F495454
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1716 | 597 | 3432 | 257 |
Family's Representative Sequence
| Representative Sequence | 3300048920|Ga0496117_0044861|Ga0496117_0044861_2236_3123 |
| Length | 295 |
| Sequence | LLQHSETGAAHRNERRLFNARAAVGCGVAINPGEVMRLDGKVAIVTGAASGIGKRIAEVYAENGAAVAIADINLDAANATAKELEATGAKAIGVKMDVTSEQEVDAGVADVVARLGHVDILVSNAGIQIVNPVDKFAYADWKKLVAIHLDGAFLTTRACLQAMYARGKGGSIIYMGSVHSKEASKLKAPYVAAKHGLVGLAKVVAKEGAEHGVRANVICPGFVRTPLVEKQIPEQAKELGISEADVIKNVMLKETVDGEFTTVDDVAQCALFLAGFETNALTGQSLVVSHGWFMQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 8 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 9 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 11 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 12 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 19 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 20 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 101 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 102 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 103 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 104 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 105 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 106 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 107 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 108 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 109 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 110 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 111 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 113 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 114 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 115 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 116 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 119 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 120 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 122 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 123 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 124 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 125 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 126 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 127 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 128 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 129 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 131 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 147 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 159 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 163 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 164 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 170 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 171 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 172 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 182 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 183 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 185 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 261 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 263 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 267 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 268 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 269 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 271 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 272 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 273 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 274 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 275 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 276 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 277 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 278 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 279 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 280 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 281 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 282 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 283 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 284 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 285 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 286 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 287 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 288 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 289 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 291 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 292 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 293 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 294 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 295 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 296 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 297 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 300 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 301 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 302 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 303 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 304 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 305 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 306 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 307 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 308 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 309 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 310 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 311 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 312 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 313 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 314 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 315 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 316 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 317 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 318 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 319 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 320 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 322 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 323 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 324 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 325 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 326 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 327 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 328 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 329 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 330 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 331 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 332 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 333 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 334 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 335 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 336 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 337 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 338 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 339 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 340 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 341 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 342 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 343 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 344 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 345 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 346 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 347 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 348 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 428 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 429 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 430 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 431 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 432 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 433 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 436 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 437 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 438 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 439 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 440 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 441 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 442 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 443 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 444 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 445 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 446 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 447 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 448 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 449 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 450 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 454 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 488 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 489 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 494 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 495 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 496 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 499 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 500 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 503 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 504 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 505 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 506 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 507 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 508 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 509 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 510 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 511 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 512 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 513 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 514 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 515 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 516 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 517 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 518 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 519 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 520 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 521 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 522 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 523 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 524 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 525 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 526 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 527 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 528 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 529 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 530 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 532 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 533 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 534 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 535 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 536 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 537 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 538 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 539 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 540 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 541 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 542 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 543 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 544 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 545 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 546 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 547 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 548 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 549 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 550 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 551 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 552 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 553 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 554 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 555 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 556 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 557 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 558 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 559 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 560 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 561 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 562 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 563 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 564 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 565 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 566 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 567 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 568 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 569 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 570 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 571 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 572 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 573 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 574 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 575 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 576 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 577 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 578 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 579 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 580 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 581 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 582 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 583 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 584 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 585 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 586 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 587 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 588 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 589 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 590 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 591 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 592 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 593 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 594 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 595 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 596 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 597 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.8 |
| Metatranscriptomes | 0.35 |
| Isolates | 3.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.23 |
| Nodule | 0.47 |
| Rhizoplane | 2.74 |
| Rhizosphere | 83.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496117_0044861 | 3300048920 | Bacteria | 3199 |
| 2 | JGI24741J21665_1001217 | 3300001915 | Bacteria | 7572 |
| 3 | JGI24740J21852_10007131 | 3300001979 | Bacteria | 4565 |
| 4 | JGI24740J21852_10020119 | 3300001979 | Bacteria | 2336 |
| 5 | JGI24740J21852_10068980 | 3300001979 | Bacteria | 952 |
| 6 | JGI24739J22299_10012826 | 3300001989 | Bacteria | 3071 |
| 7 | JGI24737J22298_10003471 | 3300001990 | Bacteria | 5564 |
| 8 | JGI24744J21845_10004468 | 3300002077 | Bacteria | 2891 |
| 9 | JGI25155J39150_1000532 | 3300002704 | Bacteria | 8900 |
| 10 | JGI25155J39150_1000936 | 3300002704 | Bacteria | 3743 |
| 11 | JGI25156J39149_1001026 | 3300002705 | Bacteria | 13042 |
| 12 | JGI25156J39149_1004771 | 3300002705 | Bacteria | 4057 |
| 13 | JGI25156J39149_1015034 | 3300002705 | Bacteria | 1568 |
| 14 | JGI25156J39149_1021461 | 3300002705 | Bacteria | 1117 |
| 15 | JGI25162J39368_1000001 | 3300002737 | Bacteria | 740113 |
| 16 | JGI25162J39368_1005321 | 3300002737 | Bacteria | 2582 |
| 17 | JGI25154J39366_1000871 | 3300002738 | Bacteria | 13042 |
| 18 | JGI25154J39366_1000911 | 3300002738 | Bacteria | 12467 |
| 19 | JGI25157J39369_1004172 | 3300002741 | Bacteria | 2699 |
| 20 | JGI25157J39369_1004410 | 3300002741 | Bacteria | 2558 |
| 21 | JGI25163J39215_1002601 | 3300002771 | Bacteria | 1770 |
| 22 | JGI25164J39214_1000475 | 3300002772 | Bacteria | 19811 |
| 23 | JGI25152J39213_1028232 | 3300002773 | Bacteria | 895 |
| 24 | JGI25151J46595_10000913 | 3300003187 | Bacteria | 23081 |
| 25 | JGI25151J46595_10006316 | 3300003187 | Bacteria | 5974 |
| 26 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 27 | JGI25165J46597_1001366 | 3300003214 | Bacteria | 13559 |
| 28 | JGI25153J46596_10000045 | 3300003215 | Bacteria | 149347 |
| 29 | JGI25153J46596_10018640 | 3300003215 | Bacteria | 2688 |
| 30 | rootH1_10019690 | 3300003316 | Bacteria | 4250 |
| 31 | rootL2_10065722 | 3300003322 | Bacteria | 14285 |
| 32 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 33 | Ga0055538_1000013 | 3300003751 | Bacteria | 348596 |
| 34 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 35 | Ga0055539_1000018 | 3300003752 | Bacteria | 348596 |
| 36 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 37 | Ga0055533_1000022 | 3300003756 | Bacteria | 348596 |
| 38 | Ga0055532_1000017 | 3300003758 | Bacteria | 306880 |
| 39 | Ga0055525_1000001 | 3300003759 | Bacteria | 1016948 |
| 40 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 41 | Ga0055525_1000024 | 3300003759 | Bacteria | 348596 |
| 42 | Ga0055535_1006731 | 3300003761 | Bacteria | 2286 |
| 43 | Ga0055526_1028622 | 3300003771 | Bacteria | 1679 |
| 44 | Ga0055536_1004251 | 3300003781 | Bacteria | 7385 |
| 45 | Ga0055536_1012671 | 3300003781 | Bacteria | 3108 |
| 46 | Ga0055530_10036597 | 3300003791 | Bacteria | 1234 |
| 47 | Ga0055540_1001616 | 3300003792 | Bacteria | 13119 |
| 48 | Ga0055531_10002054 | 3300003794 | Bacteria | 13887 |
| 49 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 50 | Ga0055541_1000013 | 3300003841 | Bacteria | 348596 |
| 51 | Ga0065165_1000745 | 3300005262 | Bacteria | 44712 |
| 52 | Ga0065712_10112677 | 3300005290 | Bacteria | 1796 |
| 53 | Ga0065715_10321857 | 3300005293 | Bacteria | 1000 |
| 54 | Ga0070658_10000881 | 3300005327 | Bacteria | 25676 |
| 55 | Ga0070658_10093058 | 3300005327 | Bacteria | 2486 |
| 56 | Ga0070658_10138067 | 3300005327 | Bacteria | 2035 |
| 57 | Ga0070658_10156267 | 3300005327 | Bacteria | 1912 |
| 58 | Ga0070658_10224133 | 3300005327 | Bacteria | 1591 |
| 59 | Ga0070658_10382575 | 3300005327 | Bacteria | 1207 |
| 60 | Ga0070658_10505211 | 3300005327 | Bacteria | 1044 |
| 61 | Ga0070658_10664089 | 3300005327 | Bacteria | 904 |
| 62 | Ga0070676_10018089 | 3300005328 | Bacteria | 3902 |
| 63 | Ga0070676_10073008 | 3300005328 | Bacteria | 2064 |
| 64 | Ga0070676_10155875 | 3300005328 | Bacteria | 1466 |
| 65 | Ga0070683_100009560 | 3300005329 | Bacteria | 8300 |
| 66 | Ga0070683_100096695 | 3300005329 | Bacteria | 2778 |
| 67 | Ga0070683_100102161 | 3300005329 | Bacteria | 2700 |
| 68 | Ga0070683_100122436 | 3300005329 | Bacteria | 2458 |
| 69 | Ga0070683_100262653 | 3300005329 | Bacteria | 1642 |
| 70 | Ga0070683_100306077 | 3300005329 | Bacteria | 1512 |
| 71 | Ga0070683_100496211 | 3300005329 | Bacteria | 1166 |
| 72 | Ga0070690_100000396 | 3300005330 | Bacteria | 22104 |
| 73 | Ga0070690_100001314 | 3300005330 | Bacteria | 12919 |
| 74 | Ga0070670_100000011 | 3300005331 | Bacteria | 263074 |
