119_0062517 | Ga0496119_0062517_1004_1822 | 265 |
| 1643 | 3300048923 | Ga0496120_0009069 | Ga0496120_0009069_2097_2915 | 265 |
| 1644 | 3300048923 | Ga0496120_0184618 | Ga0496120_0184618_87_905 | 265 |
| 1645 | 3300048929 | Ga0496126_0086852 | Ga0496126_0086852_398_1216 | 265 |
| 1646 | 3300049569 | Ga0501032_0000587 | Ga0501032_0000587_17543_18364 | 265 |
| 1647 | 3300049569 | Ga0501032_0049889 | Ga0501032_0049889_267_1088 | 265 |
| 1648 | 3300049570 | Ga0501033_0000076 | Ga0501033_0000076_56935_57759 | 265 |
| 1649 | 3300049570 | Ga0501033_0000521 | Ga0501033_0000521_3157_3978 | 265 |
| 1650 | 3300049570 | Ga0501033_0016419 | Ga0501033_0016419_3517_4338 | 265 |
| 1651 | 3300049570 | Ga0501033_0141001 | Ga0501033_0141001_582_1403 | 265 |
| 1652 | 3300049571 | Ga0501034_0001873 | Ga0501034_0001873_2606_3430 | 265 |
| 1653 | 3300049571 | Ga0501034_0008667 | Ga0501034_0008667_2412_3236 | 265 |
| 1654 | 3300049571 | Ga0501034_0166741 | Ga0501034_0166741_1003_1824 | 265 |
| 1655 | 3300049571 | Ga0501034_0479686 | Ga0501034_0479686_247_1065 | 265 |
| 1656 | 3300049572 | Ga0501036_0002844 | Ga0501036_0002844_6653_7477 | 265 |
| 1657 | 3300049572 | Ga0501036_0084228 | Ga0501036_0084228_1709_2530 | 265 |
| 1658 | 3300049573 | Ga0501037_0000224 | Ga0501037_0000224_413_1234 | 265 |
| 1659 | 3300049573 | Ga0501037_0000812 | Ga0501037_0000812_6666_7490 | 265 |
| 1660 | 3300049573 | Ga0501037_0062874 | Ga0501037_0062874_125_946 | 265 |
| 1661 | 3300049574 | Ga0501038_0000241 | Ga0501038_0000241_23281_24105 | 265 |
| 1662 | 3300049574 | Ga0501038_0109237 | Ga0501038_0109237_384_1205 | 265 |
| 1663 | 3300049574 | Ga0501038_0277545 | Ga0501038_0277545_181_1002 | 265 |
| 1664 | 3300049574 | Ga0501038_0442920 | Ga0501038_0442920_86_907 | 265 |
| 1665 | 3300049575 | Ga0501039_0000196 | Ga0501039_0000196_23429_24253 | 265 |
| 1666 | 3300049575 | Ga0501039_0319359 | Ga0501039_0319359_356_1177 | 265 |
| 1667 | 3300049579 | Ga0501043_0000005 | Ga0501043_0000005_31923_32744 | 265 |
| 1668 | 3300049579 | Ga0501043_0000043 | Ga0501043_0000043_61658_62482 | 265 |
| 1669 | 3300049579 | Ga0501043_0372383 | Ga0501043_0372383_174_995 | 265 |
| 1670 | 3300049580 | Ga0501046_0038328 | Ga0501046_0038328_2906_3730 | 265 |
| 1671 | 3300049581 | Ga0501047_0005104 | Ga0501047_0005104_1247_2068 | 265 |
| 1672 | 3300049581 | Ga0501047_0049610 | Ga0501047_0049610_127_948 | 265 |
| 1673 | 3300049581 | Ga0501047_0052545 | Ga0501047_0052545_2899_3720 | 265 |
| 1674 | 3300049583 | Ga0501067_0045622 | Ga0501067_0045622_1272_2093 | 265 |
| 1675 | 3300049584 | Ga0501068_0027596 | Ga0501068_0027596_124_945 | 265 |
| 1676 | 3300049585 | Ga0501069_0000011 | Ga0501069_0000011_27234_28055 | 265 |
| 1677 | 3300049585 | Ga0501069_0055908 | Ga0501069_0055908_394_1215 | 265 |
| 1678 | 3300049585 | Ga0501069_0159404 | Ga0501069_0159404_387_1208 | 265 |
| 1679 | 3300049586 | Ga0501070_0000117 | Ga0501070_0000117_16885_17706 | 265 |
| 1680 | 3300049586 | Ga0501070_0001936 | Ga0501070_0001936_16481_17302 | 265 |