| 75 | Ga0070670_100009125 | 3300005331 | Bacteria | 8476 |
| 76 | Ga0070670_100063773 | 3300005331 | Bacteria | 3162 |
| 77 | Ga0070670_100142839 | 3300005331 | Bacteria | 2070 |
| 78 | Ga0070670_100453730 | 3300005331 | Bacteria | 1136 |
| 79 | Ga0070677_10000119 | 3300005333 | Bacteria | 26083 |
| 80 | Ga0070677_10052611 | 3300005333 | Bacteria | 1653 |
| 81 | Ga0068869_100000465 | 3300005334 | Bacteria | 22413 |
| 82 | Ga0068869_100000575 | 3300005334 | Bacteria | 20597 |
| 83 | Ga0068869_100030458 | 3300005334 | Bacteria | 3787 |
| 84 | Ga0068869_100038379 | 3300005334 | Bacteria | 3414 |
| 85 | Ga0070666_10000097 | 3300005335 | Bacteria | 60322 |
| 86 | Ga0070666_10000198 | 3300005335 | Bacteria | 40959 |
| 87 | Ga0070666_10004931 | 3300005335 | Bacteria | 8163 |
| 88 | Ga0070666_10005202 | 3300005335 | Bacteria | 7969 |
| 89 | Ga0070666_10029401 | 3300005335 | Bacteria | 3612 |
| 90 | Ga0070666_10033779 | 3300005335 | Bacteria | 3387 |
| 91 | Ga0070666_10050374 | 3300005335 | Bacteria | 2801 |
| 92 | Ga0070666_10190636 | 3300005335 | Bacteria | 1440 |
| 93 | Ga0070666_10377766 | 3300005335 | Bacteria | 1017 |
| 94 | Ga0070680_100011206 | 3300005336 | Bacteria | 6935 |
| 95 | Ga0070680_100100287 | 3300005336 | Bacteria | 2403 |
| 96 | Ga0070680_100463638 | 3300005336 | Bacteria | 1082 |
| 97 | Ga0070682_100059155 | 3300005337 | Bacteria | 2419 |
| 98 | Ga0070682_100080367 | 3300005337 | Bacteria | 2108 |
| 99 | Ga0070682_100126734 | 3300005337 | Bacteria | 1722 |
| 100 | Ga0068868_100016774 | 3300005338 | Bacteria | 5446 |
| 101 | Ga0068868_100038492 | 3300005338 | Bacteria | 3712 |
| 102 | Ga0068868_100060073 | 3300005338 | Bacteria | 3008 |
| 103 | Ga0068868_100161524 | 3300005338 | Bacteria | 1850 |
| 104 | Ga0068868_100187168 | 3300005338 | Bacteria | 1720 |
| 105 | Ga0068868_100353230 | 3300005338 | Bacteria | 1259 |
| 106 | Ga0070660_100002548 | 3300005339 | Bacteria | 12490 |
| 107 | Ga0070660_100006229 | 3300005339 | Bacteria | 8260 |
| 108 | Ga0070660_100028777 | 3300005339 | Bacteria | 4160 |
| 109 | Ga0070660_100081744 | 3300005339 | Bacteria | 2536 |
| 110 | Ga0070689_100003279 | 3300005340 | Bacteria | 10743 |
| 111 | Ga0070689_100037597 | 3300005340 | Bacteria | 3701 |
| 112 | Ga0070689_100347195 | 3300005340 | Bacteria | 1244 |
| 113 | Ga0070691_10031910 | 3300005341 | Bacteria | 2472 |
| 114 | Ga0070687_100001236 | 3300005343 | Bacteria | 8866 |
| 115 | Ga0070687_100174327 | 3300005343 | Bacteria | 1283 |
| 116 | Ga0070661_100000128 | 3300005344 | Bacteria | 63056 |
| 117 | Ga0070661_100010705 | 3300005344 | Bacteria | 6382 |
| 118 | Ga0070661_100067383 | 3300005344 | Bacteria | 2630 |
| 119 | Ga0070661_100167629 | 3300005344 | Bacteria | 1666 |
| 120 | Ga0070692_10005521 | 3300005345 | Bacteria | 5402 |
| 121 | Ga0070692_10074102 | 3300005345 | Bacteria | 1820 |
| 122 | Ga0070692_10339447 | 3300005345 | Bacteria | 930 |
| 123 | Ga0070668_100000193 | 3300005347 | Bacteria | 39976 |
| 124 | Ga0070668_100000218 | 3300005347 | Bacteria | 36854 |
| 125 | Ga0070668_100006659 | 3300005347 | Bacteria | 8561 |
| 126 | Ga0070668_100105539 | 3300005347 | Bacteria | 2237 |
| 127 | Ga0070668_100243131 | 3300005347 | Bacteria | 1492 |
| 128 | Ga0070668_100344960 | 3300005347 | Bacteria | 1259 |
| 129 | Ga0070669_100001298 | 3300005353 | Bacteria | 18042 |
| 130 | Ga0070669_100006029 | 3300005353 | Bacteria | 8744 |
| 131 | Ga0070669_100048564 | 3300005353 | Bacteria | 3098 |
| 132 | Ga0070669_100073260 | 3300005353 | Bacteria | 2537 |
| 133 | Ga0070675_100007099 | 3300005354 | Bacteria | 8625 |
| 134 | Ga0070675_100059143 | 3300005354 | Bacteria | 3161 |
| 135 | Ga0070675_100303980 | 3300005354 | Bacteria | 1406 |
| 136 | Ga0070671_100000026 | 3300005355 | Bacteria | 120482 |
| 137 | Ga0070671_100001435 | 3300005355 | Bacteria | 17804 |
| 138 | Ga0070671_100016327 | 3300005355 | Bacteria | 6004 |
| 139 | Ga0070671_100033885 | 3300005355 | Bacteria | 4225 |
| 140 | Ga0070671_100053322 | 3300005355 | Bacteria | 3361 |
| 141 | Ga0070671_100086404 | 3300005355 | Bacteria | 2624 |
| 142 | Ga0070671_100262836 | 3300005355 | Bacteria | 1467 |
| 143 | Ga0070671_100322402 | 3300005355 | Bacteria | 1317 |
| 144 | Ga0070674_100000686 | 3300005356 | Bacteria | 17130 |
| 145 | Ga0070674_100000953 | 3300005356 | Bacteria | 15095 |
| 146 | Ga0070674_100021719 | 3300005356 | Bacteria | 4127 |
| 147 | Ga0070674_100047070 | 3300005356 | Bacteria | 2953 |
| 148 | Ga0070673_100054732 | 3300005364 | Bacteria | 3140 |
| 149 | Ga0070673_100067881 | 3300005364 | Bacteria | 2853 |
| 150 | Ga0070673_100757118 | 3300005364 | Bacteria | 895 |
| 151 | Ga0070688_100001706 | 3300005365 | Bacteria | 10967 |
| 152 | Ga0070688_100006308 | 3300005365 | Bacteria | 6330 |
| 153 | Ga0070659_100006519 | 3300005366 | Bacteria | 8429 |
| 154 | Ga0070659_100015651 | 3300005366 | Bacteria | 5682 |
| 155 | Ga0070659_100019145 | 3300005366 | Bacteria | 5180 |
| 156 | Ga0070659_100222101 | 3300005366 | Bacteria | 1559 |
| 157 | Ga0070659_100288472 | 3300005366 | Bacteria | 1366 |
| 158 | Ga0070659_100494006 | 3300005366 | Bacteria | 1042 |
| 159 | Ga0070667_100000010 | 3300005367 | Bacteria | 273500 |
| 160 | Ga0070667_100000092 | 3300005367 | Bacteria | 111329 |
| 161 | Ga0070667_100001339 | 3300005367 | Bacteria | 22088 |
| 162 | Ga0070667_100004143 | 3300005367 | Bacteria | 12254 |
| 163 | Ga0070667_100011628 | 3300005367 | Bacteria | 7277 |
| 164 | Ga0070667_100011752 | 3300005367 | Bacteria | 7234 |
| 165 | Ga0070667_100028507 | 3300005367 | Bacteria | 4649 |
| 166 | Ga0070667_100028612 | 3300005367 | Bacteria | 4640 |
| 167 | Ga0070667_100031890 | 3300005367 | Bacteria | 4392 |
| 168 | Ga0070667_100108091 | 3300005367 | Bacteria | 2409 |
| 169 | Ga0070667_100453085 | 3300005367 | Bacteria | 1172 |
| 170 | Ga0070703_10080915 | 3300005406 | Bacteria | 1106 |
| 171 | Ga0070714_100070954 | 3300005435 | Bacteria | 3011 |
| 172 | Ga0070714_100071156 | 3300005435 | Bacteria | 3007 |
| 173 | Ga0070714_100158133 | 3300005435 | Bacteria | 2048 |
| 174 | Ga0070713_100001639 | 3300005436 | Bacteria | 14365 |
| 175 | Ga0070713_100045084 | 3300005436 | Bacteria | 3611 |
| 176 | Ga0070713_100051803 | 3300005436 | Bacteria | 3396 |
| 177 | Ga0070710_10048246 | 3300005437 | Bacteria | 2378 |
| 178 | Ga0070701_10015406 | 3300005438 | Bacteria | 3530 |
| 179 | Ga0070701_10078065 | 3300005438 | Bacteria | 1786 |
| 180 | Ga0070711_100027185 | 3300005439 | Bacteria | 3754 |
| 181 | Ga0070705_100000278 | 3300005440 | Bacteria | 30604 |
| 182 | Ga0070705_100027619 | 3300005440 | Bacteria | 3101 |
| 183 | Ga0070700_100050934 | 3300005441 | Bacteria | 2576 |
| 184 | Ga0070700_100288273 | 3300005441 | Bacteria | 1193 |
| 185 | Ga0070708_100008135 | 3300005445 | Bacteria | 8410 |
| 186 | Ga0070663_100001469 | 3300005455 | Bacteria | 12964 |
| 187 | Ga0070663_100010345 | 3300005455 | Bacteria | 5815 |
| 188 | Ga0070663_100019991 | 3300005455 | Bacteria | 4424 |
| 189 | Ga0070663_100083587 | 3300005455 | Bacteria | 2351 |
| 190 | Ga0070663_100114868 | 3300005455 | Bacteria | 2027 |
| 191 | Ga0070678_100002532 | 3300005456 | Bacteria | 10018 |
| 192 | Ga0070678_100019947 | 3300005456 | Bacteria | 4387 |
| 193 | Ga0070678_100043700 | 3300005456 | Bacteria | 3194 |
| 194 | Ga0070678_100043774 | 3300005456 | Bacteria | 3192 |
| 195 | Ga0070678_100092086 | 3300005456 | Bacteria | 2328 |
| 196 | Ga0070662_100005207 | 3300005457 | Bacteria | 8298 |
| 197 | Ga0070662_100042067 | 3300005457 | Bacteria | 3262 |
| 198 | Ga0070662_100067285 | 3300005457 | Bacteria | 2630 |
| 199 | Ga0070662_100105738 | 3300005457 | Bacteria | 2137 |
| 200 | Ga0070662_100426214 | 3300005457 | Bacteria | 1098 |
| 201 | Ga0070681_10048741 | 3300005458 | Bacteria | 4232 |
| 202 | Ga0070681_10088290 | 3300005458 | Bacteria | 3052 |
| 203 | Ga0070681_10252343 | 3300005458 | Bacteria | 1676 |
| 204 | Ga0068867_100201114 | 3300005459 | Bacteria | 1595 |
| 205 | Ga0068867_100416876 | 3300005459 | Bacteria | 1136 |
| 206 | Ga0070685_10000035 | 3300005466 | Bacteria | 81433 |
| 207 | Ga0070685_10000657 | 3300005466 | Bacteria | 18906 |
| 208 | Ga0070685_10001172 | 3300005466 | Bacteria | 14028 |
| 209 | Ga0070706_100000099 | 3300005467 | Bacteria | 105782 |
| 210 | Ga0070706_100198822 | 3300005467 | Bacteria | 1872 |
| 211 | Ga0070706_100392642 | 3300005467 | Bacteria | 1291 |
| 212 | Ga0070707_100002214 | 3300005468 | Bacteria | 18546 |
| 213 | Ga0070707_100245113 | 3300005468 | Bacteria | 1744 |
| 214 | Ga0070698_100072846 | 3300005471 | Bacteria | 3442 |
| 215 | Ga0070699_100079247 | 3300005518 | Bacteria | 2861 |
| 216 | Ga0070699_100285563 | 3300005518 | Bacteria | 1478 |
| 217 | Ga0070699_100434818 | 3300005518 | Bacteria | 1189 |
| 218 | Ga0070679_100002575 | 3300005530 | Bacteria | 16471 |
| 219 | Ga0070679_100124967 | 3300005530 | Bacteria | 2555 |
| 220 | Ga0070684_100030135 | 3300005535 | Bacteria | 4608 |
| 221 | Ga0070684_100128207 | 3300005535 | Bacteria | 2287 |
| 222 | Ga0070697_100067912 | 3300005536 | Bacteria | 2917 |
| 223 | Ga0070697_100264684 | 3300005536 | Bacteria | 1473 |
| 224 | Ga0068853_100000208 | 3300005539 | Bacteria | 41514 |
| 225 | Ga0068853_100002117 | 3300005539 | Bacteria | 14743 |
| 226 | Ga0068853_100006289 | 3300005539 | Bacteria | 9417 |
| 227 | Ga0068853_100017942 | 3300005539 | Bacteria | 5848 |
| 228 | Ga0068853_100049630 | 3300005539 | Bacteria | 3607 |
| 229 | Ga0068853_100129047 | 3300005539 | Bacteria | 2261 |
| 230 | Ga0068853_100246922 | 3300005539 | Bacteria | 1637 |
| 231 | Ga0068853_100494924 | 3300005539 | Bacteria | 1154 |
| 232 | Ga0070672_100284056 | 3300005543 | Bacteria | 1400 |
| 233 | Ga0070686_100002031 | 3300005544 | Bacteria | 11223 |
| 234 | Ga0070686_100011604 | 3300005544 | Bacteria | 5003 |
| 235 | Ga0070695_100038331 | 3300005545 | Bacteria | 3024 |
| 236 | Ga0070696_100023647 | 3300005546 | Bacteria | 4177 |
| 237 | Ga0070693_100001786 | 3300005547 | Bacteria | 9798 |
| 238 | Ga0070693_100003714 | 3300005547 | Bacteria | 7140 |
| 239 | Ga0070693_100008954 | 3300005547 | Bacteria | 4966 |
| 240 | Ga0070693_100069111 | 3300005547 | Bacteria | 2075 |
| 241 | Ga0070693_100178477 | 3300005547 | Bacteria | 1366 |
| 242 | Ga0070665_100008420 | 3300005548 | Bacteria | 10434 |
| 243 | Ga0070665_100011217 | 3300005548 | Bacteria | 9061 |
| 244 | Ga0070665_100041022 | 3300005548 | Bacteria | 4651 |
| 245 | Ga0070665_100224656 | 3300005548 | Bacteria | 1878 |
| 246 | Ga0070665_100893809 | 3300005548 | Bacteria | 901 |
| 247 | Ga0070704_100139795 | 3300005549 | Bacteria | 1889 |
| 248 | Ga0070704_100637147 | 3300005549 | Bacteria | 940 |
| 249 | Ga0068855_100001112 | 3300005563 | Bacteria | 33452 |
| 250 | Ga0068855_100031910 | 3300005563 | Bacteria | 6288 |
| 251 | Ga0068855_100046378 | 3300005563 | Bacteria | 5138 |
| 252 | Ga0068855_100106520 | 3300005563 | Bacteria | 3222 |
| 253 | Ga0068855_100169572 | 3300005563 | Bacteria | 2472 |
| 254 | Ga0068855_100201083 | 3300005563 | Bacteria | 2243 |
| 255 | Ga0068855_100215511 | 3300005563 | Bacteria | 2155 |
| 256 | Ga0068855_100259113 | 3300005563 | Bacteria | 1938 |
| 257 | Ga0068855_100354717 | 3300005563 | Bacteria | 1615 |
| 258 | Ga0068855_100965212 | 3300005563 | Bacteria | 897 |
| 259 | Ga0070664_100004070 | 3300005564 | Bacteria | 11746 |
| 260 | Ga0070664_100004390 | 3300005564 | Bacteria | 11330 |
| 261 | Ga0070664_100007970 | 3300005564 | Bacteria | 8556 |
| 262 | Ga0070664_100015258 | 3300005564 | Bacteria | 6279 |
| 263 | Ga0070664_100040629 | 3300005564 | Bacteria | 3922 |
| 264 | Ga0070664_100056523 | 3300005564 | Bacteria | 3334 |
| 265 | Ga0070664_100299834 | 3300005564 | Bacteria | 1452 |
| 266 | Ga0068857_100001298 | 3300005577 | Bacteria | 19635 |
| 267 | Ga0068857_100042462 | 3300005577 | Bacteria | 4035 |
| 268 | Ga0068857_100062934 | 3300005577 | Bacteria | 3298 |
| 269 | Ga0068857_100064096 | 3300005577 | Bacteria | 3267 |
| 270 | Ga0068857_100113602 | 3300005577 | Bacteria | 2435 |
| 271 | Ga0068857_100166783 | 3300005577 | Bacteria | 2000 |
| 272 | Ga0068854_100000631 | 3300005578 | Bacteria | 20858 |
| 273 | Ga0068854_100003249 | 3300005578 | Bacteria | 10128 |
| 274 | Ga0068854_100005790 | 3300005578 | Bacteria | 7823 |
| 275 | Ga0068854_100020998 | 3300005578 | Bacteria | 4426 |
| 276 | Ga0068854_100048403 | 3300005578 | Bacteria | 3033 |
| 277 | Ga0068854_100097292 | 3300005578 | Bacteria | 2200 |
| 278 | Ga0068854_100537789 | 3300005578 | Bacteria | 989 |
| 279 | Ga0068854_100563536 | 3300005578 | Bacteria | 968 |
| 280 | Ga0068856_100009926 | 3300005614 | Bacteria | 9248 |
| 281 | Ga0068856_100033906 | 3300005614 | Bacteria | 4999 |
| 282 | Ga0068856_100146127 | 3300005614 | Bacteria | 2372 |
| 283 | Ga0068856_100174008 | 3300005614 | Bacteria | 2165 |
| 284 | Ga0068856_100196292 | 3300005614 | Bacteria | 2032 |
| 285 | Ga0068856_100555778 | 3300005614 | Bacteria | 1169 |
| 286 | Ga0070702_100003317 | 3300005615 | Bacteria | 7183 |
| 287 | Ga0070702_100063587 | 3300005615 | Bacteria | 2155 |
| 288 | Ga0070702_100087798 | 3300005615 | Bacteria | 1879 |
| 289 | Ga0070702_100099523 | 3300005615 | Bacteria | 1781 |
| 290 | Ga0070702_100260815 | 3300005615 | Bacteria | 1180 |
| 291 | Ga0068852_100006990 | 3300005616 | Bacteria | 8212 |
| 292 | Ga0068852_100029077 | 3300005616 | Bacteria | 4534 |
| 293 | Ga0068852_100057093 | 3300005616 | Bacteria | 3376 |
| 294 | Ga0068852_100078321 | 3300005616 | Bacteria | 2924 |
| 295 | Ga0068852_100508765 | 3300005616 | Bacteria | 1200 |
| 296 | Ga0068852_100674102 | 3300005616 | Bacteria | 1043 |
| 297 | Ga0068859_100004578 | 3300005617 | Bacteria | 14104 |
| 298 | Ga0068859_100005284 | 3300005617 | Bacteria | 13129 |
| 299 | Ga0068859_100015514 | 3300005617 | Bacteria | 7654 |
| 300 | Ga0068859_100023206 | 3300005617 | Bacteria | 6225 |
| 301 | Ga0068859_100034851 | 3300005617 | Bacteria | 5050 |
| 302 | Ga0068859_100036938 | 3300005617 | Bacteria | 4903 |
| 303 | Ga0068859_100037450 | 3300005617 | Bacteria | 4867 |
| 304 | Ga0068859_100168722 | 3300005617 | Bacteria | 2269 |
| 305 | Ga0068859_100169934 | 3300005617 | Bacteria | 2261 |
| 306 | Ga0068859_100575449 | 3300005617 | Bacteria | 1220 |
| 307 | Ga0068864_100000020 | 3300005618 | Bacteria | 263460 |
| 308 | Ga0068864_100001107 | 3300005618 | Bacteria | 22544 |
| 309 | Ga0068864_100003260 | 3300005618 | Bacteria | 13407 |
| 310 | Ga0068864_100006188 | 3300005618 | Bacteria | 9814 |
| 311 | Ga0068864_100081663 | 3300005618 | Bacteria | 2834 |
| 312 | Ga0068864_100315068 | 3300005618 | Bacteria | 1468 |
| 313 | Ga0068866_10000329 | 3300005718 | Bacteria | 22440 |
| 314 | Ga0068866_10009330 | 3300005718 | Bacteria | 4161 |
| 315 | Ga0068866_10078377 | 3300005718 | Bacteria | 1768 |
| 316 | Ga0068861_100001745 | 3300005719 | Bacteria | 13962 |
| 317 | Ga0068851_10002098 | 3300005834 | Bacteria | 8767 |
| 318 | Ga0068851_10124710 | 3300005834 | Bacteria | 1387 |
| 319 | Ga0068851_10136773 | 3300005834 | Bacteria | 1329 |
| 320 | Ga0068870_10000064 | 3300005840 | Bacteria | 33109 |
| 321 | Ga0068863_100000124 | 3300005841 | Bacteria | 80821 |
| 322 | Ga0068863_100000158 | 3300005841 | Bacteria | 71918 |
| 323 | Ga0068863_100002017 | 3300005841 | Bacteria | 20118 |
| 324 | Ga0068863_100005398 | 3300005841 | Bacteria | 12607 |
| 325 | Ga0068863_100018111 | 3300005841 | Bacteria | 6744 |
| 326 | Ga0068863_100084338 | 3300005841 | Bacteria | 3011 |
| 327 | Ga0068863_100090044 | 3300005841 | Bacteria | 2909 |
| 328 | Ga0068863_100106067 | 3300005841 | Bacteria | 2673 |
| 329 | Ga0068863_100189636 | 3300005841 | Bacteria | 1975 |
| 330 | Ga0068863_100510423 | 3300005841 | Bacteria | 1184 |
| 331 | Ga0068858_100000149 | 3300005842 | Bacteria | 73242 |
| 332 | Ga0068858_100001385 | 3300005842 | Bacteria | 24970 |
| 333 | Ga0068858_100017303 | 3300005842 | Bacteria | 6761 |
| 334 | Ga0068858_100020053 | 3300005842 | Bacteria | 6252 |
| 335 | Ga0068858_100021949 | 3300005842 | Bacteria | 5962 |
| 336 | Ga0068858_100027784 | 3300005842 | Bacteria | 5256 |
| 337 | Ga0068858_100057078 | 3300005842 | Bacteria | 3608 |
| 338 | Ga0068858_100124252 | 3300005842 | Bacteria | 2415 |
| 339 | Ga0068858_100290673 | 3300005842 | Bacteria | 1558 |
| 340 | Ga0068858_100360929 | 3300005842 | Bacteria | 1392 |
| 341 | Ga0068858_100599094 | 3300005842 | Bacteria | 1069 |
| 342 | Ga0068860_100000595 | 3300005843 | Bacteria | 43142 |
| 343 | Ga0068860_100000822 | 3300005843 | Bacteria | 34721 |
| 344 | Ga0068860_100002442 | 3300005843 | Bacteria | 19521 |
| 345 | Ga0068860_100012152 | 3300005843 | Bacteria | 8482 |
| 346 | Ga0068860_100014589 | 3300005843 | Bacteria | 7688 |
| 347 | Ga0068860_100015601 | 3300005843 | Bacteria | 7419 |
| 348 | Ga0068860_100024545 | 3300005843 | Bacteria | 5824 |
| 349 | Ga0068860_100674316 | 3300005843 | Bacteria | 1043 |
| 350 | Ga0068862_100000076 | 3300005844 | Bacteria | 117053 |
| 351 | Ga0068862_100001389 | 3300005844 | Bacteria | 22423 |
| 352 | Ga0068862_100005977 | 3300005844 | Bacteria | 10132 |
| 353 | Ga0068862_100048526 | 3300005844 | Bacteria | 3625 |
| 354 | Ga0081455_10004545 | 3300005937 | Bacteria | 15491 |
| 355 | Ga0081455_10025273 | 3300005937 | Bacteria | 5486 |
| 356 | Ga0081455_10143094 | 3300005937 | Bacteria | 1854 |
| 357 | Ga0081540_1000427 | 3300005983 | Bacteria | 41566 |
| 358 | Ga0081540_1002493 | 3300005983 | Bacteria | 14983 |
| 359 | Ga0081539_10001566 | 3300005985 | Bacteria | 37942 |
| 360 | Ga0081539_10007546 | 3300005985 | Bacteria | 9851 |
| 361 | Ga0070717_10010659 | 3300006028 | Bacteria | 6948 |
| 362 | Ga0075365_10165380 | 3300006038 | Bacteria | 1543 |
| 363 | Ga0075368_10095739 | 3300006042 | Bacteria | 1217 |
| 364 | Ga0075364_10039817 | 3300006051 | Bacteria | 3047 |
| 365 | Ga0075432_10108217 | 3300006058 | Bacteria | 1033 |
| 366 | Ga0070716_100165335 | 3300006173 | Bacteria | 1438 |
| 367 | Ga0070712_100017186 | 3300006175 | Bacteria | 4680 |
| 368 | Ga0070712_100188560 | 3300006175 | Bacteria | 1612 |
| 369 | Ga0075362_10000561 | 3300006177 | Bacteria | 10840 |
| 370 | Ga0075362_10097862 | 3300006177 | Bacteria | 1369 |
| 371 | Ga0075366_10175374 | 3300006195 | Bacteria | 1301 |
| 372 | Ga0097621_100003928 | 3300006237 | Bacteria | 10297 |
| 373 | Ga0097621_100030727 | 3300006237 | Bacteria | 4256 |
| 374 | Ga0097621_100058699 | 3300006237 | Bacteria | 3148 |
| 375 | Ga0097621_100150918 | 3300006237 | Bacteria | 1993 |
| 376 | Ga0068871_100017442 | 3300006358 | Bacteria | 5434 |
| 377 | Ga0068871_100050328 | 3300006358 | Bacteria | 3370 |
| 378 | Ga0068871_100307144 | 3300006358 | Bacteria | 1394 |
| 379 | Ga0068871_100430844 | 3300006358 | Bacteria | 1179 |
| 380 | Ga0068871_100599825 | 3300006358 | Bacteria | 1001 |
| 381 | Ga0075428_100056037 | 3300006844 | Bacteria | 4318 |
| 382 | Ga0075431_100025533 | 3300006847 | Bacteria | 6057 |
| 383 | Ga0075433_10002066 | 3300006852 | Bacteria | 15176 |
| 384 | Ga0075434_100250202 | 3300006871 | Bacteria | 1791 |
| 385 | Ga0075429_100318394 | 3300006880 | Bacteria | 1361 |
| 386 | Ga0068865_100000156 | 3300006881 | Bacteria | 37229 |
| 387 | Ga0068865_100020079 | 3300006881 | Bacteria | 4332 |
| 388 | Ga0068865_100307182 | 3300006881 | Bacteria | 1271 |
| 389 | Ga0068865_100378074 | 3300006881 | Bacteria | 1154 |
| 390 | Ga0068865_100477208 | 3300006881 | Bacteria | 1036 |
| 391 | Ga0075436_100123709 | 3300006914 | Bacteria | 1811 |
| 392 | Ga0075436_100151751 | 3300006914 | Bacteria | 1631 |
| 393 | Ga0097620_100004578 | 3300006931 | Bacteria | 14104 |
| 394 | Ga0097620_100005284 | 3300006931 | Bacteria | 13129 |
| 395 | Ga0097620_100015515 | 3300006931 | Bacteria | 7654 |
| 396 | Ga0097620_100023205 | 3300006931 | Bacteria | 6225 |
| 397 | Ga0097620_100034851 | 3300006931 | Bacteria | 5050 |
| 398 | Ga0097620_100036943 | 3300006931 | Bacteria | 4903 |
| 399 | Ga0097620_100037450 | 3300006931 | Bacteria | 4867 |
| 400 | Ga0097620_100168722 | 3300006931 | Bacteria | 2269 |
| 401 | Ga0097620_100169948 | 3300006931 | Bacteria | 2261 |
| 402 | Ga0097620_100219185 | 3300006931 | Bacteria | 1990 |
| 403 | Ga0097620_100575330 | 3300006931 | Bacteria | 1220 |
| 404 | Ga0099794_10084111 | 3300007265 | Bacteria | 1573 |
| 405 | Ga0105251_10051665 | 3300009011 | Bacteria | 1959 |
| 406 | Ga0105240_10008057 | 3300009093 | Bacteria | 15158 |
| 407 | Ga0105240_10009257 | 3300009093 | Bacteria | 13968 |
| 408 | Ga0105240_10025571 | 3300009093 | Bacteria | 7754 |
| 409 | Ga0105240_10033209 | 3300009093 | Bacteria | 6670 |
| 410 | Ga0105240_10046532 | 3300009093 | Bacteria | 5497 |
| 411 | Ga0105240_10081467 | 3300009093 | Bacteria | 3977 |
| 412 | Ga0105240_10203320 | 3300009093 | Bacteria | 2320 |
| 413 | Ga0105240_10657937 | 3300009093 | Bacteria | 1147 |
| 414 | Ga0111539_10011533 | 3300009094 | Bacteria | 11090 |
| 415 | Ga0111539_10975374 | 3300009094 | Bacteria | 985 |
| 416 | Ga0111539_11087882 | 3300009094 | Bacteria | 929 |
| 417 | Ga0105245_10000426 | 3300009098 | Bacteria | 39349 |
| 418 | Ga0105245_10006948 | 3300009098 | Bacteria | 9924 |
| 419 | Ga0105245_10031246 | 3300009098 | Bacteria | 4711 |
| 420 | Ga0105245_10121273 | 3300009098 | Bacteria | 2443 |
| 421 | Ga0105245_10159162 | 3300009098 | Bacteria | 2141 |
| 422 | Ga0105245_10192878 | 3300009098 | Bacteria | 1952 |
| 423 | Ga0105245_10198731 | 3300009098 | Bacteria | 1924 |
| 424 | Ga0105247_10003007 | 3300009101 | Bacteria | 11171 |
| 425 | Ga0105247_10016993 | 3300009101 | Bacteria | 4365 |
| 426 | Ga0105247_10091599 | 3300009101 | Bacteria | 1931 |
| 427 | Ga0105247_10453021 | 3300009101 | Bacteria | 925 |
| 428 | Ga0114129_10209601 | 3300009147 | Bacteria | 2635 |
| 429 | Ga0114129_10434991 | 3300009147 | Bacteria | 1723 |
| 430 | Ga0105243_10001511 | 3300009148 | Bacteria | 20313 |
| 431 | Ga0105243_10002592 | 3300009148 | Bacteria | 15081 |
| 432 | Ga0105243_10031015 | 3300009148 | Bacteria | 4120 |
| 433 | Ga0105243_10121472 | 3300009148 | Bacteria | 2203 |
| 434 | Ga0105243_10136646 | 3300009148 | Bacteria | 2086 |
| 435 | Ga0105243_10253318 | 3300009148 | Bacteria | 1573 |
| 436 | Ga0105243_10631189 | 3300009148 | Bacteria | 1036 |
| 437 | Ga0105241_10001288 | 3300009174 | Bacteria | 19136 |
| 438 | Ga0105241_10002134 | 3300009174 | Bacteria | 14955 |
| 439 | Ga0105241_10005667 | 3300009174 | Bacteria | 9214 |
| 440 | Ga0105241_10124958 | 3300009174 | Bacteria | 2076 |
| 441 | Ga0105241_10156844 | 3300009174 | Bacteria | 1867 |
| 442 | Ga0105241_10492730 | 3300009174 | Bacteria | 1091 |
| 443 | Ga0105242_10022105 | 3300009176 | Bacteria | 4998 |
| 444 | Ga0105242_10234054 | 3300009176 | Bacteria | 1648 |
| 445 | Ga0105242_10243646 | 3300009176 | Bacteria | 1617 |
| 446 | Ga0105242_10250334 | 3300009176 | Bacteria | 1596 |
| 447 | Ga0105242_10497334 | 3300009176 | Bacteria | 1159 |
| 448 | Ga0105248_10001654 | 3300009177 | Bacteria | 24795 |
| 449 | Ga0105248_10018646 | 3300009177 | Bacteria | 7672 |
| 450 | Ga0105248_10078430 | 3300009177 | Bacteria | 3712 |
| 451 | Ga0105248_10080447 | 3300009177 | Bacteria | 3662 |
| 452 | Ga0105248_10356291 | 3300009177 | Bacteria | 1647 |
| 453 | Ga0105248_10726277 | 3300009177 | Bacteria | 1121 |
| 454 | Ga0105237_10000846 | 3300009545 | Bacteria | 41712 |
| 455 | Ga0105237_10005975 | 3300009545 | Bacteria | 13636 |
| 456 | Ga0105237_10017079 | 3300009545 | Bacteria | 7529 |
| 457 | Ga0105237_10045629 | 3300009545 | Bacteria | 4409 |
| 458 | Ga0105237_10060141 | 3300009545 | Bacteria | 3801 |
| 459 | Ga0105237_10116221 | 3300009545 | Bacteria | 2668 |
| 460 | Ga0105237_10182470 | 3300009545 | Bacteria | 2098 |
| 461 | Ga0105237_10385201 | 3300009545 | Bacteria | 1407 |
| 462 | Ga0105237_10485789 | 3300009545 | Bacteria | 1241 |
| 463 | Ga0105238_10000315 | 3300009551 | Bacteria | 52804 |
| 464 | Ga0105238_10000738 | 3300009551 | Bacteria | 34144 |
| 465 | Ga0105238_10000970 | 3300009551 | Bacteria | 29353 |
| 466 | Ga0105238_10001651 | 3300009551 | Bacteria | 22387 |
| 467 | Ga0105238_10007091 | 3300009551 | Bacteria | 11215 |
| 468 | Ga0105238_10055112 | 3300009551 | Bacteria | 3991 |
| 469 | Ga0105238_10058971 | 3300009551 | Bacteria | 3846 |
| 470 | Ga0105238_10059574 | 3300009551 | Bacteria | 3824 |
| 471 | Ga0105238_10204236 | 3300009551 | Bacteria | 1952 |
| 472 | Ga0105249_10001740 | 3300009553 | Bacteria | 19004 |
| 473 | Ga0105249_10008085 | 3300009553 | Bacteria | 9169 |
| 474 | Ga0105249_10025022 | 3300009553 | Bacteria | 5371 |
| 475 | Ga0105249_10026131 | 3300009553 | Bacteria | 5258 |
| 476 | Ga0105249_10828253 | 3300009553 | Bacteria | 990 |
| 477 | Ga0105239_10003874 | 3300010375 | Bacteria | 18150 |
| 478 | Ga0105239_10012419 | 3300010375 | Bacteria | 9485 |
| 479 | Ga0105239_10023370 | 3300010375 | Bacteria | 6807 |
| 480 | Ga0105239_10033029 | 3300010375 | Bacteria | 5683 |
| 481 | Ga0105239_10071697 | 3300010375 | Bacteria | 3806 |
| 482 | Ga0105239_10098427 | 3300010375 | Bacteria | 3233 |
| 483 | Ga0105239_10135092 | 3300010375 | Bacteria | 2746 |
| 484 | Ga0105239_10252927 | 3300010375 | Bacteria | 1979 |
| 485 | Ga0105239_10266586 | 3300010375 | Bacteria | 1926 |
| 486 | Ga0105239_10326532 | 3300010375 | Bacteria | 1731 |
| 487 | Ga0105239_10447165 | 3300010375 | Bacteria | 1466 |
| 488 | Ga0105239_10695697 | 3300010375 | Bacteria | 1162 |
| 489 | Ga0105246_10184458 | 3300011119 | Bacteria | 1610 |
| 490 | Ga0105246_10350127 | 3300011119 | Bacteria | 1210 |
| 491 | Ga0105246_10411453 | 3300011119 | Bacteria | 1126 |
| 492 | Ga0157327_1005580 | 3300012512 | Bacteria | 1026 |
| 493 | Ga0157373_10003695 | 3300013100 | Bacteria | 11579 |
| 494 | Ga0157373_10009307 | 3300013100 | Bacteria | 7263 |
| 495 | Ga0157371_10000290 | 3300013102 | Bacteria | 67914 |
| 496 | Ga0157371_10021286 | 3300013102 | Bacteria | 4762 |
| 497 | Ga0157371_10026749 | 3300013102 | Bacteria | 4190 |
| 498 | Ga0157371_10066081 | 3300013102 | Bacteria | 2561 |
| 499 | Ga0157371_10281668 | 3300013102 | Bacteria | 1201 |
| 500 | Ga0157370_10024107 | 3300013104 | Bacteria | 6031 |
| 501 | Ga0157370_10034755 | 3300013104 | Bacteria | 4904 |
| 502 | Ga0157370_10038592 | 3300013104 | Bacteria | 4620 |
| 503 | Ga0157370_10051023 | 3300013104 | Bacteria | 3953 |
| 504 | Ga0157370_10053167 | 3300013104 | Bacteria | 3863 |
| 505 | Ga0157369_10004891 | 3300013105 | Bacteria | 15715 |
| 506 | Ga0157369_10025478 | 3300013105 | Bacteria | 6567 |
| 507 | Ga0157369_10055121 | 3300013105 | Bacteria | 4291 |
| 508 | Ga0157369_10073706 | 3300013105 | Bacteria | 3662 |
| 509 | Ga0157369_10174535 | 3300013105 | Bacteria | 2263 |
| 510 | Ga0157369_10642752 | 3300013105 | Bacteria | 1094 |
| 511 | Ga0157374_10034837 | 3300013296 | Bacteria | 4602 |
| 512 | Ga0157374_10043797 | 3300013296 | Bacteria | 4136 |
| 513 | Ga0157374_10145194 | 3300013296 | Bacteria | 2305 |
| 514 | Ga0157374_10246213 | 3300013296 | Bacteria | 1758 |
| 515 | Ga0157378_10000005 | 3300013297 | Bacteria | 197893 |
| 516 | Ga0157378_10004739 | 3300013297 | Bacteria | 11919 |
| 517 | Ga0157378_10033327 | 3300013297 | Bacteria | 4553 |
| 518 | Ga0157378_10051328 | 3300013297 | Bacteria | 3670 |
| 519 | Ga0157378_10052920 | 3300013297 | Bacteria | 3613 |
| 520 | Ga0157378_10235164 | 3300013297 | Bacteria | 1748 |
| 521 | Ga0157378_10760789 | 3300013297 | Bacteria | 992 |
| 522 | Ga0163162_10000673 | 3300013306 | Bacteria | 31751 |
| 523 | Ga0163162_10001215 | 3300013306 | Bacteria | 24072 |
| 524 | Ga0163162_10020730 | 3300013306 | Bacteria | 6461 |
| 525 | Ga0163162_10066191 | 3300013306 | Bacteria | 3662 |
| 526 | Ga0163162_10081725 | 3300013306 | Bacteria | 3302 |
| 527 | Ga0163162_10102951 | 3300013306 | Bacteria | 2949 |
| 528 | Ga0163162_10109449 | 3300013306 | Bacteria | 2860 |
| 529 | Ga0163162_10526200 | 3300013306 | Bacteria | 1312 |
| 530 | Ga0157372_10000417 | 3300013307 | Bacteria | 46710 |
| 531 | Ga0157372_10072947 | 3300013307 | Bacteria | 3868 |
| 532 | Ga0157372_10115555 | 3300013307 | Bacteria | 3076 |
| 533 | Ga0157372_10117118 | 3300013307 | Bacteria | 3055 |
| 534 | Ga0157372_10139434 | 3300013307 | Bacteria | 2793 |
| 535 | Ga0157372_10205175 | 3300013307 | Bacteria | 2284 |
| 536 | Ga0157372_10493075 | 3300013307 | Bacteria | 1428 |
| 537 | Ga0157372_10528095 | 3300013307 | Bacteria | 1376 |
| 538 | Ga0157372_10703453 | 3300013307 | Bacteria | 1176 |
| 539 | Ga0157372_10986455 | 3300013307 | Bacteria | 976 |
| 540 | Ga0157375_10109937 | 3300013308 | Bacteria | 2853 |
| 541 | Ga0157375_10574579 | 3300013308 | Bacteria | 1288 |
| 542 | Ga0163163_10000358 | 3300014325 | Bacteria | 43838 |
| 543 | Ga0163163_10001487 | 3300014325 | Bacteria | 19846 |
| 544 | Ga0163163_10009750 | 3300014325 | Bacteria | 8600 |
| 545 | Ga0163163_10046355 | 3300014325 | Bacteria | 4271 |
| 546 | Ga0157380_10009680 | 3300014326 | Bacteria | 6910 |
| 547 | Ga0157380_10052493 | 3300014326 | Bacteria | 3229 |
| 548 | Ga0157380_10190059 | 3300014326 | Bacteria | 1812 |
| 549 | Ga0182008_10040838 | 3300014497 | Bacteria | 2315 |
| 550 | Ga0182008_10090525 | 3300014497 | Bacteria | 1508 |
| 551 | Ga0182008_10253313 | 3300014497 | Bacteria | 909 |
| 552 | Ga0157377_10002948 | 3300014745 | Bacteria | 7610 |
| 553 | Ga0157377_10004717 | 3300014745 | Bacteria | 6313 |
| 554 | Ga0157377_10018176 | 3300014745 | Bacteria | 3652 |
| 555 | Ga0157377_10176438 | 3300014745 | Bacteria | 1340 |
| 556 | Ga0157379_10000219 | 3300014968 | Bacteria | 44603 |
| 557 | Ga0157379_10001710 | 3300014968 | Bacteria | 18170 |
| 558 | Ga0157379_10028114 | 3300014968 | Bacteria | 5005 |
| 559 | Ga0157379_10190898 | 3300014968 | Bacteria | 1851 |
| 560 | Ga0157379_10284767 | 3300014968 | Bacteria | 1504 |
| 561 | Ga0157379_10392262 | 3300014968 | Bacteria | 1275 |
| 562 | Ga0157376_10005857 | 3300014969 | Bacteria | 8620 |
| 563 | Ga0157376_10019920 | 3300014969 | Bacteria | 5180 |
| 564 | Ga0157376_10027680 | 3300014969 | Bacteria | 4497 |
| 565 | Ga0157376_10092402 | 3300014969 | Bacteria | 2623 |
| 566 | Ga0157376_10501089 | 3300014969 | Bacteria | 1193 |
| 567 | Ga0182006_1002125 | 3300015261 | Bacteria | 11043 |
| 568 | Ga0182006_1114020 | 3300015261 | Bacteria | 946 |
| 569 | Ga0182007_10004010 | 3300015262 | Bacteria | 6794 |
| 570 | Ga0182007_10009816 | 3300015262 | Bacteria | 3822 |
| 571 | Ga0182007_10014265 | 3300015262 | Bacteria | 3003 |
| 572 | Ga0182005_1001650 | 3300015265 | Bacteria | 8674 |
| 573 | Ga0163161_10013133 | 3300017792 | Bacteria | 5756 |
| 574 | Ga0163161_10179432 | 3300017792 | Bacteria | 1623 |
| 575 | Ga0163161_10428626 | 3300017792 | Bacteria | 1065 |
| 576 | Ga0206356_11636764 | 3300020070 | Bacteria | 2604 |
| 577 | Ga0206353_10673777 | 3300020082 | Bacteria | 2014 |
| 578 | Ga0154015_1664260 | 3300020610 | Bacteria | 1660 |
| 579 | Ga0213872_10002518 | 3300021361 | Bacteria | 10700 |
| 580 | Ga0213872_10005752 | 3300021361 | Bacteria | 6307 |
| 581 | Ga0228598_1001753 | 3300024227 | Bacteria | 4748 |
| 582 | Ga0209435_100015 | 3300025206 | Bacteria | 321177 |
| 583 | Ga0209435_100288 | 3300025206 | Bacteria | 12225 |
| 584 | Ga0209760_101484 | 3300025207 | Bacteria | 2458 |
| 585 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 586 | Ga0209784_100005 | 3300025224 | Bacteria | 1040422 |
| 587 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 588 | Ga0209566_100005 | 3300025225 | Bacteria | 1040422 |
| 589 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 590 | Ga0209674_100009 | 3300025226 | Bacteria | 1040422 |
| 591 | Ga0209674_100249 | 3300025226 | Bacteria | 45253 |
| 592 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 593 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 594 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 595 | Ga0209563_100012 | 3300025230 | Bacteria | 1040422 |
| 596 | Ga0207427_100149 | 3300025231 | Bacteria | 78920 |
| 597 | Ga0207427_100485 | 3300025231 | Bacteria | 21493 |
| 598 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 599 | Ga0209437_100623 | 3300025233 | Bacteria | 21500 |
| 600 | Ga0209437_101358 | 3300025233 | Bacteria | 6327 |
| 601 | Ga0209437_102147 | 3300025233 | Bacteria | 3963 |
| 602 | Ga0209258_100298 | 3300025242 | Bacteria | 81047 |
| 603 | Ga0209258_100391 | 3300025242 | Bacteria | 55848 |
| 604 | Ga0209646_1000040 | 3300025246 | Bacteria | 347867 |
| 605 | Ga0209646_1000105 | 3300025246 | Bacteria | 163453 |
| 606 | Ga0209026_1000034 | 3300025250 | Bacteria | 306953 |
| 607 | Ga0209026_1002619 | 3300025250 | Bacteria | 6572 |
| 608 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 609 | Ga0209677_100006 | 3300025253 | Bacteria | 1040422 |
| 610 | Ga0209677_102934 | 3300025253 | Bacteria | 5961 |
| 611 | Ga0209759_1000234 | 3300025256 | Bacteria | 83099 |
| 612 | Ga0209759_1000569 | 3300025256 | Bacteria | 37040 |
| 613 | Ga0209759_1003262 | 3300025256 | Bacteria | 6556 |
| 614 | Ga0209759_1009116 | 3300025256 | Bacteria | 3031 |
| 615 | Ga0209129_1003748 | 3300025258 | Bacteria | 6418 |
| 616 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 617 | Ga0209233_1000046 | 3300025261 | Bacteria | 470971 |
| 618 | Ga0209455_1024715 | 3300025272 | Bacteria | 1105 |
| 619 | Ga0209676_1000214 | 3300025292 | Bacteria | 127818 |
| 620 | Ga0209676_1001207 | 3300025292 | Bacteria | 27585 |
| 621 | Ga0209676_1001472 | 3300025292 | Bacteria | 21882 |
| 622 | Ga0209025_1000217 | 3300025294 | Bacteria | 137909 |
| 623 | Ga0209564_1000518 | 3300025295 | Bacteria | 63204 |
| 624 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 625 | Ga0209758_1000246 | 3300025297 | Bacteria | 111041 |
| 626 | Ga0209758_1025772 | 3300025297 | Bacteria | 2568 |
| 627 | Ga0209050_1000412 | 3300025298 | Bacteria | 79647 |
| 628 | Ga0209050_1016288 | 3300025298 | Bacteria | 3053 |
| 629 | Ga0209050_1021718 | 3300025298 | Bacteria | 2330 |
| 630 | Ga0209051_1000150 | 3300025303 | Bacteria | 132005 |
| 631 | Ga0209051_1001731 | 3300025303 | Bacteria | 17386 |
| 632 | Ga0209257_1000275 | 3300025304 | Bacteria | 116952 |
| 633 | Ga0209257_1027391 | 3300025304 | Bacteria | 1898 |
| 634 | Ga0207656_10078311 | 3300025321 | Bacteria | 1481 |
| 635 | Ga0207656_10137601 | 3300025321 | Bacteria | 1149 |
| 636 | Ga0207713_1058962 | 3300025735 | Bacteria | 1475 |
| 637 | Ga0207682_10000195 | 3300025893 | Bacteria | 27484 |
| 638 | Ga0207692_10155699 | 3300025898 | Bacteria | 1312 |
| 639 | Ga0207642_10002118 | 3300025899 | Bacteria | 6140 |
| 640 | Ga0207642_10003463 | 3300025899 | Bacteria | 4983 |
| 641 | Ga0207710_10013630 | 3300025900 | Bacteria | 3420 |
| 642 | Ga0207710_10021487 | 3300025900 | Bacteria | 2766 |
| 643 | Ga0207710_10078286 | 3300025900 | Bacteria | 1529 |
| 644 | Ga0207688_10000941 | 3300025901 | Bacteria | 14730 |
| 645 | Ga0207688_10008007 | 3300025901 | Bacteria | 5751 |
| 646 | Ga0207688_10041064 | 3300025901 | Bacteria | 2572 |
| 647 | Ga0207688_10067336 | 3300025901 | Bacteria | 2026 |
| 648 | Ga0207680_10000139 | 3300025903 | Bacteria | 34616 |
| 649 | Ga0207680_10012162 | 3300025903 | Bacteria | 4377 |
| 650 | Ga0207680_10030483 | 3300025903 | Bacteria | 3042 |
| 651 | Ga0207680_10052954 | 3300025903 | Bacteria | 2434 |
| 652 | Ga0207680_10135755 | 3300025903 | Bacteria | 1626 |
| 653 | Ga0207680_10325307 | 3300025903 | Bacteria | 1076 |
| 654 | Ga0207647_10001601 | 3300025904 | Bacteria | 17389 |
| 655 | Ga0207647_10006149 | 3300025904 | Bacteria | 8742 |
| 656 | Ga0207647_10018431 | 3300025904 | Bacteria | 4720 |
| 657 | Ga0207647_10026218 | 3300025904 | Bacteria | 3816 |
| 658 | Ga0207647_10193919 | 3300025904 | Bacteria | 1177 |
| 659 | Ga0207685_10016666 | 3300025905 | Bacteria | 2357 |
| 660 | Ga0207645_10001126 | 3300025907 | Bacteria | 22114 |
| 661 | Ga0207645_10054434 | 3300025907 | Bacteria | 2555 |
| 662 | Ga0207645_10104429 | 3300025907 | Bacteria | 1830 |
| 663 | Ga0207645_10321824 | 3300025907 | Bacteria | 1032 |
| 664 | Ga0207643_10000016 | 3300025908 | Bacteria | 121792 |
| 665 | Ga0207643_10161337 | 3300025908 | Bacteria | 1349 |
| 666 | Ga0207705_10000103 | 3300025909 | Bacteria | 97511 |
| 667 | Ga0207705_10018494 | 3300025909 | Bacteria | 4982 |
| 668 | Ga0207705_10073161 | 3300025909 | Bacteria | 2486 |
| 669 | Ga0207705_10143497 | 3300025909 | Bacteria | 1785 |
| 670 | Ga0207705_10220347 | 3300025909 | Bacteria | 1441 |
| 671 | Ga0207705_10223869 | 3300025909 | Bacteria | 1430 |
| 672 | Ga0207684_10000047 | 3300025910 | Bacteria | 244386 |
| 673 | Ga0207684_10089073 | 3300025910 | Bacteria | 2629 |
| 674 | Ga0207684_10099982 | 3300025910 | Bacteria | 2478 |
| 675 | Ga0207684_10249305 | 3300025910 | Bacteria | 1532 |
| 676 | Ga0207654_10000465 | 3300025911 | Bacteria | 23187 |
| 677 | Ga0207654_10052584 | 3300025911 | Bacteria | 2348 |
| 678 | Ga0207654_10060903 | 3300025911 | Bacteria | 2207 |
| 679 | Ga0207654_10266698 | 3300025911 | Bacteria | 1153 |
| 680 | Ga0207654_10283850 | 3300025911 | Bacteria | 1121 |
| 681 | Ga0207707_10068750 | 3300025912 | Bacteria | 3087 |
| 682 | Ga0207707_10095782 | 3300025912 | Bacteria | 2594 |
| 683 | Ga0207707_10133932 | 3300025912 | Bacteria | 2167 |
| 684 | Ga0207707_10179584 | 3300025912 | Bacteria | 1848 |
| 685 | Ga0207695_10000573 | 3300025913 | Bacteria | 75332 |
| 686 | Ga0207695_10000692 | 3300025913 | Bacteria | 66089 |
| 687 | Ga0207695_10008225 | 3300025913 | Bacteria | 13100 |
| 688 | Ga0207695_10011367 | 3300025913 | Bacteria | 10790 |
| 689 | Ga0207695_10023120 | 3300025913 | Bacteria | 7035 |
| 690 | Ga0207695_10029200 | 3300025913 | Bacteria | 6099 |
| 691 | Ga0207695_10049343 | 3300025913 | Bacteria | 4439 |
| 692 | Ga0207695_10133319 | 3300025913 | Bacteria | 2440 |
| 693 | Ga0207695_10207643 | 3300025913 | Bacteria | 1871 |
| 694 | Ga0207695_10323282 | 3300025913 | Bacteria | 1432 |
| 695 | Ga0207671_10004004 | 3300025914 | Bacteria | 14314 |
| 696 | Ga0207671_10004486 | 3300025914 | Bacteria | 13303 |
| 697 | Ga0207671_10008804 | 3300025914 | Bacteria | 8500 |
| 698 | Ga0207671_10030356 | 3300025914 | Bacteria | 4031 |
| 699 | Ga0207671_10185971 | 3300025914 | Bacteria | 1618 |
| 700 | Ga0207671_10264815 | 3300025914 | Bacteria | 1353 |
| 701 | Ga0207671_10452994 | 3300025914 | Bacteria | 1022 |
| 702 | Ga0207693_10000589 | 3300025915 | Bacteria | 32554 |
| 703 | Ga0207693_10072584 | 3300025915 | Bacteria | 2694 |
| 704 | Ga0207663_10016219 | 3300025916 | Bacteria | 4125 |
| 705 | Ga0207660_10021224 | 3300025917 | Bacteria | 4366 |
| 706 | Ga0207660_10522756 | 3300025917 | Bacteria | 964 |
| 707 | Ga0207662_10000003 | 3300025918 | Bacteria | 148717 |
| 708 | Ga0207662_10019928 | 3300025918 | Bacteria | 3822 |
| 709 | Ga0207657_10000009 | 3300025919 | Bacteria | 187503 |
| 710 | Ga0207657_10002371 | 3300025919 | Bacteria | 20373 |
| 711 | Ga0207657_10003372 | 3300025919 | Bacteria | 17076 |
| 712 | Ga0207657_10053293 | 3300025919 | Bacteria | 3505 |
| 713 | Ga0207657_10099027 | 3300025919 | Bacteria | 2422 |
| 714 | Ga0207657_10144866 | 3300025919 | Bacteria | 1938 |
| 715 | Ga0207649_10000275 | 3300025920 | Bacteria | 40550 |
| 716 | Ga0207649_10003334 | 3300025920 | Bacteria | 8787 |
| 717 | Ga0207649_10010372 | 3300025920 | Bacteria | 5117 |
| 718 | Ga0207649_10059933 | 3300025920 | Bacteria | 2390 |
| 719 | Ga0207652_10057060 | 3300025921 | Bacteria | 3362 |
| 720 | Ga0207652_10063748 | 3300025921 | Bacteria | 3188 |
| 721 | Ga0207646_10035640 | 3300025922 | Bacteria | 4493 |
| 722 | Ga0207681_10000362 | 3300025923 | Bacteria | 32331 |
| 723 | Ga0207681_10004343 | 3300025923 | Bacteria | 8747 |
| 724 | Ga0207681_10042876 | 3300025923 | Bacteria | 3025 |
| 725 | Ga0207681_10076669 | 3300025923 | Bacteria | 2348 |
| 726 | Ga0207681_10140936 | 3300025923 | Bacteria | 1795 |
| 727 | Ga0207681_10178151 | 3300025923 | Bacteria | 1617 |
| 728 | Ga0207694_10000128 | 3300025924 | Bacteria | 78863 |
| 729 | Ga0207694_10000505 | 3300025924 | Bacteria | 35291 |
| 730 | Ga0207694_10006279 | 3300025924 | Bacteria | 9075 |
| 731 | Ga0207694_10007293 | 3300025924 | Bacteria | 8389 |
| 732 | Ga0207694_10023433 | 3300025924 | Bacteria | 4685 |
| 733 | Ga0207694_10024178 | 3300025924 | Bacteria | 4613 |
| 734 | Ga0207694_10028217 | 3300025924 | Bacteria | 4279 |
| 735 | Ga0207694_10520965 | 3300025924 | Bacteria | 996 |
| 736 | Ga0207650_10000025 | 3300025925 | Bacteria | 265351 |
| 737 | Ga0207650_10000692 | 3300025925 | Bacteria | 26357 |
| 738 | Ga0207650_10021626 | 3300025925 | Bacteria | 4545 |
| 739 | Ga0207650_10022454 | 3300025925 | Bacteria | 4466 |
| 740 | Ga0207650_10125334 | 3300025925 | Bacteria | 2004 |
| 741 | Ga0207650_10268968 | 3300025925 | Bacteria | 1385 |
| 742 | Ga0207659_10002164 | 3300025926 | Bacteria | 11667 |
| 743 | Ga0207659_10124115 | 3300025926 | Bacteria | 1983 |
| 744 | Ga0207659_10266995 | 3300025926 | Bacteria | 1395 |
| 745 | Ga0207687_10000184 | 3300025927 | Bacteria | 41508 |
| 746 | Ga0207687_10001005 | 3300025927 | Bacteria | 19137 |
| 747 | Ga0207687_10014501 | 3300025927 | Bacteria | 5158 |
| 748 | Ga0207687_10030914 | 3300025927 | Bacteria | 3615 |
| 749 | Ga0207687_10035875 | 3300025927 | Bacteria | 3376 |
| 750 | Ga0207687_10421197 | 3300025927 | Bacteria | 1102 |
| 751 | Ga0207687_10629811 | 3300025927 | Bacteria | 906 |
| 752 | Ga0207700_10042359 | 3300025928 | Bacteria | 3337 |
| 753 | Ga0207700_10052903 | 3300025928 | Bacteria | 3039 |
| 754 | Ga0207644_10000063 | 3300025931 | Bacteria | 78017 |
| 755 | Ga0207644_10000394 | 3300025931 | Bacteria | 28414 |
| 756 | Ga0207644_10011338 | 3300025931 | Bacteria | 5895 |
| 757 | Ga0207644_10020788 | 3300025931 | Bacteria | 4464 |
| 758 | Ga0207644_10032906 | 3300025931 | Bacteria | 3620 |
| 759 | Ga0207690_10002703 | 3300025932 | Bacteria | 10701 |
| 760 | Ga0207690_10019874 | 3300025932 | Bacteria | 4140 |
| 761 | Ga0207690_10057867 | 3300025932 | Bacteria | 2620 |
| 762 | Ga0207706_10000283 | 3300025933 | Bacteria | 55425 |
| 763 | Ga0207706_10006684 | 3300025933 | Bacteria | 10666 |
| 764 | Ga0207706_10077774 | 3300025933 | Bacteria | 2918 |
| 765 | Ga0207706_10085325 | 3300025933 | Bacteria | 2776 |
| 766 | Ga0207706_10615217 | 3300025933 | Bacteria | 932 |
| 767 | Ga0207686_10001013 | 3300025934 | Bacteria | 16644 |
| 768 | Ga0207686_10004410 | 3300025934 | Bacteria | 7551 |
| 769 | Ga0207686_10046620 | 3300025934 | Bacteria | 2675 |
| 770 | Ga0207709_10000708 | 3300025935 | Bacteria | 26838 |
| 771 | Ga0207709_10004486 | 3300025935 | Bacteria | 8057 |
| 772 | Ga0207709_10071277 | 3300025935 | Bacteria | 2206 |
| 773 | Ga0207709_10084664 | 3300025935 | Bacteria | 2053 |
| 774 | Ga0207709_10453607 | 3300025935 | Bacteria | 992 |
| 775 | Ga0207670_10000805 | 3300025936 | Bacteria | 16356 |
| 776 | Ga0207670_10030039 | 3300025936 | Bacteria | 3469 |
| 777 | Ga0207669_10000292 | 3300025937 | Bacteria | 22979 |
| 778 | Ga0207669_10000331 | 3300025937 | Bacteria | 21620 |
| 779 | Ga0207669_10125716 | 3300025937 | Bacteria | 1751 |
| 780 | Ga0207669_10150555 | 3300025937 | Bacteria | 1629 |
| 781 | Ga0207704_10000761 | 3300025938 | Bacteria | 14186 |
| 782 | Ga0207704_10015537 | 3300025938 | Bacteria | 3882 |
| 783 | Ga0207704_10183674 | 3300025938 | Bacteria | 1514 |
| 784 | Ga0207704_10204749 | 3300025938 | Bacteria | 1447 |
| 785 | Ga0207704_10270914 | 3300025938 | Bacteria | 1285 |
| 786 | Ga0207704_10395005 | 3300025938 | Bacteria | 1090 |
| 787 | Ga0207665_10019597 | 3300025939 | Bacteria | 4448 |
| 788 | Ga0207665_10279987 | 3300025939 | Bacteria | 1241 |
| 789 | Ga0207691_10001649 | 3300025940 | Bacteria | 22114 |
| 790 | Ga0207691_10024020 | 3300025940 | Bacteria | 5734 |
| 791 | Ga0207711_10000157 | 3300025941 | Bacteria | 73266 |
| 792 | Ga0207711_10000291 | 3300025941 | Bacteria | 53588 |
| 793 | Ga0207711_10001136 | 3300025941 | Bacteria | 25406 |
| 794 | Ga0207711_10001959 | 3300025941 | Bacteria | 18703 |
| 795 | Ga0207711_10083588 | 3300025941 | Bacteria | 2793 |
| 796 | Ga0207711_10115778 | 3300025941 | Bacteria | 2389 |
| 797 | Ga0207689_10000009 | 3300025942 | Bacteria | 127375 |
| 798 | Ga0207689_10008955 | 3300025942 | Bacteria | 8678 |
| 799 | Ga0207689_10040023 | 3300025942 | Bacteria | 3880 |
| 800 | Ga0207689_10125276 | 3300025942 | Bacteria | 2114 |
| 801 | Ga0207661_10092935 | 3300025944 | Bacteria | 2516 |
| 802 | Ga0207661_10102334 | 3300025944 | Bacteria | 2408 |
| 803 | Ga0207661_10115324 | 3300025944 | Bacteria | 2279 |
| 804 | Ga0207661_10497480 | 3300025944 | Bacteria | 1114 |
| 805 | Ga0207679_10000458 | 3300025945 | Bacteria | 28788 |
| 806 | Ga0207679_10025262 | 3300025945 | Bacteria | 4083 |
| 807 | Ga0207679_10092308 | 3300025945 | Bacteria | 2345 |
| 808 | Ga0207679_10109447 | 3300025945 | Bacteria | 2177 |
| 809 | Ga0207679_10193017 | 3300025945 | Bacteria | 1695 |
| 810 | Ga0207679_10382166 | 3300025945 | Bacteria | 1235 |
| 811 | Ga0207679_10435874 | 3300025945 | Bacteria | 1159 |
| 812 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 813 | Ga0207667_10000444 | 3300025949 | Bacteria | 55540 |
| 814 | Ga0207667_10016347 | 3300025949 | Bacteria | 8388 |
| 815 | Ga0207667_10020050 | 3300025949 | Bacteria | 7444 |
| 816 | Ga0207667_10024289 | 3300025949 | Bacteria | 6657 |
| 817 | Ga0207667_10043989 | 3300025949 | Bacteria | 4736 |
| 818 | Ga0207667_10115403 | 3300025949 | Bacteria | 2768 |
| 819 | Ga0207667_10156409 | 3300025949 | Bacteria | 2345 |
| 820 | Ga0207667_10205533 | 3300025949 | Bacteria | 2019 |
| 821 | Ga0207667_10416538 | 3300025949 | Bacteria | 1367 |
| 822 | Ga0207667_10449987 | 3300025949 | Bacteria | 1309 |
| 823 | Ga0207667_10533435 | 3300025949 | Bacteria | 1188 |
| 824 | Ga0207667_10704729 | 3300025949 | Bacteria | 1012 |
| 825 | Ga0207651_10000183 | 3300025960 | Bacteria | 27331 |
| 826 | Ga0207651_10040815 | 3300025960 | Bacteria | 3074 |
| 827 | Ga0207651_10054872 | 3300025960 | Bacteria | 2733 |
| 828 | Ga0207651_10194689 | 3300025960 | Bacteria | 1620 |
| 829 | Ga0207651_10413227 | 3300025960 | Bacteria | 1150 |
| 830 | Ga0207712_10001593 | 3300025961 | Bacteria | 15281 |
| 831 | Ga0207712_10002835 | 3300025961 | Bacteria | 11102 |
| 832 | Ga0207712_10011209 | 3300025961 | Bacteria | 5709 |
| 833 | Ga0207712_10054026 | 3300025961 | Bacteria | 2820 |
| 834 | Ga0207712_10277417 | 3300025961 | Bacteria | 1367 |
| 835 | Ga0207712_10437856 | 3300025961 | Bacteria | 1106 |
| 836 | Ga0207712_10507913 | 3300025961 | Bacteria | 1031 |
| 837 | Ga0207668_10000165 | 3300025972 | Bacteria | 45827 |
| 838 | Ga0207668_10009504 | 3300025972 | Bacteria | 5834 |
| 839 | Ga0207668_10091926 | 3300025972 | Bacteria | 2231 |
| 840 | Ga0207668_10098026 | 3300025972 | Bacteria | 2171 |
| 841 | Ga0207668_10099090 | 3300025972 | Bacteria | 2161 |
| 842 | Ga0207668_10107899 | 3300025972 | Bacteria | 2083 |
| 843 | Ga0207668_10142820 | 3300025972 | Bacteria | 1843 |
| 844 | Ga0207640_10001565 | 3300025981 | Bacteria | 12291 |
| 845 | Ga0207640_10008836 | 3300025981 | Bacteria | 5609 |
| 846 | Ga0207640_10053191 | 3300025981 | Bacteria | 2642 |
| 847 | Ga0207640_10106284 | 3300025981 | Bacteria | 1979 |
| 848 | Ga0207658_10000008 | 3300025986 | Bacteria | 265351 |
| 849 | Ga0207658_10000141 | 3300025986 | Bacteria | 75673 |
| 850 | Ga0207658_10004695 | 3300025986 | Bacteria | 9464 |
| 851 | Ga0207658_10011172 | 3300025986 | Bacteria | 6116 |
| 852 | Ga0207658_10025007 | 3300025986 | Bacteria | 4179 |
| 853 | Ga0207658_10025524 | 3300025986 | Bacteria | 4138 |
| 854 | Ga0207658_10037857 | 3300025986 | Bacteria | 3470 |
| 855 | Ga0207658_10043470 | 3300025986 | Bacteria | 3266 |
| 856 | Ga0207658_10071615 | 3300025986 | Bacteria | 2625 |
| 857 | Ga0207658_10132789 | 3300025986 | Bacteria | 2003 |
| 858 | Ga0207658_10560325 | 3300025986 | Bacteria | 1023 |
| 859 | Ga0207677_10000028 | 3300026023 | Bacteria | 125165 |
| 860 | Ga0207677_10001996 | 3300026023 | Bacteria | 10780 |
| 861 | Ga0207677_10260649 | 3300026023 | Bacteria | 1413 |
| 862 | Ga0207677_10267264 | 3300026023 | Bacteria | 1397 |
| 863 | Ga0207677_10304942 | 3300026023 | Bacteria | 1317 |
| 864 | Ga0207677_10469875 | 3300026023 | Bacteria | 1081 |
| 865 | Ga0207703_10000050 | 3300026035 | Bacteria | 145849 |
| 866 | Ga0207703_10000730 | 3300026035 | Bacteria | 32306 |
| 867 | Ga0207703_10000775 | 3300026035 | Bacteria | 31437 |
| 868 | Ga0207703_10002326 | 3300026035 | Bacteria | 16598 |
| 869 | Ga0207703_10010882 | 3300026035 | Bacteria | 7093 |
| 870 | Ga0207703_10023963 | 3300026035 | Bacteria | 4801 |
| 871 | Ga0207703_10025290 | 3300026035 | Bacteria | 4669 |
| 872 | Ga0207703_10332347 | 3300026035 | Bacteria | 1394 |
| 873 | Ga0207639_10001036 | 3300026041 | Bacteria | 18873 |
| 874 | Ga0207639_10003764 | 3300026041 | Bacteria | 10207 |
| 875 | Ga0207639_10005208 | 3300026041 | Bacteria | 8771 |
| 876 | Ga0207639_10005329 | 3300026041 | Bacteria | 8685 |
| 877 | Ga0207639_10009099 | 3300026041 | Bacteria | 6843 |
| 878 | Ga0207639_10037840 | 3300026041 | Bacteria | 3586 |
| 879 | Ga0207639_10067422 | 3300026041 | Bacteria | 2784 |
| 880 | Ga0207639_10082217 | 3300026041 | Bacteria | 2553 |
| 881 | Ga0207639_10146153 | 3300026041 | Bacteria | 1975 |
| 882 | Ga0207639_10217772 | 3300026041 | Bacteria | 1647 |
| 883 | Ga0207639_10301156 | 3300026041 | Bacteria | 1417 |
| 884 | Ga0207639_10348395 | 3300026041 | Bacteria | 1322 |
| 885 | Ga0207639_10395414 | 3300026041 | Bacteria | 1244 |
| 886 | Ga0207639_10397056 | 3300026041 | Bacteria | 1242 |
| 887 | Ga0207639_10693795 | 3300026041 | Bacteria | 944 |
| 888 | Ga0207678_10002449 | 3300026067 | Bacteria | 16870 |
| 889 | Ga0207678_10006228 | 3300026067 | Bacteria | 10596 |
| 890 | Ga0207678_10008968 | 3300026067 | Bacteria | 8803 |
| 891 | Ga0207678_10010216 | 3300026067 | Bacteria | 8239 |
| 892 | Ga0207678_10011956 | 3300026067 | Bacteria | 7622 |
| 893 | Ga0207678_10046182 | 3300026067 | Bacteria | 3767 |
| 894 | Ga0207678_10057773 | 3300026067 | Bacteria | 3339 |
| 895 | Ga0207678_10089763 | 3300026067 | Bacteria | 2627 |
| 896 | Ga0207678_10104114 | 3300026067 | Bacteria | 2422 |
| 897 | Ga0207678_10147235 | 3300026067 | Bacteria | 2010 |
| 898 | Ga0207678_10366960 | 3300026067 | Bacteria | 1243 |
| 899 | Ga0207708_10006313 | 3300026075 | Bacteria | 8787 |
| 900 | Ga0207708_10245596 | 3300026075 | Bacteria | 1441 |
| 901 | Ga0207702_10001345 | 3300026078 | Bacteria | 24582 |
| 902 | Ga0207702_10003495 | 3300026078 | Bacteria | 14317 |
| 903 | Ga0207702_10012547 | 3300026078 | Bacteria | 7047 |
| 904 | Ga0207702_10025685 | 3300026078 | Bacteria | 4889 |
| 905 | Ga0207702_10029127 | 3300026078 | Bacteria | 4593 |
| 906 | Ga0207702_10102507 | 3300026078 | Bacteria | 2529 |
| 907 | Ga0207702_10404403 | 3300026078 | Bacteria | 1317 |
| 908 | Ga0207702_10575685 | 3300026078 | Bacteria | 1103 |
| 909 | Ga0207641_10000118 | 3300026088 | Bacteria | 117721 |
| 910 | Ga0207641_10000193 | 3300026088 | Bacteria | 83308 |
| 911 | Ga0207641_10003787 | 3300026088 | Bacteria | 13269 |
| 912 | Ga0207641_10004315 | 3300026088 | Bacteria | 12349 |
| 913 | Ga0207641_10031368 | 3300026088 | Bacteria | 4408 |
| 914 | Ga0207641_10032091 | 3300026088 | Bacteria | 4360 |
| 915 | Ga0207641_10040969 | 3300026088 | Bacteria | 3881 |
| 916 | Ga0207641_10052521 | 3300026088 | Bacteria | 3452 |
| 917 | Ga0207641_10056001 | 3300026088 | Bacteria | 3350 |
| 918 | Ga0207648_10000279 | 3300026089 | Bacteria | 55317 |
| 919 | Ga0207648_10044153 | 3300026089 | Bacteria | 3911 |
| 920 | Ga0207648_10056971 | 3300026089 | Bacteria | 3410 |
| 921 | Ga0207648_10148462 | 3300026089 | Bacteria | 2068 |
| 922 | Ga0207648_10156359 | 3300026089 | Bacteria | 2013 |
| 923 | Ga0207648_10200762 | 3300026089 | Bacteria | 1768 |
| 924 | Ga0207676_10000024 | 3300026095 | Bacteria | 265351 |
| 925 | Ga0207676_10000312 | 3300026095 | Bacteria | 41651 |
| 926 | Ga0207676_10004121 | 3300026095 | Bacteria | 10262 |
| 927 | Ga0207676_10004895 | 3300026095 | Bacteria | 9488 |
| 928 | Ga0207676_10005657 | 3300026095 | Bacteria | 8850 |
| 929 | Ga0207676_10008079 | 3300026095 | Bacteria | 7478 |
| 930 | Ga0207676_10039477 | 3300026095 | Bacteria | 3611 |
| 931 | Ga0207676_10080263 | 3300026095 | Bacteria | 2648 |
| 932 | Ga0207676_10101118 | 3300026095 | Bacteria | 2390 |
| 933 | Ga0207674_10000103 | 3300026116 | Bacteria | 97454 |
| 934 | Ga0207674_10000881 | 3300026116 | Bacteria | 39300 |
| 935 | Ga0207674_10002555 | 3300026116 | Bacteria | 22911 |
| 936 | Ga0207674_10008403 | 3300026116 | Bacteria | 11932 |
| 937 | Ga0207674_10011957 | 3300026116 | Bacteria | 9731 |
| 938 | Ga0207674_10050271 | 3300026116 | Bacteria | 4260 |
| 939 | Ga0207674_10053743 | 3300026116 | Bacteria | 4104 |
| 940 | Ga0207674_10095789 | 3300026116 | Bacteria | 2953 |
| 941 | Ga0207674_10130942 | 3300026116 | Bacteria | 2472 |
| 942 | Ga0207674_10233707 | 3300026116 | Bacteria | 1786 |
| 943 | Ga0207675_100000005 | 3300026118 | Bacteria | 199965 |
| 944 | Ga0207675_100003128 | 3300026118 | Bacteria | 16233 |
| 945 | Ga0207675_100041220 | 3300026118 | Bacteria | 4311 |
| 946 | Ga0207675_100241708 | 3300026118 | Bacteria | 1745 |
| 947 | Ga0207675_100297415 | 3300026118 | Bacteria | 1571 |
| 948 | Ga0207683_10000089 | 3300026121 | Bacteria | 72911 |
| 949 | Ga0207683_10001013 | 3300026121 | Bacteria | 25627 |
| 950 | Ga0207683_10001682 | 3300026121 | Bacteria | 19793 |
| 951 | Ga0207683_10040657 | 3300026121 | Bacteria | 4058 |
| 952 | Ga0207683_10328249 | 3300026121 | Bacteria | 1402 |
| 953 | Ga0207698_10001282 | 3300026142 | Bacteria | 14654 |
| 954 | Ga0207698_10002146 | 3300026142 | Bacteria | 11651 |
| 955 | Ga0207698_10010548 | 3300026142 | Bacteria | 5946 |
| 956 | Ga0207698_10011002 | 3300026142 | Bacteria | 5849 |
| 957 | Ga0207698_10630146 | 3300026142 | Bacteria | 1060 |
| 958 | Ga0207698_10664284 | 3300026142 | Bacteria | 1034 |
| 959 | Ga0209281_1007736 | 3300027111 | Bacteria | 2669 |
| 960 | Ga0209813_10038558 | 3300027866 | Bacteria | 1444 |
| 961 | Ga0207428_10010847 | 3300027907 | Bacteria | 8119 |
| 962 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 963 | Ga0268266_10000559 | 3300028379 | Bacteria | 51883 |
| 964 | Ga0268266_10001954 | 3300028379 | Bacteria | 23169 |
| 965 | Ga0268266_10010714 | 3300028379 | Bacteria | 7989 |
| 966 | Ga0268266_10013898 | 3300028379 | Bacteria | 6932 |
| 967 | Ga0268266_10084764 | 3300028379 | Bacteria | 2768 |
| 968 | Ga0268266_10200327 | 3300028379 | Bacteria | 1827 |
| 969 | Ga0268266_10370867 | 3300028379 | Bacteria | 1348 |
| 970 | Ga0268266_10616766 | 3300028379 | Bacteria | 1043 |
| 971 | Ga0268265_10000054 | 3300028380 | Bacteria | 165504 |
| 972 | Ga0268265_10000538 | 3300028380 | Bacteria | 38660 |
| 973 | Ga0268265_10000598 | 3300028380 | Bacteria | 36284 |
| 974 | Ga0268265_10020292 | 3300028380 | Bacteria | 4636 |
| 975 | Ga0268265_10037420 | 3300028380 | Bacteria | 3562 |
| 976 | Ga0268265_10367365 | 3300028380 | Bacteria | 1319 |
| 977 | Ga0268264_10000173 | 3300028381 | Bacteria | 138426 |
| 978 | Ga0268264_10000323 | 3300028381 | Bacteria | 75489 |
| 979 | Ga0268264_10001476 | 3300028381 | Bacteria | 21939 |
| 980 | Ga0268264_10003353 | 3300028381 | Bacteria | 13843 |
| 981 | Ga0268264_10003867 | 3300028381 | Bacteria | 12847 |
| 982 | Ga0268264_10009955 | 3300028381 | Bacteria | 7872 |
| 983 | Ga0268264_10016107 | 3300028381 | Bacteria | 6125 |
| 984 | Ga0268264_10037615 | 3300028381 | Bacteria | 3990 |
| 985 | Ga0268264_10073259 | 3300028381 | Bacteria | 2906 |
| 986 | Ga0307515_10000154 | 3300028794 | Bacteria | 166582 |
| 987 | Ga0307515_10004744 | 3300028794 | Bacteria | 27847 |
| 988 | Ga0307515_10073073 | 3300028794 | Bacteria | 4616 |
| 989 | Ga0307515_10262275 | 3300028794 | Bacteria | 1462 |
| 990 | Ga0307511_10072246 | 3300030521 | Bacteria | 2508 |
| 991 | Ga0307512_10024522 | 3300030522 | Bacteria | 5365 |
| 992 | Ga0265762_1006198 | 3300030760 | Bacteria | 2143 |
| 993 | Ga0265330_10026996 | 3300031235 | Bacteria | 2595 |
| 994 | Ga0265328_10000305 | 3300031239 | Bacteria | 22931 |
| 995 | Ga0265328_10010362 | 3300031239 | Bacteria | 3756 |
| 996 | Ga0265328_10014633 | 3300031239 | Bacteria | 3086 |
| 997 | Ga0265328_10145334 | 3300031239 | Bacteria | 890 |
| 998 | Ga0265331_10000005 | 3300031250 | Bacteria | 465192 |
| 999 | Ga0265331_10001445 | 3300031250 | Bacteria | 17455 |
| 1000 | Ga0265331_10001990 | 3300031250 | Bacteria | 14269 |
| 1001 | Ga0265331_10004390 | 3300031250 | Bacteria | 8824 |
| 1002 | Ga0265327_10066157 | 3300031251 | Bacteria | 1825 |
| 1003 | Ga0265316_10001750 | 3300031344 | Bacteria | 22990 |
| 1004 | Ga0265316_10294962 | 3300031344 | Bacteria | 1182 |
| 1005 | Ga0307513_10005286 | 3300031456 | Bacteria | 17089 |
| 1006 | Ga0307509_10001286 | 3300031507 | Bacteria | 42598 |
| 1007 | Ga0307408_100029787 | 3300031548 | Bacteria | 3785 |
| 1008 | Ga0265314_10000595 | 3300031711 | Bacteria | 45508 |
| 1009 | Ga0265314_10004707 | 3300031711 | Bacteria | 12526 |
| 1010 | Ga0265314_10079146 | 3300031711 | Bacteria | 2174 |
| 1011 | Ga0307516_10057185 | 3300031730 | Bacteria | 3800 |
| 1012 | Ga0307516_10491163 | 3300031730 | Bacteria | 882 |
| 1013 | Ga0307412_10002057 | 3300031911 | Bacteria | 11167 |
| 1014 | Ga0307412_10021192 | 3300031911 | Bacteria | 3966 |
| 1015 | Ga0307409_100622917 | 3300031995 | Bacteria | 1069 |
| 1016 | Ga0307416_100110706 | 3300032002 | Bacteria | 2419 |
| 1017 | Ga0307416_100150505 | 3300032002 | Bacteria | 2133 |
| 1018 | Ga0307411_10030049 | 3300032005 | Bacteria | 3327 |
| 1019 | Ga0307411_10233142 | 3300032005 | Bacteria | 1436 |
| 1020 | Ga0307507_10089135 | 3300033179 | Bacteria | 2656 |
| 1021 | Ga0307510_10002924 | 3300033180 | Bacteria | 19645 |
| 1022 | Ga0307510_10038410 | 3300033180 | Bacteria | 5293 |
| 1023 | Ga0307510_10210097 | 3300033180 | Bacteria | 1469 |
| 1024 | Ga0373958_0002456 | 3300034819 | Bacteria | 2600 |
| 1025 | Ga0373926_0111039 | 3300035083 | Bacteria | 1030 |
| 1026 | Ga0373923_0043737 | 3300035111 | Bacteria | 1854 |
| 1027 | Ga0373932_0018271 | 3300035112 | Bacteria | 1810 |
| 1028 | Ga0373936_0009456 | 3300035113 | Bacteria | 3676 |
| 1029 | Ga0373936_0090957 | 3300035113 | Bacteria | 1279 |
| 1030 | Ga0373941_0006795 | 3300035115 | Bacteria | 2772 |
| 1031 | Ga0373945_0025975 | 3300035116 | Bacteria | 2038 |
| 1032 | Ga0373953_0006322 | 3300035117 | Bacteria | 3898 |
| 1033 | Ga0373954_0008296 | 3300035118 | Bacteria | 4557 |
| 1034 | Ga0373954_0063653 | 3300035118 | Bacteria | 1743 |
| 1035 | Ga0373956_0012525 | 3300035119 | Bacteria | 3517 |
| 1036 | Ga0373943_0003378 | 3300035170 | Bacteria | 7255 |
| 1037 | Ga0373943_0009425 | 3300035170 | Bacteria | 4376 |
| 1038 | Ga0373943_0035578 | 3300035170 | Bacteria | 2381 |
| 1039 | Ga0373946_0057194 | 3300035171 | Bacteria | 1649 |
| 1040 | Ga0373942_0003016 | 3300035207 | Bacteria | 3988 |
| 1041 | Ga0373961_0001242 | 3300035241 | Bacteria | 7820 |
| 1042 | Ga0373924_0043006 | 3300035410 | Bacteria | 1855 |
| 1043 | Ga0373931_0012753 | 3300035691 | Bacteria | 4078 |
| 1044 | Ga0373935_0032485 | 3300035692 | Bacteria | 3244 |
| 1045 | Ga0373935_0128506 | 3300035692 | Bacteria | 1700 |
| 1046 | Ga0373927_0003672 | 3300035695 | Bacteria | 10930 |
| 1047 | Ga0373927_0096268 | 3300035695 | Bacteria | 1924 |
| 1048 | Ga0373927_0170458 | 3300035695 | Bacteria | 1427 |
| 1049 | Ga0373933_0117769 | 3300035724 | Bacteria | 1661 |
| 1050 | Ga0373947_0001397 | 3300035725 | Bacteria | 14855 |
| 1051 | Ga0373947_0106013 | 3300035725 | Bacteria | 1771 |
| 1052 | Ga0373937_0009697 | 3300036401 | Bacteria | 8392 |
| 1053 | Ga0373937_0352850 | 3300036401 | Bacteria | 1393 |
| 1054 | Ga0316584_0205226 | 3300036712 | Bacteria | 1453 |
| 1055 | Ga0373925_0003939 | 3300037068 | Bacteria | 11333 |
| 1056 | Ga0373925_0011747 | 3300037068 | Bacteria | 6335 |
| 1057 | Ga0373925_0183437 | 3300037068 | Bacteria | 1658 |
| 1058 | Ga0395899_0001400 | 3300037312 | Bacteria | 20673 |
| 1059 | Ga0395899_0004896 | 3300037312 | Bacteria | 10422 |
| 1060 | Ga0395899_0099577 | 3300037312 | Bacteria | 2100 |
| 1061 | Ga0395899_0162548 | 3300037312 | Bacteria | 1576 |
| 1062 | Ga0395899_0180807 | 3300037312 | Bacteria | 1481 |
| 1063 | Ga0395900_0003405 | 3300037418 | Bacteria | 17181 |
| 1064 | Ga0395900_0014128 | 3300037418 | Bacteria | 8153 |
| 1065 | Ga0395900_0019708 | 3300037418 | Bacteria | 6876 |
| 1066 | Ga0395900_0053959 | 3300037418 | Bacteria | 4137 |
| 1067 | Ga0395900_0080388 | 3300037418 | Bacteria | 3349 |
| 1068 | Ga0395900_0121199 | 3300037418 | Bacteria | 2683 |
| 1069 | Ga0395900_0125446 | 3300037418 | Bacteria | 2633 |
| 1070 | Ga0395900_0174570 | 3300037418 | Bacteria | 2186 |
| 1071 | Ga0395900_0533252 | 3300037418 | Bacteria | 1120 |
| 1072 | Ga0395898_0003681 | 3300037466 | Bacteria | 17022 |
| 1073 | Ga0395898_0008334 | 3300037466 | Bacteria | 10958 |
| 1074 | Ga0395898_0012207 | 3300037466 | Bacteria | 8885 |
| 1075 | Ga0395898_0015516 | 3300037466 | Bacteria | 7812 |
| 1076 | Ga0395898_0033102 | 3300037466 | Bacteria | 5159 |
| 1077 | Ga0395898_0049703 | 3300037466 | Bacteria | 4108 |
| 1078 | Ga0395898_0069491 | 3300037466 | Bacteria | 3407 |
| 1079 | Ga0395898_0132814 | 3300037466 | Bacteria | 2383 |
| 1080 | Ga0395905_0009017 | 3300037471 | Bacteria | 9786 |
| 1081 | Ga0395905_0012637 | 3300037471 | Bacteria | 8122 |
| 1082 | Ga0395905_0015530 | 3300037471 | Bacteria | 7236 |
| 1083 | Ga0395905_0025270 | 3300037471 | Bacteria | 5601 |
| 1084 | Ga0395905_0025886 | 3300037471 | Bacteria | 5529 |
| 1085 | Ga0395905_0031850 | 3300037471 | Bacteria | 4962 |
| 1086 | Ga0395905_0083763 | 3300037471 | Bacteria | 2987 |
| 1087 | Ga0395905_0244718 | 3300037471 | Bacteria | 1676 |
| 1088 | Ga0395905_0523020 | 3300037471 | Bacteria | 1087 |
| 1089 | Ga0436364_0748271 | 3300037853 | Bacteria | 3125 |
| 1090 | Ga0395901_0000715 | 3300038443 | Bacteria | 37852 |
| 1091 | Ga0395901_0001760 | 3300038443 | Bacteria | 22342 |
| 1092 | Ga0395901_0072646 | 3300038443 | Bacteria | 3586 |
| 1093 | Ga0395901_0198955 | 3300038443 | Bacteria | 2100 |
| 1094 | Ga0395901_0433200 | 3300038443 | Bacteria | 1347 |
| 1095 | Ga0395901_0681071 | 3300038443 | Bacteria | 1028 |
| 1096 | Ga0395901_0766522 | 3300038443 | Bacteria | 956 |
| 1097 | Ga0436365_0476052 | 3300039437 | Bacteria | 2126 |
| 1098 | Ga0436361_0129708 | 3300039447 | Bacteria | 10947 |
| 1099 | Ga0436361_0663813 | 3300039447 | Bacteria | 1674 |
| 1100 | Ga0436361_0928183 | 3300039447 | Bacteria | 11188 |
| 1101 | Ga0436363_0216924 | 3300039450 | Bacteria | 1757 |
| 1102 | Ga0436363_0283319 | 3300039450 | Bacteria | 3571 |
| 1103 | Ga0439436_0002769 | 3300041404 | Bacteria | 5304 |
| 1104 | Ga0439439_0020708 | 3300041406 | Bacteria | 1636 |
| 1105 | Ga0451787_683669 | 3300041441 | Bacteria | 3141 |
| 1106 | Ga0451789_0622405 | 3300041443 | Bacteria | 1093 |
| 1107 | Ga0451793_1344463 | 3300041452 | Bacteria | 7396 |
| 1108 | Ga0451800_0389109 | 3300041459 | Bacteria | 1223 |
| 1109 | Ga0451802_0053535 | 3300041460 | Bacteria | 5889 |
| 1110 | Ga0451837_1160533 | 3300041494 | Bacteria | 1831 |
| 1111 | Ga0439448_0004510 | 3300042005 | Bacteria | 3933 |
| 1112 | Ga0450906_004168 | 3300042145 | Bacteria | 3051 |
| 1113 | Ga0439458_0003180 | 3300042157 | Bacteria | 3892 |
| 1114 | Ga0439458_0016138 | 3300042157 | Bacteria | 1697 |
| 1115 | Ga0451577_0010744 | 3300042876 | Bacteria | 8712 |
| 1116 | Ga0466969_0014983 | 3300044656 | Bacteria | 4067 |
| 1117 | Ga0466972_0003347 | 3300044658 | Bacteria | 7947 |
| 1118 | Ga0466972_0010376 | 3300044658 | Bacteria | 4677 |
| 1119 | Ga0453683_0010101 | 3300044673 | Bacteria | 6271 |
| 1120 | Ga0466965_0005619 | 3300044683 | Bacteria | 5658 |
| 1121 | Ga0466966_0006129 | 3300044684 | Bacteria | 7944 |
| 1122 | Ga0466966_0019399 | 3300044684 | Bacteria | 4474 |
| 1123 | Ga0466966_0076585 | 3300044684 | Bacteria | 2088 |
| 1124 | Ga0466966_0133242 | 3300044684 | Bacteria | 1520 |
| 1125 | Ga0466961_0218336 | 3300044693 | Bacteria | 1175 |
| 1126 | Ga0466963_0018485 | 3300044694 | Bacteria | 4359 |
| 1127 | Ga0466963_0079955 | 3300044694 | Bacteria | 2212 |
| 1128 | Ga0466964_0000235 | 3300044706 | Bacteria | 15877 |
| 1129 | Ga0453684_0208094 | 3300044712 | Bacteria | 2276 |
| 1130 | Ga0466971_0216808 | 3300044719 | Bacteria | 906 |
| 1131 | Ga0466968_0000415 | 3300044735 | Bacteria | 14183 |
| 1132 | Ga0466968_0007387 | 3300044735 | Bacteria | 4177 |
| 1133 | Ga0466970_0333302 | 3300044765 | Bacteria | 859 |
| 1134 | Ga0466957_0000271 | 3300044842 | Bacteria | 25090 |
| 1135 | Ga0466957_0009540 | 3300044842 | Bacteria | 5542 |
| 1136 | Ga0466957_0072442 | 3300044842 | Bacteria | 2133 |
| 1137 | Ga0466960_0250857 | 3300044901 | Bacteria | 983 |
| 1138 | Ga0466959_0002938 | 3300045049 | Bacteria | 10998 |
| 1139 | Ga0466959_0006494 | 3300045049 | Bacteria | 8104 |
| 1140 | Ga0466959_0006800 | 3300045049 | Bacteria | 7968 |
| 1141 | Ga0466959_0156857 | 3300045049 | Bacteria | 1602 |
| 1142 | Ga0451576_0001258 | 3300045051 | Bacteria | 44537 |
| 1143 | Ga0451576_0054023 | 3300045051 | Bacteria | 4206 |
| 1144 | Ga0451576_0278462 | 3300045051 | Bacteria | 1749 |
| 1145 | Ga0466958_0106493 | 3300045836 | Bacteria | 1748 |
| 1146 | Ga0466958_0227851 | 3300045836 | Bacteria | 1190 |
| 1147 | Ga0466967_0008678 | 3300045976 | Bacteria | 7478 |
| 1148 | Ga0466967_0082919 | 3300045976 | Bacteria | 2898 |
| 1149 | Ga0466967_0114991 | 3300045976 | Bacteria | 2477 |
| 1150 | Ga0466967_0191822 | 3300045976 | Bacteria | 1931 |
| 1151 | Ga0466967_0219628 | 3300045976 | Bacteria | 1805 |
| 1152 | Ga0466967_0819173 | 3300045976 | Bacteria | 924 |
| 1153 | Ga0466967_1090519 | 3300045976 | Bacteria | 795 |
| 1154 | Ga0495627_001489 | 3300046453 | Bacteria | 13555 |
| 1155 | Ga0495603_0065699 | 3300046455 | Bacteria | 2138 |
| 1156 | Ga0495603_0229061 | 3300046455 | Bacteria | 1071 |
| 1157 | Ga0495590_0000245 | 3300046457 | Bacteria | 29532 |
| 1158 | Ga0495590_0000893 | 3300046457 | Bacteria | 13364 |
| 1159 | Ga0495629_0011583 | 3300046459 | Bacteria | 6404 |
| 1160 | Ga0495629_0270571 | 3300046459 | Bacteria | 1167 |
| 1161 | Ga0495638_0000439 | 3300046460 | Bacteria | 50194 |
| 1162 | Ga0495638_0008167 | 3300046460 | Bacteria | 7441 |
| 1163 | Ga0495641_0067069 | 3300046461 | Bacteria | 1614 |
| 1164 | Ga0495641_0090628 | 3300046461 | Bacteria | 1366 |
| 1165 | Ga0495651_0001138 | 3300046462 | Bacteria | 20564 |
| 1166 | Ga0495651_0012632 | 3300046462 | Bacteria | 6516 |
| 1167 | Ga0495651_0031145 | 3300046462 | Bacteria | 4161 |
| 1168 | Ga0495651_0076662 | 3300046462 | Bacteria | 2532 |
| 1169 | Ga0495653_0007087 | 3300046463 | Bacteria | 9192 |
| 1170 | Ga0495653_0071517 | 3300046463 | Bacteria | 2593 |
| 1171 | Ga0495650_0000075 | 3300046471 | Bacteria | 250589 |
| 1172 | Ga0495650_0000215 | 3300046471 | Bacteria | 122533 |
| 1173 | Ga0495650_0033470 | 3300046471 | Bacteria | 2287 |
| 1174 | Ga0495650_0072877 | 3300046471 | Bacteria | 1343 |
| 1175 | Ga0495580_0076149 | 3300046472 | Bacteria | 2340 |
| 1176 | Ga0495582_0032532 | 3300046473 | Bacteria | 2868 |
| 1177 | Ga0495605_0000027 | 3300046474 | Bacteria | 220680 |
| 1178 | Ga0495605_0138811 | 3300046474 | Bacteria | 1092 |
| 1179 | Ga0495639_0076887 | 3300046475 | Bacteria | 1549 |
| 1180 | Ga0495662_0153159 | 3300046476 | Bacteria | 1135 |
| 1181 | Ga0495664_0007128 | 3300046477 | Bacteria | 6198 |
| 1182 | Ga0495664_0101700 | 3300046477 | Bacteria | 1732 |
| 1183 | Ga0495584_0001461 | 3300046491 | Bacteria | 14195 |
| 1184 | Ga0495584_0016429 | 3300046491 | Bacteria | 3774 |
| 1185 | Ga0495584_0019698 | 3300046491 | Bacteria | 3428 |
| 1186 | Ga0495584_0055561 | 3300046491 | Bacteria | 1992 |
| 1187 | Ga0495585_0064413 | 3300046492 | Bacteria | 2010 |
| 1188 | Ga0495585_0162785 | 3300046492 | Bacteria | 1157 |
| 1189 | Ga0495596_0032957 | 3300046500 | Bacteria | 2063 |
| 1190 | Ga0495596_0102211 | 3300046500 | Bacteria | 1113 |
| 1191 | Ga0495607_0000337 | 3300046501 | Bacteria | 48518 |
| 1192 | Ga0495607_0000754 | 3300046501 | Bacteria | 31011 |
| 1193 | Ga0495607_0004634 | 3300046501 | Bacteria | 10066 |
| 1194 | Ga0495607_0006533 | 3300046501 | Bacteria | 8197 |
| 1195 | Ga0495583_0000071 | 3300046506 | Bacteria | 183691 |
| 1196 | Ga0495583_0000122 | 3300046506 | Bacteria | 132255 |
| 1197 | Ga0495606_0000497 | 3300046507 | Bacteria | 64227 |
| 1198 | Ga0495606_0001806 | 3300046507 | Bacteria | 27233 |
| 1199 | Ga0495606_0004505 | 3300046507 | Bacteria | 13879 |
| 1200 | Ga0495606_0007233 | 3300046507 | Bacteria | 10004 |
| 1201 | Ga0495606_0110074 | 3300046507 | Bacteria | 1663 |
| 1202 | Ga0495608_0047614 | 3300046511 | Bacteria | 2849 |
| 1203 | Ga0495610_0004566 | 3300046512 | Bacteria | 10178 |
| 1204 | Ga0495610_0005943 | 3300046512 | Bacteria | 8548 |
| 1205 | Ga0495616_0000088 | 3300046513 | Bacteria | 77629 |
| 1206 | Ga0495616_0000318 | 3300046513 | Bacteria | 38489 |
| 1207 | Ga0495616_0001828 | 3300046513 | Bacteria | 14412 |
| 1208 | Ga0495616_0009569 | 3300046513 | Bacteria | 5657 |
| 1209 | Ga0495616_0022784 | 3300046513 | Bacteria | 3378 |
| 1210 | Ga0495616_0054343 | 3300046513 | Bacteria | 1986 |
| 1211 | Ga0495616_0115293 | 3300046513 | Bacteria | 1245 |
| 1212 | Ga0495618_0034445 | 3300046514 | Bacteria | 3175 |
| 1213 | Ga0495628_0001036 | 3300046516 | Bacteria | 25436 |
| 1214 | Ga0495628_0006847 | 3300046516 | Bacteria | 9907 |
| 1215 | Ga0495628_0118398 | 3300046516 | Bacteria | 2033 |
| 1216 | Ga0495628_0173989 | 3300046516 | Bacteria | 1631 |
| 1217 | Ga0495630_0075746 | 3300046517 | Bacteria | 2535 |
| 1218 | Ga0495631_0012715 | 3300046518 | Bacteria | 4102 |
| 1219 | Ga0495631_0047094 | 3300046518 | Bacteria | 1894 |
| 1220 | Ga0495631_0112480 | 3300046518 | Bacteria | 1171 |
| 1221 | Ga0495632_0000385 | 3300046519 | Bacteria | 42145 |
| 1222 | Ga0495632_0002332 | 3300046519 | Bacteria | 14575 |
| 1223 | Ga0495643_0000154 | 3300046522 | Bacteria | 112250 |
| 1224 | Ga0495643_0047939 | 3300046522 | Bacteria | 2311 |
| 1225 | Ga0495648_0034989 | 3300046524 | Bacteria | 3261 |
| 1226 | Ga0495663_0002266 | 3300046525 | Bacteria | 5847 |
| 1227 | Ga0495666_0011560 | 3300046526 | Bacteria | 4400 |
| 1228 | Ga0495666_0162121 | 3300046526 | Bacteria | 1037 |
| 1229 | Ga0495642_0020879 | 3300046528 | Bacteria | 2575 |
| 1230 | Ga0495642_0025329 | 3300046528 | Bacteria | 2351 |
| 1231 | Ga0495652_0007912 | 3300046529 | Bacteria | 9759 |
| 1232 | Ga0495652_0011509 | 3300046529 | Bacteria | 8000 |
| 1233 | Ga0495652_0097503 | 3300046529 | Bacteria | 2391 |
| 1234 | Ga0495665_0001290 | 3300046531 | Bacteria | 13376 |
| 1235 | Ga0495665_0034208 | 3300046531 | Bacteria | 2717 |
| 1236 | Ga0495665_0235598 | 3300046531 | Bacteria | 944 |
| 1237 | Ga0495587_0011313 | 3300046536 | Bacteria | 5656 |
| 1238 | Ga0495587_0046603 | 3300046536 | Bacteria | 2572 |
| 1239 | Ga0495609_0000009 | 3300046538 | Bacteria | 354860 |
| 1240 | Ga0495609_0000124 | 3300046538 | Bacteria | 84411 |
| 1241 | Ga0495621_0001362 | 3300046539 | Bacteria | 6318 |
| 1242 | Ga0495621_0148442 | 3300046539 | Bacteria | 921 |
| 1243 | Ga0495597_0142981 | 3300046542 | Bacteria | 986 |
| 1244 | Ga0495645_0003363 | 3300046543 | Bacteria | 10842 |
| 1245 | Ga0495645_0058688 | 3300046543 | Bacteria | 2791 |
| 1246 | Ga0495645_0066983 | 3300046543 | Bacteria | 2593 |
| 1247 | Ga0495622_0000007 | 3300046557 | Bacteria | 239352 |
| 1248 | Ga0495622_0000427 | 3300046557 | Bacteria | 27809 |
| 1249 | Ga0495622_0001376 | 3300046557 | Bacteria | 12403 |
| 1250 | Ga0495622_0026543 | 3300046557 | Bacteria | 2704 |
| 1251 | Ga0495656_0270363 | 3300046615 | Bacteria | 863 |
| 1252 | Ga0495668_0023138 | 3300046616 | Bacteria | 3546 |
| 1253 | Ga0495668_0067119 | 3300046616 | Bacteria | 1973 |
| 1254 | Ga0495634_0076029 | 3300046642 | Bacteria | 2205 |
| 1255 | Ga0495625_0020935 | 3300046660 | Bacteria | 5042 |
| 1256 | Ga0495625_0024501 | 3300046660 | Bacteria | 4592 |
| 1257 | Ga0495625_0039388 | 3300046660 | Bacteria | 3451 |
| 1258 | Ga0495635_0019638 | 3300046663 | Bacteria | 4707 |
| 1259 | Ga0495635_0156531 | 3300046663 | Bacteria | 1551 |
| 1260 | Ga0495661_0000032 | 3300046665 | Bacteria | 170076 |
| 1261 | Ga0495661_0000094 | 3300046665 | Bacteria | 109394 |
| 1262 | Ga0495661_0004034 | 3300046665 | Bacteria | 10697 |
| 1263 | Ga0495661_0005699 | 3300046665 | Bacteria | 8814 |
| 1264 | Ga0495661_0032246 | 3300046665 | Bacteria | 3313 |
| 1265 | Ga0495661_0147829 | 3300046665 | Bacteria | 1271 |
| 1266 | Ga0495588_0000055 | 3300046674 | Bacteria | 280059 |
| 1267 | Ga0495657_0076494 | 3300046675 | Bacteria | 2174 |
| 1268 | Ga0495657_0103445 | 3300046675 | Bacteria | 1812 |
| 1269 | Ga0495599_0004365 | 3300046678 | Bacteria | 8374 |
| 1270 | Ga0495623_0008428 | 3300046679 | Bacteria | 6697 |
| 1271 | Ga0495623_0042669 | 3300046679 | Bacteria | 2889 |
| 1272 | Ga0495646_0000769 | 3300046680 | Bacteria | 17863 |
| 1273 | Ga0495646_0101233 | 3300046680 | Bacteria | 1652 |
| 1274 | Ga0495658_0058970 | 3300046683 | Bacteria | 2197 |
| 1275 | Ga0495658_0503193 | 3300046683 | Bacteria | 775 |
| 1276 | Ga0495669_0184053 | 3300046684 | Bacteria | 996 |
| 1277 | Ga0495624_0003522 | 3300046690 | Bacteria | 11607 |
| 1278 | Ga0495624_0067380 | 3300046690 | Bacteria | 2233 |
| 1279 | Ga0495670_0006312 | 3300046691 | Bacteria | 5821 |
| 1280 | Ga0495670_0097903 | 3300046691 | Bacteria | 1508 |
| 1281 | Ga0495671_0022016 | 3300046692 | Bacteria | 3343 |
| 1282 | Ga0495649_0000286 | 3300046694 | Bacteria | 44673 |
| 1283 | Ga0495589_0000019 | 3300046794 | Bacteria | 200814 |
| 1284 | Ga0495589_0000148 | 3300046794 | Bacteria | 65054 |
| 1285 | Ga0495589_0046879 | 3300046794 | Bacteria | 2143 |
| 1286 | Ga0495600_0000302 | 3300046809 | Bacteria | 26375 |
| 1287 | Ga0495600_0000460 | 3300046809 | Bacteria | 21142 |
| 1288 | Ga0495660_0004474 | 3300046810 | Bacteria | 8453 |
| 1289 | Ga0495581_0001785 | 3300047315 | Bacteria | 12020 |
| 1290 | Ga0495581_0018356 | 3300047315 | Bacteria | 4062 |
| 1291 | Ga0495604_0083846 | 3300047317 | Bacteria | 2381 |
| 1292 | Ga0495604_0095241 | 3300047317 | Bacteria | 2199 |
| 1293 | Ga0495604_0138144 | 3300047317 | Bacteria | 1744 |
| 1294 | Ga0495674_0077717 | 3300047319 | Bacteria | 2853 |
| 1295 | Ga0495676_0246741 | 3300047321 | Bacteria | 1220 |
| 1296 | Ga0495680_0167858 | 3300047322 | Bacteria | 1590 |
| 1297 | Ga0495683_0205411 | 3300047323 | Bacteria | 886 |
| 1298 | Ga0495687_000024 | 3300047443 | Bacteria | 316676 |
| 1299 | Ga0495687_000046 | 3300047443 | Bacteria | 210412 |
| 1300 | Ga0495687_000132 | 3300047443 | Bacteria | 114685 |
| 1301 | Ga0495687_000947 | 3300047443 | Bacteria | 29896 |
| 1302 | Ga0495675_0255198 | 3300047444 | Bacteria | 1052 |
| 1303 | Ga0495677_0000018 | 3300047445 | Bacteria | 120412 |
| 1304 | Ga0495677_0000059 | 3300047445 | Bacteria | 62937 |
| 1305 | Ga0495677_0000476 | 3300047445 | Bacteria | 17122 |
| 1306 | Ga0495677_0018821 | 3300047445 | Bacteria | 2504 |
| 1307 | Ga0495677_0044344 | 3300047445 | Bacteria | 1630 |
| 1308 | Ga0495673_0000163 | 3300047469 | Bacteria | 114230 |
| 1309 | Ga0495673_0000199 | 3300047469 | Bacteria | 93637 |
| 1310 | Ga0495681_0170031 | 3300047470 | Bacteria | 902 |
| 1311 | Ga0495684_0006624 | 3300047471 | Bacteria | 8984 |
| 1312 | Ga0495686_0001232 | 3300047472 | Bacteria | 29230 |
| 1313 | Ga0495686_0008573 | 3300047472 | Bacteria | 7486 |
| 1314 | Ga0495593_0007919 | 3300047673 | Bacteria | 6190 |
| 1315 | Ga0495593_0024798 | 3300047673 | Bacteria | 3320 |
| 1316 | Ga0495593_0126683 | 3300047673 | Bacteria | 1298 |
| 1317 | Ga0495602_0011414 | 3300048088 | Bacteria | 9187 |
| 1318 | Ga0495602_0049139 | 3300048088 | Bacteria | 3781 |
| 1319 | Ga0495602_0056928 | 3300048088 | Bacteria | 3434 |
| 1320 | Ga0495602_0187276 | 3300048088 | Bacteria | 1590 |
| 1321 | Ga0495626_0000054 | 3300048091 | Bacteria | 154997 |
| 1322 | Ga0495626_0000683 | 3300048091 | Bacteria | 32511 |
| 1323 | Ga0495626_0001301 | 3300048091 | Bacteria | 20372 |
| 1324 | Ga0495626_0028157 | 3300048091 | Bacteria | 2726 |
| 1325 | Ga0496100_0497442 | 3300048903 | Bacteria | 939 |
| 1326 | Ga0496101_0030143 | 3300048904 | Bacteria | 3801 |
| 1327 | Ga0496101_0722822 | 3300048904 | Bacteria | 786 |
| 1328 | Ga0496102_0003046 | 3300048905 | Bacteria | 14198 |
| 1329 | Ga0496102_0669119 | 3300048905 | Bacteria | 961 |
| 1330 | Ga0496103_0051171 | 3300048906 | Bacteria | 2556 |
| 1331 | Ga0496103_0208136 | 3300048906 | Bacteria | 1258 |
| 1332 | Ga0496103_0239513 | 3300048906 | Bacteria | 1167 |
| 1333 | Ga0496105_0288617 | 3300048908 | Bacteria | 1321 |
| 1334 | Ga0496106_0064665 | 3300048909 | Bacteria | 2783 |
| 1335 | Ga0496106_0275132 | 3300048909 | Bacteria | 1348 |
| 1336 | Ga0496106_0361909 | 3300048909 | Bacteria | 1165 |
| 1337 | Ga0496107_0000027 | 3300048910 | Bacteria | 108619 |
| 1338 | Ga0496107_0100304 | 3300048910 | Bacteria | 2122 |
| 1339 | Ga0496107_0199673 | 3300048910 | Bacteria | 1487 |
| 1340 | Ga0496108_0724010 | 3300048911 | Bacteria | 862 |
| 1341 | Ga0496109_0003908 | 3300048912 | Bacteria | 12450 |
| 1342 | Ga0496109_0009801 | 3300048912 | Bacteria | 8179 |
| 1343 | Ga0496109_0023139 | 3300048912 | Bacteria | 5512 |
| 1344 | Ga0496109_0149227 | 3300048912 | Bacteria | 2188 |
| 1345 | Ga0496109_0251673 | 3300048912 | Bacteria | 1664 |
| 1346 | Ga0496109_0394737 | 3300048912 | Bacteria | 1307 |
| 1347 | Ga0496109_0454945 | 3300048912 | Bacteria | 1209 |
| 1348 | Ga0496110_0009845 | 3300048913 | Bacteria | 7746 |
| 1349 | Ga0496110_0052917 | 3300048913 | Bacteria | 3568 |
| 1350 | Ga0496110_0088567 | 3300048913 | Bacteria | 2765 |
| 1351 | Ga0496110_0681512 | 3300048913 | Bacteria | 929 |
| 1352 | Ga0496110_0742893 | 3300048913 | Bacteria | 884 |
| 1353 | Ga0496111_0007923 | 3300048914 | Bacteria | 7006 |
| 1354 | Ga0496112_0001433 | 3300048915 | Bacteria | 18299 |
| 1355 | Ga0496112_0002904 | 3300048915 | Bacteria | 13953 |
| 1356 | Ga0496112_0051152 | 3300048915 | Bacteria | 4052 |
| 1357 | Ga0496112_0190148 | 3300048915 | Bacteria | 2015 |
| 1358 | Ga0496113_0011411 | 3300048916 | Bacteria | 5924 |
| 1359 | Ga0496113_0101328 | 3300048916 | Bacteria | 2232 |
| 1360 | Ga0496114_0038708 | 3300048917 | Bacteria | 3946 |
| 1361 | Ga0496114_0106590 | 3300048917 | Bacteria | 2398 |
| 1362 | Ga0496114_0151381 | 3300048917 | Bacteria | 2013 |
| 1363 | Ga0496114_0201638 | 3300048917 | Bacteria | 1742 |
| 1364 | Ga0496115_0000002 | 3300048918 | Bacteria | 365286 |
| 1365 | Ga0496115_0014651 | 3300048918 | Bacteria | 5939 |
| 1366 | Ga0496115_0208790 | 3300048918 | Bacteria | 1613 |
| 1367 | Ga0496116_0014477 | 3300048919 | Bacteria | 6294 |
| 1368 | Ga0496116_0034118 | 3300048919 | Bacteria | 3597 |
| 1369 | Ga0496116_0130384 | 3300048919 | Bacteria | 1435 |
| 1370 | Ga0496118_0000559 | 3300048921 | Bacteria | 61311 |
| 1371 | Ga0496118_0000565 | 3300048921 | Bacteria | 61226 |
| 1372 | Ga0496118_0003882 | 3300048921 | Bacteria | 18351 |
| 1373 | Ga0496118_0009060 | 3300048921 | Bacteria | 10142 |
| 1374 | Ga0496118_0150034 | 3300048921 | Bacteria | 1461 |
| 1375 | Ga0496120_0096251 | 3300048923 | Bacteria | 1573 |
| 1376 | Ga0496121_0000059 | 3300048924 | Bacteria | 278177 |
| 1377 | Ga0496121_0000763 | 3300048924 | Bacteria | 59158 |
| 1378 | Ga0496121_0063308 | 3300048924 | Bacteria | 3023 |
| 1379 | Ga0496121_0243345 | 3300048924 | Bacteria | 1252 |
| 1380 | Ga0496122_0000501 | 3300048925 | Bacteria | 81470 |
| 1381 | Ga0496122_0002154 | 3300048925 | Bacteria | 28898 |
| 1382 | Ga0496122_0002573 | 3300048925 | Bacteria | 25486 |
| 1383 | Ga0496123_0000029 | 3300048926 | Bacteria | 295871 |
| 1384 | Ga0496123_0002577 | 3300048926 | Bacteria | 22061 |
| 1385 | Ga0496123_0074939 | 3300048926 | Bacteria | 2091 |
| 1386 | Ga0496124_0000226 | 3300048927 | Bacteria | 110448 |
| 1387 | Ga0496124_0000306 | 3300048927 | Bacteria | 90641 |
| 1388 | Ga0496124_0004880 | 3300048927 | Bacteria | 15426 |
| 1389 | Ga0496124_0031755 | 3300048927 | Bacteria | 4671 |
| 1390 | Ga0496125_0005346 | 3300048928 | Bacteria | 14333 |
| 1391 | Ga0496125_0024695 | 3300048928 | Bacteria | 5519 |
| 1392 | Ga0496125_0171540 | 3300048928 | Bacteria | 1457 |
| 1393 | Ga0496125_0267672 | 3300048928 | Bacteria | 1067 |
| 1394 | Ga0496126_0000052 | 3300048929 | Bacteria | 312383 |
| 1395 | Ga0496126_0019169 | 3300048929 | Bacteria | 6745 |
| 1396 | Ga0496126_0067028 | 3300048929 | Bacteria | 3208 |
| 1397 | Ga0496126_0168660 | 3300048929 | Bacteria | 1867 |
| 1398 | Ga0496126_0548948 | 3300048929 | Bacteria | 917 |
| 1399 | Ga0501309_002235 | 3300049129 | Bacteria | 2058 |
| 1400 | Ga0495678_001117 | 3300049459 | Bacteria | 22317 |
| 1401 | Ga0495678_002508 | 3300049459 | Bacteria | 12363 |
| 1402 | Ga0495678_005616 | 3300049459 | Bacteria | 6863 |
| 1403 | Ga0495682_0008940 | 3300049460 | Bacteria | 3928 |
| 1404 | Ga0495682_0028829 | 3300049460 | Bacteria | 2056 |
| 1405 | Ga0501292_006670 | 3300049515 | Bacteria | 1648 |
| 1406 | Ga0501031_0002712 | 3300049568 | Bacteria | 11269 |
| 1407 | Ga0501031_0078143 | 3300049568 | Bacteria | 2156 |
| 1408 | Ga0501031_0109746 | 3300049568 | Bacteria | 1801 |
| 1409 | Ga0501032_0006069 | 3300049569 | Bacteria | 8902 |
| 1410 | Ga0501032_0011007 | 3300049569 | Bacteria | 6503 |
| 1411 | Ga0501032_0012880 | 3300049569 | Bacteria | 5961 |
| 1412 | Ga0501032_0084696 | 3300049569 | Bacteria | 2107 |
| 1413 | Ga0501032_0732474 | 3300049569 | Bacteria | 626 |
| 1414 | Ga0501033_0003340 | 3300049570 | Bacteria | 13243 |
| 1415 | Ga0501033_0042973 | 3300049570 | Bacteria | 3367 |
| 1416 | Ga0501033_0117854 | 3300049570 | Bacteria | 1929 |
| 1417 | Ga0501033_0135239 | 3300049570 | Bacteria | 1783 |
| 1418 | Ga0501034_0000242 | 3300049571 | Bacteria | 101072 |
| 1419 | Ga0501034_0000245 | 3300049571 | Bacteria | 100221 |
| 1420 | Ga0501034_0005369 | 3300049571 | Bacteria | 14029 |
| 1421 | Ga0501034_0006882 | 3300049571 | Bacteria | 12159 |
| 1422 | Ga0501034_0014233 | 3300049571 | Bacteria | 8200 |
| 1423 | Ga0501036_0011156 | 3300049572 | Bacteria | 7433 |
| 1424 | Ga0501036_0101038 | 3300049572 | Bacteria | 2440 |
| 1425 | Ga0501036_0115335 | 3300049572 | Bacteria | 2269 |
| 1426 | Ga0501036_0175700 | 3300049572 | Bacteria | 1803 |
| 1427 | Ga0501036_0387272 | 3300049572 | Bacteria | 1166 |
| 1428 | Ga0501036_0586298 | 3300049572 | Bacteria | 925 |
| 1429 | Ga0501037_0004205 | 3300049573 | Bacteria | 10439 |
| 1430 | Ga0501037_0017736 | 3300049573 | Bacteria | 5238 |
| 1431 | Ga0501037_0024296 | 3300049573 | Bacteria | 4482 |
| 1432 | Ga0501037_0101560 | 3300049573 | Bacteria | 2075 |
| 1433 | Ga0501037_0153391 | 3300049573 | Bacteria | 1645 |
| 1434 | Ga0501037_0201653 | 3300049573 | Unclassified | 1406 |
| 1435 | Ga0501037_0253082 | 3300049573 | Bacteria | 1232 |
| 1436 | Ga0501038_0002716 | 3300049574 | Bacteria | 16504 |
| 1437 | Ga0501038_0004923 | 3300049574 | Bacteria | 12404 |
| 1438 | Ga0501038_0011201 | 3300049574 | Bacteria | 8188 |
| 1439 | Ga0501038_0030294 | 3300049574 | Bacteria | 4789 |
| 1440 | Ga0501038_0084083 | 3300049574 | Bacteria | 2678 |
| 1441 | Ga0501038_0175774 | 3300049574 | Bacteria | 1730 |
| 1442 | Ga0501038_0352330 | 3300049574 | Bacteria | 1146 |
| 1443 | Ga0501039_0010025 | 3300049575 | Bacteria | 7225 |
| 1444 | Ga0501039_0010465 | 3300049575 | Bacteria | 7069 |
| 1445 | Ga0501039_0020230 | 3300049575 | Bacteria | 5102 |
| 1446 | Ga0501039_0069685 | 3300049575 | Bacteria | 2731 |
| 1447 | Ga0501039_0142408 | 3300049575 | Bacteria | 1883 |
| 1448 | Ga0501039_0271286 | 3300049575 | Bacteria | 1333 |
| 1449 | Ga0501040_0077616 | 3300049576 | Bacteria | 2298 |
| 1450 | Ga0501040_0078028 | 3300049576 | Bacteria | 2291 |
| 1451 | Ga0501040_0229025 | 3300049576 | Bacteria | 1323 |
| 1452 | Ga0501040_0268897 | 3300049576 | Bacteria | 1217 |
| 1453 | Ga0501040_0323391 | 3300049576 | Bacteria | 1103 |
| 1454 | Ga0501040_0325569 | 3300049576 | Bacteria | 1099 |
| 1455 | Ga0501041_0017939 | 3300049577 | Bacteria | 4213 |
| 1456 | Ga0501041_0018502 | 3300049577 | Bacteria | 4150 |
| 1457 | Ga0501041_0243055 | 3300049577 | Bacteria | 1131 |
| 1458 | Ga0501042_0008235 | 3300049578 | Bacteria | 6871 |
| 1459 | Ga0501042_0041030 | 3300049578 | Bacteria | 3290 |
| 1460 | Ga0501042_0113169 | 3300049578 | Bacteria | 1954 |
| 1461 | Ga0501042_0120129 | 3300049578 | Bacteria | 1892 |
| 1462 | Ga0501043_0002911 | 3300049579 | Bacteria | 14286 |
| 1463 | Ga0501043_0041516 | 3300049579 | Bacteria | 3614 |
| 1464 | Ga0501043_0048633 | 3300049579 | Bacteria | 3334 |
| 1465 | Ga0501043_0098165 | 3300049579 | Bacteria | 2302 |
| 1466 | Ga0501043_0137542 | 3300049579 | Bacteria | 1913 |
| 1467 | Ga0501043_0472679 | 3300049579 | Bacteria | 939 |
| 1468 | Ga0501043_0482858 | 3300049579 | Bacteria | 927 |
| 1469 | Ga0501043_0494370 | 3300049579 | Bacteria | 914 |
| 1470 | Ga0501046_0006273 | 3300049580 | Bacteria | 10547 |
| 1471 | Ga0501046_0028467 | 3300049580 | Bacteria | 4549 |
| 1472 | Ga0501046_0036929 | 3300049580 | Bacteria | 3928 |
| 1473 | Ga0501046_0131771 | 3300049580 | Bacteria | 1896 |
| 1474 | Ga0501046_0132074 | 3300049580 | Bacteria | 1893 |
| 1475 | Ga0501046_0174670 | 3300049580 | Bacteria | 1610 |
| 1476 | Ga0501046_0180154 | 3300049580 | Bacteria | 1580 |
| 1477 | Ga0501046_0393622 | 3300049580 | Bacteria | 1001 |
| 1478 | Ga0501047_0000054 | 3300049581 | Bacteria | 149749 |
| 1479 | Ga0501047_0000530 | 3300049581 | Bacteria | 41265 |
| 1480 | Ga0501047_0001045 | 3300049581 | Bacteria | 27629 |
| 1481 | Ga0501047_0001922 | 3300049581 | Bacteria | 19965 |
| 1482 | Ga0501047_0010962 | 3300049581 | Bacteria | 8576 |
| 1483 | Ga0501047_0019383 | 3300049581 | Bacteria | 6525 |
| 1484 | Ga0501047_0037961 | 3300049581 | Bacteria | 4659 |
| 1485 | Ga0501047_0107100 | 3300049581 | Bacteria | 2677 |
| 1486 | Ga0501047_0136566 | 3300049581 | Bacteria | 2332 |
| 1487 | Ga0501047_0151061 | 3300049581 | Bacteria | 2198 |
| 1488 | Ga0501047_0244419 | 3300049581 | Bacteria | 1644 |
| 1489 | Ga0501047_0396114 | 3300049581 | Bacteria | 1214 |
| 1490 | Ga0501048_0033223 | 3300049582 | Bacteria | 3728 |
| 1491 | Ga0501067_0000246 | 3300049583 | Bacteria | 29961 |
| 1492 | Ga0501067_0001614 | 3300049583 | Bacteria | 12352 |
| 1493 | Ga0501067_0262370 | 3300049583 | Bacteria | 962 |
| 1494 | Ga0501068_0001112 | 3300049584 | Bacteria | 14222 |
| 1495 | Ga0501068_0042130 | 3300049584 | Bacteria | 2745 |
| 1496 | Ga0501068_0045491 | 3300049584 | Bacteria | 2645 |
| 1497 | Ga0501068_0092243 | 3300049584 | Bacteria | 1870 |
| 1498 | Ga0501069_0001146 | 3300049585 | Bacteria | 12815 |
| 1499 | Ga0501069_0042165 | 3300049585 | Bacteria | 2524 |
| 1500 | Ga0501070_0001709 | 3300049586 | Bacteria | 19474 |
| 1501 | Ga0501070_0022433 | 3300049586 | Bacteria | 5287 |
| 1502 | Ga0501070_0040094 | 3300049586 | Bacteria | 3906 |
| 1503 | Ga0501070_0588875 | 3300049586 | Bacteria | 887 |
| 1504 | Ga0501071_0016873 | 3300049587 | Bacteria | 5023 |
| 1505 | Ga0501071_0059742 | 3300049587 | Bacteria | 2759 |
| 1506 | Ga0501071_0096852 | 3300049587 | Bacteria | 2172 |
| 1507 | Ga0501072_0000311 | 3300049588 | Bacteria | 34577 |
| 1508 | Ga0501072_0042779 | 3300049588 | Bacteria | 3559 |
| 1509 | Ga0501072_0050205 | 3300049588 | Bacteria | 3285 |
| 1510 | Ga0501072_0089288 | 3300049588 | Bacteria | 2446 |
| 1511 | Ga0501072_0107511 | 3300049588 | Bacteria | 2219 |
| 1512 | Ga0501073_0005005 | 3300049589 | Bacteria | 9942 |
| 1513 | Ga0501073_0009083 | 3300049589 | Bacteria | 7336 |
| 1514 | Ga0501073_0013151 | 3300049589 | Bacteria | 6032 |
| 1515 | Ga0501073_0052608 | 3300049589 | Bacteria | 2851 |
| 1516 | Ga0501073_0083452 | 3300049589 | Bacteria | 2223 |
| 1517 | Ga0501073_0188684 | 3300049589 | Bacteria | 1426 |
| 1518 | Ga0501073_0280077 | 3300049589 | Bacteria | 1150 |
| 1519 | Ga0501074_0052622 | 3300049590 | Bacteria | 2938 |
| 1520 | Ga0501075_0001489 | 3300049591 | Bacteria | 15266 |
| 1521 | Ga0501075_0069062 | 3300049591 | Bacteria | 2670 |
| 1522 | Ga0501076_0015138 | 3300049592 | Bacteria | 5823 |
| 1523 | Ga0501076_0291253 | 3300049592 | Bacteria | 1338 |
| 1524 | Ga0501077_0002291 | 3300049593 | Bacteria | 11528 |
| 1525 | Ga0501077_0057276 | 3300049593 | Bacteria | 2475 |
| 1526 | Ga0501077_0075324 | 3300049593 | Bacteria | 2137 |
| 1527 | Ga0501077_0153892 | 3300049593 | Bacteria | 1459 |
| 1528 | Ga0501079_0002396 | 3300049741 | Bacteria | 13591 |
| 1529 | Ga0501079_0109044 | 3300049741 | Bacteria | 2150 |
| 1530 | Ga0501079_0170978 | 3300049741 | Bacteria | 1694 |
| 1531 | Ga0501079_0314632 | 3300049741 | Bacteria | 1225 |
| 1532 | Ga0501080_0000041 | 3300049742 | Bacteria | 81554 |
| 1533 | Ga0501080_0000948 | 3300049742 | Bacteria | 23724 |
| 1534 | Ga0501080_0019336 | 3300049742 | Bacteria | 6310 |
| 1535 | Ga0501080_0034009 | 3300049742 | Bacteria | 4759 |
| 1536 | Ga0501080_0044991 | 3300049742 | Bacteria | 4109 |
| 1537 | Ga0501080_0147707 | 3300049742 | Bacteria | 2173 |
| 1538 | Ga0501080_0181785 | 3300049742 | Bacteria | 1934 |
| 1539 | Ga0501080_0280712 | 3300049742 | Bacteria | 1514 |
| 1540 | Ga0501081_0026718 | 3300049743 | Bacteria | 3894 |
| 1541 | Ga0501081_0029564 | 3300049743 | Bacteria | 3703 |
| 1542 | Ga0501081_0097941 | 3300049743 | Bacteria | 2070 |
| 1543 | Ga0501081_0105657 | 3300049743 | Bacteria | 1995 |
| 1544 | Ga0501081_0119993 | 3300049743 | Bacteria | 1872 |
| 1545 | Ga0501081_0312421 | 3300049743 | Bacteria | 1154 |
| 1546 | Ga0501083_0000540 | 3300049744 | Bacteria | 24122 |
| 1547 | Ga0501083_0010398 | 3300049744 | Bacteria | 6550 |
| 1548 | Ga0501083_0153110 | 3300049744 | Bacteria | 1510 |
| 1549 | Ga0501035_0000020 | 3300049822 | Bacteria | 221605 |
| 1550 | Ga0501035_0008087 | 3300049822 | Bacteria | 9800 |
| 1551 | Ga0501035_0032641 | 3300049822 | Bacteria | 4736 |
| 1552 | Ga0501035_0039185 | 3300049822 | Bacteria | 4289 |
| 1553 | Ga0501044_0000007 | 3300049823 | Bacteria | 283429 |
| 1554 | Ga0501044_0001497 | 3300049823 | Bacteria | 27374 |
| 1555 | Ga0501044_0004637 | 3300049823 | Bacteria | 15387 |
| 1556 | Ga0501044_0005669 | 3300049823 | Bacteria | 13840 |
| 1557 | Ga0501044_0005977 | 3300049823 | Bacteria | 13463 |
| 1558 | Ga0501044_0055955 | 3300049823 | Bacteria | 4049 |
| 1559 | Ga0501044_0472832 | 3300049823 | Bacteria | 1157 |
| 1560 | Ga0501045_0044337 | 3300049824 | Bacteria | 3239 |
| 1561 | Ga0501045_0108382 | 3300049824 | Bacteria | 2058 |
| 1562 | Ga0501045_0195520 | 3300049824 | Bacteria | 1507 |
| 1563 | Ga0501045_0310082 | 3300049824 | Bacteria | 1174 |
| 1564 | Ga0501045_0435684 | 3300049824 | Bacteria | 975 |
| 1565 | nmdc:mga0yw44_112785_c1 | 3300050492 | Bacteria | 1744 |
| 1566 | nmdc:mga0yw44_27614_c1 | 3300050492 | Bacteria | 3253 |
| 1567 | nmdc:mga07m45_2441_c1 | 3300050496 | Bacteria | 8725 |
| 1568 | nmdc:mga05p37_87743_c1 | 3300050507 | Bacteria | 1972 |
| 1569 | nmdc:mga06r32_98492_c1 | 3300050510 | Bacteria | 2866 |
| 1570 | nmdc:mga08y16_336973_c1 | 3300050511 | Bacteria | 1551 |
| 1571 | nmdc:mga08y16_4539_c1 | 3300050511 | Bacteria | 14468 |
| 1572 | nmdc:mga0n895_111129_c1 | 3300050512 | Bacteria | 2756 |
| 1573 | nmdc:mga0n895_1836_c1 | 3300050512 | Bacteria | 16193 |
| 1574 | nmdc:mga0n895_209183_c1 | 3300050512 | Bacteria | 1981 |
| 1575 | nmdc:mga0n895_481473_c1 | 3300050512 | Bacteria | 1251 |
| 1576 | nmdc:mga0rr50_162534_c1 | 3300050513 | Bacteria | 1813 |
| 1577 | nmdc:mga08x19_302481_c1 | 3300050514 | Bacteria | 1111 |
| 1578 | nmdc:mga0a205_256861_c1 | 3300050515 | Bacteria | 1626 |
| 1579 | nmdc:mga0a205_2579_c1 | 3300050515 | Bacteria | 15986 |
| 1580 | nmdc:mga0a205_688321_c1 | 3300050515 | Bacteria | 872 |
| 1581 | Ga0495601_0000619 | 3300053077 | Bacteria | 18911 |
| 1582 | Ga0495601_0027002 | 3300053077 | Bacteria | 3547 |
| 1583 | Ga0495601_0080021 | 3300053077 | Bacteria | 2096 |
| 1584 | Ga0495601_0105027 | 3300053077 | Bacteria | 1826 |
| 1585 | Ga0495601_0370724 | 3300053077 | Bacteria | 930 |
| 1586 | Ga0495612_0049443 | 3300053078 | Bacteria | 1725 |
| 1587 | Ga0495612_0059876 | 3300053078 | Bacteria | 1576 |
| 1588 | Ga0500610_0000267 | 3300053079 | Bacteria | 15829 |
| 1589 | Ga0500635_0000599 | 3300053080 | Bacteria | 9546 |
| 1590 | Ga0500635_0006359 | 3300053080 | Bacteria | 3150 |
| 1591 | Ga0495595_0094456 | 3300053084 | Bacteria | 1438 |
| 1592 | Ga0495619_0010992 | 3300053085 | Bacteria | 5698 |
| 1593 | Ga0495619_0063579 | 3300053085 | Bacteria | 2459 |
| 1594 | Ga0495619_0113389 | 3300053085 | Bacteria | 1854 |
| 1595 | Ga0495619_0276924 | 3300053085 | Bacteria | 1162 |
| 1596 | Ga0500578_0000159 | 3300053086 | Bacteria | 79246 |
| 1597 | Ga0500578_0226560 | 3300053086 | Bacteria | 1134 |
| 1598 | Ga0500643_022601 | 3300053087 | Bacteria | 2021 |
| 1599 | Ga0500646_0057531 | 3300053090 | Bacteria | 1136 |
| 1600 | Ga0500583_0033904 | 3300053092 | Bacteria | 2265 |
| 1601 | Ga0500651_0000152 | 3300053093 | Bacteria | 44325 |
| 1602 | Ga0500651_0026080 | 3300053093 | Bacteria | 3670 |
| 1603 | Ga0500555_048049 | 3300053103 | Bacteria | 1173 |
| 1604 | Ga0500556_0003675 | 3300053104 | Bacteria | 4463 |
| 1605 | Ga0500562_015873 | 3300053108 | Bacteria | 1934 |
| 1606 | Ga0500572_035346 | 3300053111 | Bacteria | 1421 |
| 1607 | Ga0500594_0008119 | 3300053118 | Bacteria | 2387 |
| 1608 | Ga0500595_001693 | 3300053119 | Bacteria | 11555 |
| 1609 | Ga0500595_003554 | 3300053119 | Bacteria | 7241 |
| 1610 | Ga0500595_004549 | 3300053119 | Bacteria | 6193 |
| 1611 | Ga0500597_000644 | 3300053120 | Bacteria | 7681 |
| 1612 | Ga0500608_009663 | 3300053122 | Bacteria | 4106 |
| 1613 | Ga0500614_000810 | 3300053123 | Bacteria | 7903 |
| 1614 | Ga0500642_0151645 | 3300053130 | Bacteria | 1088 |
| 1615 | Ga0500559_0000134 | 3300053136 | Bacteria | 56963 |
| 1616 | Ga0500559_0013982 | 3300053136 | Bacteria | 3392 |
| 1617 | Ga0500559_0089463 | 3300053136 | Bacteria | 1408 |
| 1618 | Ga0500568_0006484 | 3300053139 | Bacteria | 5868 |
| 1619 | Ga0500574_000582 | 3300053141 | Bacteria | 4706 |
| 1620 | Ga0500590_030679 | 3300053148 | Bacteria | 2788 |
| 1621 | Ga0500616_0001521 | 3300053153 | Bacteria | 21858 |
| 1622 | Ga0500616_0006629 | 3300053153 | Bacteria | 7543 |
| 1623 | Ga0500616_0056629 | 3300053153 | Bacteria | 2045 |
| 1624 | Ga0500619_000197 | 3300053154 | Bacteria | 13926 |
| 1625 | Ga0500622_0001649 | 3300053156 | Bacteria | 17443 |
| 1626 | Ga0500622_0013626 | 3300053156 | Bacteria | 4383 |
| 1627 | Ga0500636_0002608 | 3300053177 | Bacteria | 10004 |
| 1628 | Ga0500636_0004757 | 3300053177 | Bacteria | 7698 |
| 1629 | Ga0500636_0025332 | 3300053177 | Bacteria | 3505 |
| 1630 | Ga0500637_0193605 | 3300053178 | Bacteria | 1161 |
| 1631 | Ga0500645_043222 | 3300053730 | Bacteria | 1327 |
| 1632 | Ga0500596_000833 | 3300053735 | Bacteria | 6111 |
| 1633 | Ga0501084_0026615 | 3300054114 | Bacteria | 4828 |
| 1634 | Ga0501084_0077867 | 3300054114 | Bacteria | 2779 |
| 1635 | Ga0501084_0095591 | 3300054114 | Bacteria | 2495 |
| 1636 | Ga0501084_0102949 | 3300054114 | Bacteria | 2398 |
| 1637 | Ga0500661_001796 | 3300055283 | Bacteria | 4044 |
| 1638 | Ga0587077_021922 | 3300059493 | Bacteria | 1139 |
| 1639 | Ga0501082_0000055 | 3300060353 | Bacteria | 80800 |
| 1640 | Ga0501082_0008399 | 3300060353 | Bacteria | 8908 |
| 1641 | Ga0501082_0010362 | 3300060353 | Bacteria | 8027 |
| 1642 | Ga0501082_0013384 | 3300060353 | Bacteria | 7054 |
| 1643 | Ga0501082_0062907 | 3300060353 | Bacteria | 3195 |
| 1644 | Ga0501082_0124504 | 3300060353 | Bacteria | 2235 |
| 1645 | Ga0501082_0174214 | 3300060353 | Bacteria | 1871 |
| 1646 | Ga0501082_0202445 | 3300060353 | Bacteria | 1727 |
| 1647 | Ga0466962_0057076 | 3300061719 | Bacteria | 1864 |
| 1648 | Ga0530510_0051863 | 3300061734 | Bacteria | 2964 |
| 1649 | Ga0530510_0272557 | 3300061734 | Bacteria | 1263 |
| 1650 | Ga0530510_0504912 | 3300061734 | Bacteria | 917 |
| 1651 | 2501082551 | 2501025502 | Bacteria | 9641094 |
| 1652 | 2501408500 | 2501025504 | Bacteria | 8008976 |
| 1653 | 2511086115 | 2510917013 | Bacteria | 9951648 |
| 1654 | 2511096234 | 2510917014 | Bacteria | 8296963 |
| 1655 | 2511103043 | 2510917015 | Bacteria | 7950052 |
| 1656 | 2511123262 | 2510917020 | Bacteria | 5657507 |
| 1657 | 2511250699 | 2511231003 | Bacteria | 5606035 |
| 1658 | 2511383157 | 2511231026 | Bacteria | 5225445 |
| 1659 | 2513556425 | 2513237082 | Bacteria | 8640282 |
| 1660 | 2513564445 | 2513237083 | Bacteria | 8410967 |
| 1661 | 2513999798 | 2513237159 | Bacteria | 6810126 |
| 1662 | 2521557177 | 2521172590 | Bacteria | 5047645 |
| 1663 | 2550696552 | 2548876994 | Bacteria | 4904866 |
| 1664 | 2553007701 | 2551306416 | Bacteria | 6152985 |
| 1665 | 2585148116 | 2582581279 | Bacteria | 4980720 |
| 1666 | 2585270420 | 2582581306 | Bacteria | 6450535 |
| 1667 | 2585387752 | 2582581865 | Bacteria | 6644329 |
| 1668 | 2585397939 | 2582581866 | Bacteria | 6859583 |
| 1669 | 2643926618 | 2643221583 | Bacteria | 5218014 |
| 1670 | 2644168236 | 2643221629 | Bacteria | 5850260 |
| 1671 | 2644302001 | 2643221654 | Bacteria | 5273570 |
| 1672 | 2644348928 | 2643221662 | Bacteria | 5851492 |
| 1673 | 2676476635 | 2675903058 | Bacteria | 6822861 |
| 1674 | 2721025362 | 2718218334 | Bacteria | 4765486 |
| 1675 | 2792746261 | 2791355123 | Bacteria | 8049106 |
| 1676 | 2808983385 | 2808606386 | Bacteria | 4471946 |
| 1677 | 2809128614 | 2808606415 | Bacteria | 4576710 |
| 1678 | 2809148235 | 2808606419 | Bacteria | 4576925 |
| 1679 | 2810362959 | 2808606700 | Bacteria | 3482157 |
| 1680 | 2819543941 | 2818991436 | Bacteria | 5376622 |
| 1681 | 2819564385 | 2818991440 | Bacteria | 4774720 |
| 1682 | 2819591907 | 2818991445 | Bacteria | 4955017 |
| 1683 | 2819617028 | 2818991449 | Bacteria | 5518009 |
| 1684 | 2819618666 | 2818991449 | Bacteria | 5518009 |
| 1685 | 2827630638 | 2827628540 | Bacteria | 6858585 |
| 1686 | 2837683533 | 2837678835 | Bacteria | 5252418 |
| 1687 | 2842526370 | 2842521101 | Bacteria | 6569494 |
| 1688 | 2842915831 | 2842914999 | Bacteria | 4419378 |
| 1689 | 2852620343 | 2852618963 | Bacteria | 4577824 |
| 1690 | 2856292673 | 2856287931 | Bacteria | 7223934 |
| 1691 | 2857360875 | 2857357740 | Bacteria | 9937880 |
| 1692 | 2883087930 | 2883087390 | Bacteria | 9532701 |
| 1693 | 2884219490 | 2884215851 | Bacteria | 4554841 |
| 1694 | 2884812893 | 2884811622 | Bacteria | 5552861 |
| 1695 | 2884840681 | 2884836552 | Bacteria | 5219991 |
| 1696 | 2884855938 | 2884852848 | Bacteria | 5221161 |
| 1697 | 2894821435 | 2894817345 | Bacteria | 4892941 |
| 1698 | 2896157137 | 2896154374 | Bacteria | 5221518 |
| 1699 | 2904440114 | 2904439833 | Bacteria | 5931679 |
| 1700 | 2904442630 | 2904439833 | Bacteria | 5931679 |
| 1701 | 2904465028 | 2904463128 | Bacteria | 4775606 |
| 1702 | 2904530950 | 2904530477 | Bacteria | 5876334 |
| 1703 | 2904587417 | 2904584206 | Bacteria | 6028872 |
| 1704 | 2904592548 | 2904589729 | Bacteria | 6113573 |
| 1705 | 2904604660 | 2904601388 | Bacteria | 5884906 |
| 1706 | 2919050472 | 2919046199 | Bacteria | 5567169 |
| 1707 | 2919082491 | 2919079590 | Bacteria | 5946433 |
| 1708 | 2919407140 | 2919404418 | Bacteria | 4232372 |
| 1709 | 2923515805 | 2923510766 | Bacteria | 5926163 |
| 1710 | 2928118605 | 2928115317 | Bacteria | 6477646 |
| 1711 | 2928133403 | 2928130867 | Bacteria | 5467269 |
| 1712 | 637075200 | 637000159 | Bacteria | 7596297 |
| 1713 | 8003960874 | 8003955200 | Bacteria | 8601927 |
| 1714 | 8045865973 | 8045864390 | Bacteria | 5043873 |
| 1715 | 8056064425 | 8056060235 | Bacteria | 7259403 |
| 1716 | 8057163447 | 8057160832 | Bacteria | 3268302 |
| 1717 | Ga0496117_0044861 | |||
| 1718 | JGI24741J21665_1001217 | |||
| 1719 | JGI24740J21852_10007131 | |||
| 1720 | JGI24740J21852_10020119 | |||
| 1721 | JGI24740J21852_10068980 | |||
| 1722 | JGI24739J22299_10012826 | |||
| 1723 | JGI24737J22298_10003471 | |||
| 1724 | JGI24744J21845_10004468 | |||
| 1725 | JGI25155J39150_1000532 | |||
| 1726 | JGI25155J39150_1000936 | |||
| 1727 | JGI25156J39149_1001026 | |||
| 1728 | JGI25156J39149_1004771 | |||
| 1729 | JGI25156J39149_1015034 | |||
| 1730 | JGI25156J39149_1021461 | |||
| 1731 | JGI25162J39368_1000001 | |||
| 1732 | JGI25162J39368_1005321 | |||
| 1733 | JGI25154J39366_1000871 | |||
| 1734 | JGI25154J39366_1000911 | |||
| 1735 | JGI25157J39369_1004172 | |||
| 1736 | JGI25157J39369_1004410 | |||
| 1737 | JGI25163J39215_1002601 | |||
| 1738 | JGI25164J39214_1000475 | |||
| 1739 | JGI25152J39213_1028232 | |||
| 1740 | JGI25151J46595_10000913 | |||
| 1741 | JGI25151J46595_10006316 | |||
| 1742 | JGI25165J46597_1000001 | |||
| 1743 | JGI25165J46597_1001366 | |||
| 1744 | JGI25153J46596_10000045 | |||
| 1745 | JGI25153J46596_10018640 | |||
| 1746 | rootH1_10019690 | |||
| 1747 | rootL2_10065722 | |||
| 1748 | Ga0055538_1000001 | |||
| 1749 | Ga0055538_1000013 | |||
| 1750 | Ga0055539_1000001 | |||
| 1751 | Ga0055539_1000018 | |||
| 1752 | Ga0055533_1000003 | |||
| 1753 | Ga0055533_1000022 | |||
| 1754 | Ga0055532_1000017 | |||
| 1755 | Ga0055525_1000001 | |||
| 1756 | Ga0055525_1000003 | |||
| 1757 | Ga0055525_1000024 | |||
| 1758 | Ga0055535_1006731 | |||
| 1759 | Ga0055526_1028622 | |||
| 1760 | Ga0055536_1004251 | |||
| 1761 | Ga0055536_1012671 | |||
| 1762 | Ga0055530_10036597 | |||
| 1763 | Ga0055540_1001616 | |||
| 1764 | Ga0055531_10002054 | |||
| 1765 | Ga0055541_1000001 | |||
| 1766 | Ga0055541_1000013 | |||
| 1767 | Ga0065165_1000745 | |||
| 1768 | Ga0065712_10112677 | |||
| 1769 | Ga0065715_10321857 | |||
| 1770 | Ga0070658_10000881 | |||
| 1771 | Ga0070658_10093058 | |||
| 1772 | Ga0070658_10138067 | |||
| 1773 | Ga0070658_10156267 | |||
| 1774 | Ga0070658_10224133 | |||
| 1775 | Ga0070658_10382575 | |||
| 1776 | Ga0070658_10505211 | |||
| 1777 | Ga0070658_10664089 | |||
| 1778 | Ga0070676_10018089 | |||
| 1779 | Ga0070676_10073008 | |||
| 1780 | Ga0070676_10155875 | |||
| 1781 | Ga0070683_100009560 | |||
| 1782 | Ga0070683_100096695 | |||
| 1783 | Ga0070683_100102161 | |||
| 1784 | Ga0070683_100122436 | |||
| 1785 | Ga0070683_100262653 | |||
| 1786 | Ga0070683_100306077 | |||
| 1787 | Ga0070683_100496211 | |||
| 1788 | Ga0070690_100000396 | |||
| 1789 | Ga0070690_100001314 | |||
| 1790 | Ga0070670_100000011 | |||
| 1791 | Ga0070670_100009125 | |||
| 1792 | Ga0070670_100063773 | |||
| 1793 | Ga0070670_100142839 | |||
| 1794 | Ga0070670_100453730 | |||
| 1795 | Ga0070677_10000119 | |||
| 1796 | Ga0070677_10052611 | |||
| 1797 | Ga0068869_100000465 | |||
| 1798 | Ga0068869_100000575 | |||
| 1799 | Ga0068869_100030458 | |||
| 1800 | Ga0068869_100038379 | |||
| 1801 | Ga0070666_10000097 | |||
| 1802 | Ga0070666_10000198 | |||
| 1803 | Ga0070666_10004931 | |||
| 1804 | Ga0070666_10005202 | |||
| 1805 | Ga0070666_10029401 | |||
| 1806 | Ga0070666_10033779 | |||
| 1807 | Ga0070666_10050374 | |||
| 1808 | Ga0070666_10190636 | |||
| 1809 | Ga0070666_10377766 | |||
| 1810 | Ga0070680_100011206 | |||
| 1811 | Ga0070680_100100287 | |||
| 1812 | Ga0070680_100463638 | |||
| 1813 | Ga0070682_100059155 | |||
| 1814 | Ga0070682_100080367 | |||
| 1815 | Ga0070682_100126734 | |||
| 1816 | Ga0068868_100016774 | |||
| 1817 | Ga0068868_100038492 | |||
| 1818 | Ga0068868_100060073 | |||
| 1819 | Ga0068868_100161524 | |||
| 1820 | Ga0068868_100187168 | |||
| 1821 | Ga0068868_100353230 | |||
| 1822 | Ga0070660_100002548 | |||
| 1823 | Ga0070660_100006229 | |||
| 1824 | Ga0070660_100028777 | |||
| 1825 | Ga0070660_100081744 | |||
| 1826 | Ga0070689_100003279 | |||
| 1827 | Ga0070689_100037597 | |||
| 1828 | Ga0070689_100347195 | |||
| 1829 | Ga0070691_10031910 | |||
| 1830 | Ga0070687_100001236 | |||
| 1831 | Ga0070687_100174327 | |||
| 1832 | Ga0070661_100000128 | |||
| 1833 | Ga0070661_100010705 | |||
| 1834 | Ga0070661_100067383 | |||
| 1835 | Ga0070661_100167629 | |||
| 1836 | Ga0070692_10005521 | |||
| 1837 | Ga0070692_10074102 | |||
| 1838 | Ga0070692_10339447 | |||
| 1839 | Ga0070668_100000193 | |||
| 1840 | Ga0070668_100000218 | |||
| 1841 | Ga0070668_100006659 | |||
| 1842 | Ga0070668_100105539 | |||
| 1843 | Ga0070668_100243131 | |||
| 1844 | Ga0070668_100344960 | |||
| 1845 | Ga0070669_100001298 | |||
| 1846 | Ga0070669_100006029 | |||
| 1847 | Ga0070669_100048564 | |||
| 1848 | Ga0070669_100073260 | |||
| 1849 | Ga0070675_100007099 | |||
| 1850 | Ga0070675_100059143 | |||
| 1851 | Ga0070675_100303980 | |||
| 1852 | Ga0070671_100000026 | |||
| 1853 | Ga0070671_100001435 | |||
| 1854 | Ga0070671_100016327 | |||
| 1855 | Ga0070671_100033885 | |||
| 1856 | Ga0070671_100053322 | |||
| 1857 | Ga0070671_100086404 | |||
| 1858 | Ga0070671_100262836 | |||
| 1859 | Ga0070671_100322402 | |||
| 1860 | Ga0070674_100000686 | |||
| 1861 | Ga0070674_100000953 | |||
| 1862 | Ga0070674_100021719 | |||
| 1863 | Ga0070674_100047070 | |||
| 1864 | Ga0070673_100054732 | |||
| 1865 | Ga0070673_100067881 | |||
| 1866 | Ga0070673_100757118 | |||
| 1867 | Ga0070688_100001706 | |||
| 1868 | Ga0070688_100006308 | |||
| 1869 | Ga0070659_100006519 | |||
| 1870 | Ga0070659_100015651 | |||
| 1871 | Ga0070659_100019145 | |||
| 1872 | Ga0070659_100222101 | |||
| 1873 | Ga0070659_100288472 | |||
| 1874 | Ga0070659_100494006 | |||
| 1875 | Ga0070667_100000010 | |||
| 1876 | Ga0070667_100000092 | |||
| 1877 | Ga0070667_100001339 | |||
| 1878 | Ga0070667_100004143 | |||
| 1879 | Ga0070667_100011628 | |||
| 1880 | Ga0070667_100011752 | |||
| 1881 | Ga0070667_100028507 | |||
| 1882 | Ga0070667_100028612 | |||
| 1883 | Ga0070667_100031890 | |||
| 1884 | Ga0070667_100108091 | |||
| 1885 | Ga0070667_100453085 | |||
| 1886 | Ga0070703_10080915 | |||
| 1887 | Ga0070714_100070954 | |||
| 1888 | Ga0070714_100071156 | |||
| 1889 | Ga0070714_100158133 | |||
| 1890 | Ga0070713_100001639 | |||
| 1891 | Ga0070713_100045084 | |||
| 1892 | Ga0070713_100051803 | |||
| 1893 | Ga0070710_10048246 | |||
| 1894 | Ga0070701_10015406 | |||
| 1895 | Ga0070701_10078065 | |||
| 1896 | Ga0070711_100027185 | |||
| 1897 | Ga0070705_100000278 | |||
| 1898 | Ga0070705_100027619 | |||
| 1899 | Ga0070700_100050934 | |||
| 1900 | Ga0070700_100288273 | |||
| 1901 | Ga0070708_100008135 | |||
| 1902 | Ga0070663_100001469 | |||
| 1903 | Ga0070663_100010345 | |||
| 1904 | Ga0070663_100019991 | |||
| 1905 | Ga0070663_100083587 | |||
| 1906 | Ga0070663_100114868 | |||
| 1907 | Ga0070678_100002532 | |||
| 1908 | Ga0070678_100019947 | |||
| 1909 | Ga0070678_100043700 | |||
| 1910 | Ga0070678_100043774 | |||
| 1911 | Ga0070678_100092086 | |||
| 1912 | Ga0070662_100005207 | |||
| 1913 | Ga0070662_100042067 | |||
| 1914 | Ga0070662_100067285 | |||
| 1915 | Ga0070662_100105738 | |||
| 1916 | Ga0070662_100426214 | |||
| 1917 | Ga0070681_10048741 | |||
| 1918 | Ga0070681_10088290 | |||
| 1919 | Ga0070681_10252343 | |||
| 1920 | Ga0068867_100201114 | |||
| 1921 | Ga0068867_100416876 | |||
| 1922 | Ga0070685_10000035 | |||
| 1923 | Ga0070685_10000657 | |||
| 1924 | Ga0070685_10001172 | |||
| 1925 | Ga0070706_100000099 | |||
| 1926 | Ga0070706_100198822 | |||
| 1927 | Ga0070706_100392642 | |||
| 1928 | Ga0070707_100002214 | |||
| 1929 | Ga0070707_100245113 | |||
| 1930 | Ga0070698_100072846 | |||
| 1931 | Ga0070699_100079247 | |||
| 1932 | Ga0070699_100285563 | |||
| 1933 | Ga0070699_100434818 | |||
| 1934 | Ga0070679_100002575 | |||
| 1935 | Ga0070679_100124967 | |||
| 1936 | Ga0070684_100030135 | |||
| 1937 | Ga0070684_100128207 | |||
| 1938 | Ga0070697_100067912 | |||
| 1939 | Ga0070697_100264684 | |||
| 1940 | Ga0068853_100000208 | |||
| 1941 | Ga0068853_100002117 | |||
| 1942 | Ga0068853_100006289 | |||
| 1943 | Ga0068853_100017942 | |||
| 1944 | Ga0068853_100049630 | |||
| 1945 | Ga0068853_100129047 | |||
| 1946 | Ga0068853_100246922 | |||
| 1947 | Ga0068853_100494924 | |||
| 1948 | Ga0070672_100284056 | |||
| 1949 | Ga0070686_100002031 | |||
| 1950 | Ga0070686_100011604 | |||
| 1951 | Ga0070695_100038331 | |||
| 1952 | Ga0070696_100023647 | |||
| 1953 | Ga0070693_100001786 | |||
| 1954 | Ga0070693_100003714 | |||
| 1955 | Ga0070693_100008954 | |||
| 1956 | Ga0070693_100069111 | |||
| 1957 | Ga0070693_100178477 | |||
| 1958 | Ga0070665_100008420 | |||
| 1959 | Ga0070665_100011217 | |||
| 1960 | Ga0070665_100041022 | |||
| 1961 | Ga0070665_100224656 | |||
| 1962 | Ga0070665_100893809 | |||
| 1963 | Ga0070704_100139795 | |||
| 1964 | Ga0070704_100637147 | |||
| 1965 | Ga0068855_100001112 | |||
| 1966 | Ga0068855_100031910 | |||
| 1967 | Ga0068855_100046378 | |||
| 1968 | Ga0068855_100106520 | |||
| 1969 | Ga0068855_100169572 | |||
| 1970 | Ga0068855_100201083 | |||
| 1971 | Ga0068855_100215511 | |||
| 1972 | Ga0068855_100259113 | |||
| 1973 | Ga0068855_100354717 | |||
| 1974 | Ga0068855_100965212 | |||
| 1975 | Ga0070664_100004070 | |||
| 1976 | Ga0070664_100004390 | |||
| 1977 | Ga0070664_100007970 | |||
| 1978 | Ga0070664_100015258 | |||
| 1979 | Ga0070664_100040629 | |||
| 1980 | Ga0070664_100056523 | |||
| 1981 | Ga0070664_100299834 | |||
| 1982 | Ga0068857_100001298 | |||
| 1983 | Ga0068857_100042462 | |||
| 1984 | Ga0068857_100062934 | |||
| 1985 | Ga0068857_100064096 | |||
| 1986 | Ga0068857_100113602 | |||
| 1987 | Ga0068857_100166783 | |||
| 1988 | Ga0068854_100000631 | |||
| 1989 | Ga0068854_100003249 | |||
| 1990 | Ga0068854_100005790 | |||
| 1991 | Ga0068854_100020998 | |||
| 1992 | Ga0068854_100048403 | |||
| 1993 | Ga0068854_100097292 | |||
| 1994 | Ga0068854_100537789 | |||
| 1995 | Ga0068854_100563536 | |||
| 1996 | Ga0068856_100009926 | |||
| 1997 | Ga0068856_100033906 | |||
| 1998 | Ga0068856_100146127 | |||
| 1999 | Ga0068856_100174008 | |||
| 2000 | Ga0068856_100196292 | |||
| 2001 | Ga0068856_100555778 | |||
| 2002 | Ga0070702_100003317 | |||
| 2003 | Ga0070702_100063587 | |||
| 2004 | Ga0070702_100087798 | |||
| 2005 | Ga0070702_100099523 | |||
| 2006 | Ga0070702_100260815 | |||
| 2007 | Ga0068852_100006990 | |||
| 2008 | Ga0068852_100029077 | |||
| 2009 | Ga0068852_100057093 | |||
| 2010 | Ga0068852_100078321 | |||
| 2011 | Ga0068852_100508765 | |||
| 2012 | Ga0068852_100674102 | |||
| 2013 | Ga0068859_100004578 | |||
| 2014 | Ga0068859_100005284 | |||
| 2015 | Ga0068859_100015514 | |||
| 2016 | Ga0068859_100023206 | |||
| 2017 | Ga0068859_100034851 | |||
| 2018 | Ga0068859_100036938 | |||
| 2019 | Ga0068859_100037450 | |||
| 2020 | Ga0068859_100168722 | |||
| 2021 | Ga0068859_100169934 | |||
| 2022 | Ga0068859_100575449 | |||
| 2023 | Ga0068864_100000020 | |||
| 2024 | Ga0068864_100001107 | |||
| 2025 | Ga0068864_100003260 | |||
| 2026 | Ga0068864_100006188 | |||
| 2027 | Ga0068864_100081663 | |||
| 2028 | Ga0068864_100315068 | |||
| 2029 | Ga0068866_10000329 | |||
| 2030 | Ga0068866_10009330 | |||
| 2031 | Ga0068866_10078377 | |||
| 2032 | Ga0068861_100001745 | |||
| 2033 | Ga0068851_10002098 | |||
| 2034 | Ga0068851_10124710 | |||
| 2035 | Ga0068851_10136773 | |||
| 2036 | Ga0068870_10000064 | |||
| 2037 | Ga0068863_100000124 | |||
| 2038 | Ga0068863_100000158 | |||
| 2039 | Ga0068863_100002017 | |||
| 2040 | Ga0068863_100005398 | |||
| 2041 | Ga0068863_100018111 | |||
| 2042 | Ga0068863_100084338 | |||
| 2043 | Ga0068863_100090044 | |||
| 2044 | Ga0068863_100106067 | |||
| 2045 | Ga0068863_100189636 | |||
| 2046 | Ga0068863_100510423 | |||
| 2047 | Ga0068858_100000149 | |||
| 2048 | Ga0068858_100001385 | |||
| 2049 | Ga0068858_100017303 | |||
| 2050 | Ga0068858_100020053 | |||
| 2051 | Ga0068858_100021949 | |||
| 2052 | Ga0068858_100027784 | |||
| 2053 | Ga0068858_100057078 | |||
| 2054 | Ga0068858_100124252 | |||
| 2055 | Ga0068858_100290673 | |||
| 2056 | Ga0068858_100360929 | |||
| 2057 | Ga0068858_100599094 | |||
| 2058 | Ga0068860_100000595 | |||
| 2059 | Ga0068860_100000822 | |||
| 2060 | Ga0068860_100002442 | |||
| 2061 | Ga0068860_100012152 | |||
| 2062 | Ga0068860_100014589 | |||
| 2063 | Ga0068860_100015601 | |||
| 2064 | Ga0068860_100024545 | |||
| 2065 | Ga0068860_100674316 | |||
| 2066 | Ga0068862_100000076 | |||
| 2067 | Ga0068862_100001389 | |||
| 2068 | Ga0068862_100005977 | |||
| 2069 | Ga0068862_100048526 | |||
| 2070 | Ga0081455_10004545 | |||
| 2071 | Ga0081455_10025273 | |||
| 2072 | Ga0081455_10143094 | |||
| 2073 | Ga0081540_1000427 | |||
| 2074 | Ga0081540_1002493 | |||
| 2075 | Ga0081539_10001566 | |||
| 2076 | Ga0081539_10007546 | |||
| 2077 | Ga0070717_10010659 | |||
| 2078 | Ga0075365_10165380 | |||
| 2079 | Ga0075368_10095739 | |||
| 2080 | Ga0075364_10039817 | |||
| 2081 | Ga0075432_10108217 | |||
| 2082 | Ga0070716_100165335 | |||
| 2083 | Ga0070712_100017186 | |||
| 2084 | Ga0070712_100188560 | |||
| 2085 | Ga0075362_10000561 | |||
| 2086 | Ga0075362_10097862 | |||
| 2087 | Ga0075366_10175374 | |||
| 2088 | Ga0097621_100003928 | |||
| 2089 | Ga0097621_100030727 | |||
| 2090 | Ga0097621_100058699 | |||
| 2091 | Ga0097621_100150918 | |||
| 2092 | Ga0068871_100017442 | |||
| 2093 | Ga0068871_100050328 | |||
| 2094 | Ga0068871_100307144 | |||
| 2095 | Ga0068871_100430844 | |||
| 2096 | Ga0068871_100599825 | |||
| 2097 | Ga0075428_100056037 | |||
| 2098 | Ga0075431_100025533 | |||
| 2099 | Ga0075433_10002066 | |||
| 2100 | Ga0075434_100250202 | |||
| 2101 | Ga0075429_100318394 | |||
| 2102 | Ga0068865_100000156 | |||
| 2103 | Ga0068865_100020079 | |||
| 2104 | Ga0068865_100307182 | |||
| 2105 | Ga0068865_100378074 | |||
| 2106 | Ga0068865_100477208 | |||
| 2107 | Ga0075436_100123709 | |||
| 2108 | Ga0075436_100151751 | |||
| 2109 | Ga0097620_100004578 | |||
| 2110 | Ga0097620_100005284 | |||
| 2111 | Ga0097620_100015515 | |||
| 2112 | Ga0097620_100023205 | |||
| 2113 | Ga0097620_100034851 | |||
| 2114 | Ga0097620_100036943 | |||
| 2115 | Ga0097620_100037450 | |||
| 2116 | Ga0097620_100168722 | |||
| 2117 | Ga0097620_100169948 | |||
| 2118 | Ga0097620_100219185 | |||
| 2119 | Ga0097620_100575330 | |||
| 2120 | Ga0099794_10084111 | |||
| 2121 | Ga0105251_10051665 | |||
| 2122 | Ga0105240_10008057 | |||
| 2123 | Ga0105240_10009257 | |||
| 2124 | Ga0105240_10025571 | |||
| 2125 | Ga0105240_10033209 | |||
| 2126 | Ga0105240_10046532 | |||
| 2127 | Ga0105240_10081467 | |||
| 2128 | Ga0105240_10203320 | |||
| 2129 | Ga0105240_10657937 | |||
| 2130 | Ga0111539_10011533 | |||
| 2131 | Ga0111539_10975374 | |||
| 2132 | Ga0111539_11087882 | |||
| 2133 | Ga0105245_10000426 | |||
| 2134 | Ga0105245_10006948 | |||
| 2135 | Ga0105245_10031246 | |||
| 2136 | Ga0105245_10121273 | |||
| 2137 | Ga0105245_10159162 | |||
| 2138 | Ga0105245_10192878 | |||
| 2139 | Ga0105245_10198731 | |||
| 2140 | Ga0105247_10003007 | |||
| 2141 | Ga0105247_10016993 | |||
| 2142 | Ga0105247_10091599 | |||
| 2143 | Ga0105247_10453021 | |||
| 2144 | Ga0114129_10209601 | |||
| 2145 | Ga0114129_10434991 | |||
| 2146 | Ga0105243_10001511 | |||
| 2147 | Ga0105243_10002592 | |||
| 2148 | Ga0105243_10031015 | |||
| 2149 | Ga0105243_10121472 | |||
| 2150 | Ga0105243_10136646 | |||
| 2151 | Ga0105243_10253318 | |||
| 2152 | Ga0105243_10631189 | |||
| 2153 | Ga0105241_10001288 | |||
| 2154 | Ga0105241_10002134 | |||
| 2155 | Ga0105241_10005667 | |||
| 2156 | Ga0105241_10124958 | |||
| 2157 | Ga0105241_10156844 | |||
| 2158 | Ga0105241_10492730 | |||
| 2159 | Ga0105242_10022105 | |||
| 2160 | Ga0105242_10234054 | |||
| 2161 | Ga0105242_10243646 | |||
| 2162 | Ga0105242_10250334 | |||
| 2163 | Ga0105242_10497334 | |||
| 2164 | Ga0105248_10001654 | |||
| 2165 | Ga0105248_10018646 | |||
| 2166 | Ga0105248_10078430 | |||
| 2167 | Ga0105248_10080447 | |||
| 2168 | Ga0105248_10356291 | |||
| 2169 | Ga0105248_10726277 | |||
| 2170 | Ga0105237_10000846 | |||
| 2171 | Ga0105237_10005975 | |||
| 2172 | Ga0105237_10017079 | |||
| 2173 | Ga0105237_10045629 | |||
| 2174 | Ga0105237_10060141 | |||
| 2175 | Ga0105237_10116221 | |||
| 2176 | Ga0105237_10182470 | |||
| 2177 | Ga0105237_10385201 | |||
| 2178 | Ga0105237_10485789 | |||
| 2179 | Ga0105238_10000315 | |||
| 2180 | Ga0105238_10000738 | |||
| 2181 | Ga0105238_10000970 | |||
| 2182 | Ga0105238_10001651 | |||
| 2183 | Ga0105238_10007091 | |||
| 2184 | Ga0105238_10055112 | |||
| 2185 | Ga0105238_10058971 | |||
| 2186 | Ga0105238_10059574 | |||
| 2187 | Ga0105238_10204236 | |||
| 2188 | Ga0105249_10001740 | |||
| 2189 | Ga0105249_10008085 | |||
| 2190 | Ga0105249_10025022 | |||
| 2191 | Ga0105249_10026131 | |||
| 2192 | Ga0105249_10828253 | |||
| 2193 | Ga0105239_10003874 | |||
| 2194 | Ga0105239_10012419 | |||
| 2195 | Ga0105239_10023370 | |||
| 2196 | Ga0105239_10033029 | |||
| 2197 | Ga0105239_10071697 | |||
| 2198 | Ga0105239_10098427 | |||
| 2199 | Ga0105239_10135092 | |||
| 2200 | Ga0105239_10252927 | |||
| 2201 | Ga0105239_10266586 | |||
| 2202 | Ga0105239_10326532 | |||
| 2203 | Ga0105239_10447165 | |||
| 2204 | Ga0105239_10695697 | |||
| 2205 | Ga0105246_10184458 | |||
| 2206 | Ga0105246_10350127 | |||
| 2207 | Ga0105246_10411453 | |||
| 2208 | Ga0157327_1005580 | |||
| 2209 | Ga0157373_10003695 | |||
| 2210 | Ga0157373_10009307 | |||
| 2211 | Ga0157371_10000290 | |||
| 2212 | Ga0157371_10021286 | |||
| 2213 | Ga0157371_10026749 | |||
| 2214 | Ga0157371_10066081 | |||
| 2215 | Ga0157371_10281668 | |||
| 2216 | Ga0157370_10024107 | |||
| 2217 | Ga0157370_10034755 | |||
| 2218 | Ga0157370_10038592 | |||
| 2219 | Ga0157370_10051023 | |||
| 2220 | Ga0157370_10053167 | |||
| 2221 | Ga0157369_10004891 | |||
| 2222 | Ga0157369_10025478 | |||
| 2223 | Ga0157369_10055121 | |||
| 2224 | Ga0157369_10073706 | |||
| 2225 | Ga0157369_10174535 | |||
| 2226 | Ga0157369_10642752 | |||
| 2227 | Ga0157374_10034837 | |||
| 2228 | Ga0157374_10043797 | |||
| 2229 | Ga0157374_10145194 | |||
| 2230 | Ga0157374_10246213 | |||
| 2231 | Ga0157378_10000005 | |||
| 2232 | Ga0157378_10004739 | |||
| 2233 | Ga0157378_10033327 | |||
| 2234 | Ga0157378_10051328 | |||
| 2235 | Ga0157378_10052920 | |||
| 2236 | Ga0157378_10235164 | |||
| 2237 | Ga0157378_10760789 | |||
| 2238 | Ga0163162_10000673 | |||
| 2239 | Ga0163162_10001215 | |||
| 2240 | Ga0163162_10020730 | |||
| 2241 | Ga0163162_10066191 | |||
| 2242 | Ga0163162_10081725 | |||
| 2243 | Ga0163162_10102951 | |||
| 2244 | Ga0163162_10109449 | |||
| 2245 | Ga0163162_10526200 | |||
| 2246 | Ga0157372_10000417 | |||
| 2247 | Ga0157372_10072947 | |||
| 2248 | Ga0157372_10115555 | |||
| 2249 | Ga0157372_10117118 | |||
| 2250 | Ga0157372_10139434 | |||
| 2251 | Ga0157372_10205175 | |||
| 2252 | Ga0157372_10493075 | |||
| 2253 | Ga0157372_10528095 | |||
| 2254 | Ga0157372_10703453 | |||
| 2255 | Ga0157372_10986455 | |||
| 2256 | Ga0157375_10109937 | |||
| 2257 | Ga0157375_10574579 | |||
| 2258 | Ga0163163_10000358 | |||
| 2259 | Ga0163163_10001487 | |||
| 2260 | Ga0163163_10009750 | |||
| 2261 | Ga0163163_10046355 | |||
| 2262 | Ga0157380_10009680 | |||
| 2263 | Ga0157380_10052493 | |||
| 2264 | Ga0157380_10190059 | |||
| 2265 | Ga0182008_10040838 | |||
| 2266 | Ga0182008_10090525 | |||
| 2267 | Ga0182008_10253313 | |||
| 2268 | Ga0157377_10002948 | |||
| 2269 | Ga0157377_10004717 | |||
| 2270 | Ga0157377_10018176 | |||
| 2271 | Ga0157377_10176438 | |||
| 2272 | Ga0157379_10000219 | |||
| 2273 | Ga0157379_10001710 | |||
| 2274 | Ga0157379_10028114 | |||
| 2275 | Ga0157379_10190898 | |||
| 2276 | Ga0157379_10284767 | |||
| 2277 | Ga0157379_10392262 | |||
| 2278 | Ga0157376_10005857 | |||
| 2279 | Ga0157376_10019920 | |||
| 2280 | Ga0157376_10027680 | |||
| 2281 | Ga0157376_10092402 | |||
| 2282 | Ga0157376_10501089 | |||
| 2283 | Ga0182006_1002125 | |||
| 2284 | Ga0182006_1114020 | |||
| 2285 | Ga0182007_10004010 | |||
| 2286 | Ga0182007_10009816 | |||
| 2287 | Ga0182007_10014265 | |||
| 2288 | Ga0182005_1001650 | |||
| 2289 | Ga0163161_10013133 | |||
| 2290 | Ga0163161_10179432 | |||
| 2291 | Ga0163161_10428626 | |||
| 2292 | Ga0206356_11636764 | |||
| 2293 | Ga0206353_10673777 | |||
| 2294 | Ga0154015_1664260 | |||
| 2295 | Ga0213872_10002518 | |||
| 2296 | Ga0213872_10005752 | |||
| 2297 | Ga0228598_1001753 | |||
| 2298 | Ga0209435_100015 | |||
| 2299 | Ga0209435_100288 | |||
| 2300 | Ga0209760_101484 | |||
| 2301 | Ga0209784_100004 | |||
| 2302 | Ga0209784_100005 | |||
| 2303 | Ga0209566_100004 | |||
| 2304 | Ga0209566_100005 | |||
| 2305 | Ga0209674_100006 | |||
| 2306 | Ga0209674_100009 | |||
| 2307 | Ga0209674_100249 | |||
| 2308 | Ga0209147_100004 | |||
| 2309 | Ga0209563_100007 | |||
| 2310 | Ga0209563_100009 | |||
| 2311 | Ga0209563_100012 | |||
| 2312 | Ga0207427_100149 | |||
| 2313 | Ga0207427_100485 | |||
| 2314 | Ga0209437_100004 | |||
| 2315 | Ga0209437_100623 | |||
| 2316 | Ga0209437_101358 | |||
| 2317 | Ga0209437_102147 | |||
| 2318 | Ga0209258_100298 | |||
| 2319 | Ga0209258_100391 | |||
| 2320 | Ga0209646_1000040 | |||
| 2321 | Ga0209646_1000105 | |||
| 2322 | Ga0209026_1000034 | |||
| 2323 | Ga0209026_1002619 | |||
| 2324 | Ga0209677_100005 | |||
| 2325 | Ga0209677_100006 | |||
| 2326 | Ga0209677_102934 | |||
| 2327 | Ga0209759_1000234 | |||
| 2328 | Ga0209759_1000569 | |||
| 2329 | Ga0209759_1003262 | |||
| 2330 | Ga0209759_1009116 | |||
| 2331 | Ga0209129_1003748 | |||
| 2332 | Ga0209233_1000005 | |||
| 2333 | Ga0209233_1000046 | |||
| 2334 | Ga0209455_1024715 | |||
| 2335 | Ga0209676_1000214 | |||
| 2336 | Ga0209676_1001207 | |||
| 2337 | Ga0209676_1001472 | |||
| 2338 | Ga0209025_1000217 | |||
| 2339 | Ga0209564_1000518 | |||
| 2340 | Ga0209758_1000007 | |||
| 2341 | Ga0209758_1000246 | |||
| 2342 | Ga0209758_1025772 | |||
| 2343 | Ga0209050_1000412 | |||
| 2344 | Ga0209050_1016288 | |||
| 2345 | Ga0209050_1021718 | |||
| 2346 | Ga0209051_1000150 | |||
| 2347 | Ga0209051_1001731 | |||
| 2348 | Ga0209257_1000275 | |||
| 2349 | Ga0209257_1027391 | |||
| 2350 | Ga0207656_10078311 | |||
| 2351 | Ga0207656_10137601 | |||
| 2352 | Ga0207713_1058962 | |||
| 2353 | Ga0207682_10000195 | |||
| 2354 | Ga0207692_10155699 | |||
| 2355 | Ga0207642_10002118 | |||
| 2356 | Ga0207642_10003463 | |||
| 2357 | Ga0207710_10013630 | |||
| 2358 | Ga0207710_10021487 | |||
| 2359 | Ga0207710_10078286 | |||
| 2360 | Ga0207688_10000941 | |||
| 2361 | Ga0207688_10008007 | |||
| 2362 | Ga0207688_10041064 | |||
| 2363 | Ga0207688_10067336 | |||
| 2364 | Ga0207680_10000139 | |||
| 2365 | Ga0207680_10012162 | |||
| 2366 | Ga0207680_10030483 | |||
| 2367 | Ga0207680_10052954 | |||
| 2368 | Ga0207680_10135755 | |||
| 2369 | Ga0207680_10325307 | |||
| 2370 | Ga0207647_10001601 | |||
| 2371 | Ga0207647_10006149 | |||
| 2372 | Ga0207647_10018431 | |||
| 2373 | Ga0207647_10026218 | |||
| 2374 | Ga0207647_10193919 | |||
| 2375 | Ga0207685_10016666 | |||
| 2376 | Ga0207645_10001126 | |||
| 2377 | Ga0207645_10054434 | |||
| 2378 | Ga0207645_10104429 | |||
| 2379 | Ga0207645_10321824 | |||
| 2380 | Ga0207643_10000016 | |||
| 2381 | Ga0207643_10161337 | |||
| 2382 | Ga0207705_10000103 | |||
| 2383 | Ga0207705_10018494 | |||
| 2384 | Ga0207705_10073161 | |||
| 2385 | Ga0207705_10143497 | |||
| 2386 | Ga0207705_10220347 | |||
| 2387 | Ga0207705_10223869 | |||
| 2388 | Ga0207684_10000047 | |||
| 2389 | Ga0207684_10089073 | |||
| 2390 | Ga0207684_10099982 | |||
| 2391 | Ga0207684_10249305 | |||
| 2392 | Ga0207654_10000465 | |||
| 2393 | Ga0207654_10052584 | |||
| 2394 | Ga0207654_10060903 | |||
| 2395 | Ga0207654_10266698 | |||
| 2396 | Ga0207654_10283850 | |||
| 2397 | Ga0207707_10068750 | |||
| 2398 | Ga0207707_10095782 | |||
| 2399 | Ga0207707_10133932 | |||
| 2400 | Ga0207707_10179584 | |||
| 2401 | Ga0207695_10000573 | |||
| 2402 | Ga0207695_10000692 | |||
| 2403 | Ga0207695_10008225 | |||
| 2404 | Ga0207695_10011367 | |||
| 2405 | Ga0207695_10023120 | |||
| 2406 | Ga0207695_10029200 | |||
| 2407 | Ga0207695_10049343 | |||
| 2408 | Ga0207695_10133319 | |||
| 2409 | Ga0207695_10207643 | |||
| 2410 | Ga0207695_10323282 | |||
| 2411 | Ga0207671_10004004 | |||
| 2412 | Ga0207671_10004486 | |||
| 2413 | Ga0207671_10008804 | |||
| 2414 | Ga0207671_10030356 | |||
| 2415 | Ga0207671_10185971 | |||
| 2416 | Ga0207671_10264815 | |||
| 2417 | Ga0207671_10452994 | |||
| 2418 | Ga0207693_10000589 | |||
| 2419 | Ga0207693_10072584 | |||
| 2420 | Ga0207663_10016219 | |||
| 2421 | Ga0207660_10021224 | |||
| 2422 | Ga0207660_10522756 | |||
| 2423 | Ga0207662_10000003 | |||
| 2424 | Ga0207662_10019928 | |||
| 2425 | Ga0207657_10000009 | |||
| 2426 | Ga0207657_10002371 | |||
| 2427 | Ga0207657_10003372 | |||
| 2428 | Ga0207657_10053293 | |||
| 2429 | Ga0207657_10099027 | |||
| 2430 | Ga0207657_10144866 | |||
| 2431 | Ga0207649_10000275 | |||
| 2432 | Ga0207649_10003334 | |||
| 2433 | Ga0207649_10010372 | |||
| 2434 | Ga0207649_10059933 | |||
| 2435 | Ga0207652_10057060 | |||
| 2436 | Ga0207652_10063748 | |||
| 2437 | Ga0207646_10035640 | |||
| 2438 | Ga0207681_10000362 | |||
| 2439 | Ga0207681_10004343 | |||
| 2440 | Ga0207681_10042876 | |||
| 2441 | Ga0207681_10076669 | |||
| 2442 | Ga0207681_10140936 | |||
| 2443 | Ga0207681_10178151 | |||
| 2444 | Ga0207694_10000128 | |||
| 2445 | Ga0207694_10000505 | |||
| 2446 | Ga0207694_10006279 | |||
| 2447 | Ga0207694_10007293 | |||
| 2448 | Ga0207694_10023433 | |||
| 2449 | Ga0207694_10024178 | |||
| 2450 | Ga0207694_10028217 | |||
| 2451 | Ga0207694_10520965 | |||
| 2452 | Ga0207650_10000025 | |||
| 2453 | Ga0207650_10000692 | |||
| 2454 | Ga0207650_10021626 | |||
| 2455 | Ga0207650_10022454 | |||
| 2456 | Ga0207650_10125334 | |||
| 2457 | Ga0207650_10268968 | |||
| 2458 | Ga0207659_10002164 | |||
| 2459 | Ga0207659_10124115 | |||
| 2460 | Ga0207659_10266995 | |||
| 2461 | Ga0207687_10000184 | |||
| 2462 | Ga0207687_10001005 | |||
| 2463 | Ga0207687_10014501 | |||
| 2464 | Ga0207687_10030914 | |||
| 2465 | Ga0207687_10035875 | |||
| 2466 | Ga0207687_10421197 | |||
| 2467 | Ga0207687_10629811 | |||
| 2468 | Ga0207700_10042359 | |||
| 2469 | Ga0207700_10052903 | |||
| 2470 | Ga0207644_10000063 | |||
| 2471 | Ga0207644_10000394 | |||
| 2472 | Ga0207644_10011338 | |||
| 2473 | Ga0207644_10020788 | |||
| 2474 | Ga0207644_10032906 | |||
| 2475 | Ga0207690_10002703 | |||
| 2476 | Ga0207690_10019874 | |||
| 2477 | Ga0207690_10057867 | |||
| 2478 | Ga0207706_10000283 | |||
| 2479 | Ga0207706_10006684 | |||
| 2480 | Ga0207706_10077774 | |||
| 2481 | Ga0207706_10085325 | |||
| 2482 | Ga0207706_10615217 | |||
| 2483 | Ga0207686_10001013 | |||
| 2484 | Ga0207686_10004410 | |||
| 2485 | Ga0207686_10046620 | |||
| 2486 | Ga0207709_10000708 | |||
| 2487 | Ga0207709_10004486 | |||
| 2488 | Ga0207709_10071277 | |||
| 2489 | Ga0207709_10084664 | |||
| 2490 | Ga0207709_10453607 | |||
| 2491 | Ga0207670_10000805 | |||
| 2492 | Ga0207670_10030039 | |||
| 2493 | Ga0207669_10000292 | |||
| 2494 | Ga0207669_10000331 | |||
| 2495 | Ga0207669_10125716 | |||
| 2496 | Ga0207669_10150555 | |||
| 2497 | Ga0207704_10000761 | |||
| 2498 | Ga0207704_10015537 | |||
| 2499 | Ga0207704_10183674 | |||
| 2500 | Ga0207704_10204749 | |||
| 2501 | Ga0207704_10270914 | |||
| 2502 | Ga0207704_10395005 | |||
| 2503 | Ga0207665_10019597 | |||
| 2504 | Ga0207665_10279987 | |||
| 2505 | Ga0207691_10001649 | |||
| 2506 | Ga0207691_10024020 | |||
| 2507 | Ga0207711_10000157 | |||
| 2508 | Ga0207711_10000291 | |||
| 2509 | Ga0207711_10001136 | |||
| 2510 | Ga0207711_10001959 | |||
| 2511 | Ga0207711_10083588 | |||
| 2512 | Ga0207711_10115778 | |||
| 2513 | Ga0207689_10000009 | |||
| 2514 | Ga0207689_10008955 | |||
| 2515 | Ga0207689_10040023 | |||
| 2516 | Ga0207689_10125276 | |||
| 2517 | Ga0207661_10092935 | |||
| 2518 | Ga0207661_10102334 | |||
| 2519 | Ga0207661_10115324 | |||
| 2520 | Ga0207661_10497480 | |||
| 2521 | Ga0207679_10000458 | |||
| 2522 | Ga0207679_10025262 | |||
| 2523 | Ga0207679_10092308 | |||
| 2524 | Ga0207679_10109447 | |||
| 2525 | Ga0207679_10193017 | |||
| 2526 | Ga0207679_10382166 | |||
| 2527 | Ga0207679_10435874 | |||
| 2528 | Ga0207667_10000001 | |||
| 2529 | Ga0207667_10000444 | |||
| 2530 | Ga0207667_10016347 | |||
| 2531 | Ga0207667_10020050 | |||
| 2532 | Ga0207667_10024289 | |||
| 2533 | Ga0207667_10043989 | |||
| 2534 | Ga0207667_10115403 | |||
| 2535 | Ga0207667_10156409 | |||
| 2536 | Ga0207667_10205533 | |||
| 2537 | Ga0207667_10416538 | |||
| 2538 | Ga0207667_10449987 | |||
| 2539 | Ga0207667_10533435 | |||
| 2540 | Ga0207667_10704729 | |||
| 2541 | Ga0207651_10000183 | |||
| 2542 | Ga0207651_10040815 | |||
| 2543 | Ga0207651_10054872 | |||
| 2544 | Ga0207651_10194689 | |||
| 2545 | Ga0207651_10413227 | |||
| 2546 | Ga0207712_10001593 | |||
| 2547 | Ga0207712_10002835 | |||
| 2548 | Ga0207712_10011209 | |||
| 2549 | Ga0207712_10054026 | |||
| 2550 | Ga0207712_10277417 | |||
| 2551 | Ga0207712_10437856 | |||
| 2552 | Ga0207712_10507913 | |||
| 2553 | Ga0207668_10000165 | |||
| 2554 | Ga0207668_10009504 | |||
| 2555 | Ga0207668_10091926 | |||
| 2556 | Ga0207668_10098026 | |||
| 2557 | Ga0207668_10099090 | |||
| 2558 | Ga0207668_10107899 | |||
| 2559 | Ga0207668_10142820 | |||
| 2560 | Ga0207640_10001565 | |||
| 2561 | Ga0207640_10008836 | |||
| 2562 | Ga0207640_10053191 | |||
| 2563 | Ga0207640_10106284 | |||
| 2564 | Ga0207658_10000008 | |||
| 2565 | Ga0207658_10000141 | |||
| 2566 | Ga0207658_10004695 | |||
| 2567 | Ga0207658_10011172 | |||
| 2568 | Ga0207658_10025007 | |||
| 2569 | Ga0207658_10025524 | |||
| 2570 | Ga0207658_10037857 | |||
| 2571 | Ga0207658_10043470 | |||
| 2572 | Ga0207658_10071615 | |||
| 2573 | Ga0207658_10132789 | |||
| 2574 | Ga0207658_10560325 | |||
| 2575 | Ga0207677_10000028 | |||
| 2576 | Ga0207677_10001996 | |||
| 2577 | Ga0207677_10260649 | |||
| 2578 | Ga0207677_10267264 | |||
| 2579 | Ga0207677_10304942 | |||
| 2580 | Ga0207677_10469875 | |||
| 2581 | Ga0207703_10000050 | |||
| 2582 | Ga0207703_10000730 | |||
| 2583 | Ga0207703_10000775 | |||
| 2584 | Ga0207703_10002326 | |||
| 2585 | Ga0207703_10010882 | |||
| 2586 | Ga0207703_10023963 | |||
| 2587 | Ga0207703_10025290 | |||
| 2588 | Ga0207703_10332347 | |||
| 2589 | Ga0207639_10001036 | |||
| 2590 | Ga0207639_10003764 | |||
| 2591 | Ga0207639_10005208 | |||
| 2592 | Ga0207639_10005329 | |||
| 2593 | Ga0207639_10009099 | |||
| 2594 | Ga0207639_10037840 | |||
| 2595 | Ga0207639_10067422 | |||
| 2596 | Ga0207639_10082217 | |||
| 2597 | Ga0207639_10146153 | |||
| 2598 | Ga0207639_10217772 | |||
| 2599 | Ga0207639_10301156 | |||
| 2600 | Ga0207639_10348395 | |||
| 2601 | Ga0207639_10395414 | |||
| 2602 | Ga0207639_10397056 | |||
| 2603 | Ga0207639_10693795 | |||
| 2604 | Ga0207678_10002449 | |||
| 2605 | Ga0207678_10006228 | |||
| 2606 | Ga0207678_10008968 | |||
| 2607 | Ga0207678_10010216 | |||
| 2608 | Ga0207678_10011956 | |||
| 2609 | Ga0207678_10046182 | |||
| 2610 | Ga0207678_10057773 | |||
| 2611 | Ga0207678_10089763 | |||
| 2612 | Ga0207678_10104114 | |||
| 2613 | Ga0207678_10147235 | |||
| 2614 | Ga0207678_10366960 | |||
| 2615 | Ga0207708_10006313 | |||
| 2616 | Ga0207708_10245596 | |||
| 2617 | Ga0207702_10001345 | |||
| 2618 | Ga0207702_10003495 | |||
| 2619 | Ga0207702_10012547 | |||
| 2620 | Ga0207702_10025685 | |||
| 2621 | Ga0207702_10029127 | |||
| 2622 | Ga0207702_10102507 | |||
| 2623 | Ga0207702_10404403 | |||
| 2624 | Ga0207702_10575685 | |||
| 2625 | Ga0207641_10000118 | |||
| 2626 | Ga0207641_10000193 | |||
| 2627 | Ga0207641_10003787 | |||
| 2628 | Ga0207641_10004315 | |||
| 2629 | Ga0207641_10031368 | |||
| 2630 | Ga0207641_10032091 | |||
| 2631 | Ga0207641_10040969 | |||
| 2632 | Ga0207641_10052521 | |||
| 2633 | Ga0207641_10056001 | |||
| 2634 | Ga0207648_10000279 | |||
| 2635 | Ga0207648_10044153 | |||
| 2636 | Ga0207648_10056971 | |||
| 2637 | Ga0207648_10148462 | |||
| 2638 | Ga0207648_10156359 | |||
| 2639 | Ga0207648_10200762 | |||
| 2640 | Ga0207676_10000024 | |||
| 2641 | Ga0207676_10000312 | |||
| 2642 | Ga0207676_10004121 | |||
| 2643 | Ga0207676_10004895 | |||
| 2644 | Ga0207676_10005657 | |||
| 2645 | Ga0207676_10008079 | |||
| 2646 | Ga0207676_10039477 | |||
| 2647 | Ga0207676_10080263 | |||
| 2648 | Ga0207676_10101118 | |||
| 2649 | Ga0207674_10000103 | |||
| 2650 | Ga0207674_10000881 | |||
| 2651 | Ga0207674_10002555 | |||
| 2652 | Ga0207674_10008403 | |||
| 2653 | Ga0207674_10011957 | |||
| 2654 | Ga0207674_10050271 | |||
| 2655 | Ga0207674_10053743 | |||
| 2656 | Ga0207674_10095789 | |||
| 2657 | Ga0207674_10130942 | |||
| 2658 | Ga0207674_10233707 | |||
| 2659 | Ga0207675_100000005 | |||
| 2660 | Ga0207675_100003128 | |||
| 2661 | Ga0207675_100041220 | |||
| 2662 | Ga0207675_100241708 | |||
| 2663 | Ga0207675_100297415 | |||
| 2664 | Ga0207683_10000089 | |||
| 2665 | Ga0207683_10001013 | |||
| 2666 | Ga0207683_10001682 | |||
| 2667 | Ga0207683_10040657 | |||
| 2668 | Ga0207683_10328249 | |||
| 2669 | Ga0207698_10001282 | |||
| 2670 | Ga0207698_10002146 | |||
| 2671 | Ga0207698_10010548 | |||
| 2672 | Ga0207698_10011002 | |||
| 2673 | Ga0207698_10630146 | |||
| 2674 | Ga0207698_10664284 | |||
| 2675 | Ga0209281_1007736 | |||
| 2676 | Ga0209813_10038558 | |||
| 2677 | Ga0207428_10010847 | |||
| 2678 | Ga0268266_10000001 | |||
| 2679 | Ga0268266_10000559 | |||
| 2680 | Ga0268266_10001954 | |||
| 2681 | Ga0268266_10010714 | |||
| 2682 | Ga0268266_10013898 | |||
| 2683 | Ga0268266_10084764 | |||
| 2684 | Ga0268266_10200327 | |||
| 2685 | Ga0268266_10370867 | |||
| 2686 | Ga0268266_10616766 | |||
| 2687 | Ga0268265_10000054 | |||
| 2688 | Ga0268265_10000538 | |||
| 2689 | Ga0268265_10000598 | |||
| 2690 | Ga0268265_10020292 | |||
| 2691 | Ga0268265_10037420 | |||
| 2692 | Ga0268265_10367365 | |||
| 2693 | Ga0268264_10000173 | |||
| 2694 | Ga0268264_10000323 | |||
| 2695 | Ga0268264_10001476 | |||
| 2696 | Ga0268264_10003353 | |||
| 2697 | Ga0268264_10003867 | |||
| 2698 | Ga0268264_10009955 | |||
| 2699 | Ga0268264_10016107 | |||
| 2700 | Ga0268264_10037615 | |||
| 2701 | Ga0268264_10073259 | |||
| 2702 | Ga0307515_10000154 | |||
| 2703 | Ga0307515_10004744 | |||
| 2704 | Ga0307515_10073073 | |||
| 2705 | Ga0307515_10262275 | |||
| 2706 | Ga0307511_10072246 | |||
| 2707 | Ga0307512_10024522 | |||
| 2708 | Ga0265762_1006198 | |||
| 2709 | Ga0265330_10026996 | |||
| 2710 | Ga0265328_10000305 | |||
| 2711 | Ga0265328_10010362 | |||
| 2712 | Ga0265328_10014633 | |||
| 2713 | Ga0265328_10145334 | |||
| 2714 | Ga0265331_10000005 | |||
| 2715 | Ga0265331_10001445 | |||
| 2716 | Ga0265331_10001990 | |||
| 2717 | Ga0265331_10004390 | |||
| 2718 | Ga0265327_10066157 | |||
| 2719 | Ga0265316_10001750 | |||
| 2720 | Ga0265316_10294962 | |||
| 2721 | Ga0307513_10005286 | |||
| 2722 | Ga0307509_10001286 | |||
| 2723 | Ga0307408_100029787 | |||
| 2724 | Ga0265314_10000595 | |||
| 2725 | Ga0265314_10004707 | |||
| 2726 | Ga0265314_10079146 | |||
| 2727 | Ga0307516_10057185 | |||
| 2728 | Ga0307516_10491163 | |||
| 2729 | Ga0307412_10002057 | |||
| 2730 | Ga0307412_10021192 | |||
| 2731 | Ga0307409_100622917 | |||
| 2732 | Ga0307416_100110706 | |||
| 2733 | Ga0307416_100150505 | |||
| 2734 | Ga0307411_10030049 | |||
| 2735 | Ga0307411_10233142 | |||
| 2736 | Ga0307507_10089135 | |||
| 2737 | Ga0307510_10002924 | |||
| 2738 | Ga0307510_10038410 | |||
| 2739 | Ga0307510_10210097 | |||
| 2740 | Ga0373958_0002456 | |||
| 2741 | Ga0373926_0111039 | |||
| 2742 | Ga0373923_0043737 | |||
| 2743 | Ga0373932_0018271 | |||
| 2744 | Ga0373936_0009456 | |||
| 2745 | Ga0373936_0090957 | |||
| 2746 | Ga0373941_0006795 | |||
| 2747 | Ga0373945_0025975 | |||
| 2748 | Ga0373953_0006322 | |||
| 2749 | Ga0373954_0008296 | |||
| 2750 | Ga0373954_0063653 | |||
| 2751 | Ga0373956_0012525 | |||
| 2752 | Ga0373943_0003378 | |||
| 2753 | Ga0373943_0009425 | |||
| 2754 | Ga0373943_0035578 | |||
| 2755 | Ga0373946_0057194 | |||
| 2756 | Ga0373942_0003016 | |||
| 2757 | Ga0373961_0001242 | |||
| 2758 | Ga0373924_0043006 | |||
| 2759 | Ga0373931_0012753 | |||
| 2760 | Ga0373935_0032485 | |||
| 2761 | Ga0373935_0128506 | |||
| 2762 | Ga0373927_0003672 | |||
| 2763 | Ga0373927_0096268 | |||
| 2764 | Ga0373927_0170458 | |||
| 2765 | Ga0373933_0117769 | |||
| 2766 | Ga0373947_0001397 | |||
| 2767 | Ga0373947_0106013 | |||
| 2768 | Ga0373937_0009697 | |||
| 2769 | Ga0373937_0352850 | |||
| 2770 | Ga0316584_0205226 | |||
| 2771 | Ga0373925_0003939 | |||
| 2772 | Ga0373925_0011747 | |||
| 2773 | Ga0373925_0183437 | |||
| 2774 | Ga0395899_0001400 | |||
| 2775 | Ga0395899_0004896 | |||
| 2776 | Ga0395899_0099577 | |||
| 2777 | Ga0395899_0162548 | |||
| 2778 | Ga0395899_0180807 | |||
| 2779 | Ga0395900_0003405 | |||
| 2780 | Ga0395900_0014128 | |||
| 2781 | Ga0395900_0019708 | |||
| 2782 | Ga0395900_0053959 | |||
| 2783 | Ga0395900_0080388 | |||
| 2784 | Ga0395900_0121199 | |||
| 2785 | Ga0395900_0125446 | |||
| 2786 | Ga0395900_0174570 | |||
| 2787 | Ga0395900_0533252 | |||
| 2788 | Ga0395898_0003681 | |||
| 2789 | Ga0395898_0008334 | |||
| 2790 | Ga0395898_0012207 | |||
| 2791 | Ga0395898_0015516 | |||
| 2792 | Ga0395898_0033102 | |||
| 2793 | Ga0395898_0049703 | |||
| 2794 | Ga0395898_0069491