| 1681 | 3300049586 | Ga0501070_0004936 | Ga0501070_0004936_1715_2536 | 265 |
| 1682 | 3300049587 | Ga0501071_0005058 | Ga0501071_0005058_3375_4196 | 265 |
| 1683 | 3300049589 | Ga0501073_0027903 | Ga0501073_0027903_2983_3804 | 265 |
| 1684 | 3300049590 | Ga0501074_0002555 | Ga0501074_0002555_10415_11236 | 265 |
| 1685 | 3300049590 | Ga0501074_0033856 | Ga0501074_0033856_2738_3559 | 265 |
| 1686 | 3300049741 | Ga0501079_0337543 | Ga0501079_0337543_247_1068 | 265 |
| 1687 | 3300049742 | Ga0501080_0005693 | Ga0501080_0005693_9904_10725 | 265 |
| 1688 | 3300049742 | Ga0501080_0014905 | Ga0501080_0014905_3792_4613 | 265 |
| 1689 | 3300049742 | Ga0501080_0525103 | Ga0501080_0525103_148_969 | 265 |
| 1690 | 3300049744 | Ga0501083_0000406 | Ga0501083_0000406_15587_16408 | 265 |
| 1691 | 3300049822 | Ga0501035_0000107 | Ga0501035_0000107_28131_28952 | 265 |
| 1692 | 3300049822 | Ga0501035_0000449 | Ga0501035_0000449_23314_24138 | 265 |
| 1693 | 3300049822 | Ga0501035_0001177 | Ga0501035_0001177_20915_21736 | 265 |
| 1694 | 3300049822 | Ga0501035_0007710 | Ga0501035_0007710_4660_5481 | 265 |
| 1695 | 3300049822 | Ga0501035_0342862 | Ga0501035_0342862_206_1027 | 265 |
| 1696 | 3300049823 | Ga0501044_0000154 | Ga0501044_0000154_77004_77825 | 265 |
| 1697 | 3300049823 | Ga0501044_0008423 | Ga0501044_0008423_9044_9865 | 265 |
| 1698 | 3300049823 | Ga0501044_0010150 | Ga0501044_0010150_6127_6951 | 265 |
| 1699 | 3300049823 | Ga0501044_0085982 | Ga0501044_0085982_1990_2811 | 265 |
| 1700 | 3300049823 | Ga0501044_0087274 | Ga0501044_0087274_2152_2973 | 265 |
| 1701 | 3300049823 | Ga0501044_0091619 | Ga0501044_0091619_1833_2654 | 265 |
| 1702 | 3300049823 | Ga0501044_0280465 | Ga0501044_0280465_633_1454 | 265 |
| 1703 | 3300050489 | nmdc:mga03683_51889_c1 | nmdc:mga03683_51889_c1_109_927 | 265 |
| 1704 | 3300050490 | nmdc:mga03n38_3995_c1 | nmdc:mga03n38_3995_c1_76_894 | 265 |
| 1705 | 3300050491 | nmdc:mga00v17_132932_c1 | nmdc:mga00v17_132932_c1_135_953 | 265 |
| 1706 | 3300050492 | nmdc:mga0yw44_1917_c1 | nmdc:mga0yw44_1917_c1_4453_5271 | 265 |
| 1707 | 3300050492 | nmdc:mga0yw44_96982_c1 | nmdc:mga0yw44_96982_c1_248_1066 | 265 |
| 1708 | 3300050494 | nmdc:mga06z11_52758_c1 | nmdc:mga06z11_52758_c1_95_913 | 265 |
| 1709 | 3300050494 | nmdc:mga06z11_91541_c1 | nmdc:mga06z11_91541_c1_186_1004 | 265 |
| 1710 | 3300050495 | nmdc:mga04h51_56754_c1 | nmdc:mga04h51_56754_c1_430_1248 | 265 |
| 1711 | 3300050496 | nmdc:mga07m45_123910_c1 | nmdc:mga07m45_123910_c1_131_949 | 265 |
| 1712 | 3300053079 | Ga0500610_0064816 | Ga0500610_0064816_327_1145 | 265 |
| 1713 | 3300053134 | Ga0500658_0141410 | Ga0500658_0141410_58_876 | 265 |
| 1714 | 3300053153 | Ga0500616_0017030 | Ga0500616_0017030_20_838 | 265 |
| 1715 | 3300053155 | Ga0500620_029555 | Ga0500620_029555_560_1378 | 265 |
| 1716 | 3300053158 | Ga0500627_0101530 | Ga0500627_0101530_212_1030 | 265 |
| 1717 | 3300054114 | Ga0501084_0238511 | Ga0501084_0238511_298_1119 | 265 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
63
246
0.78
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar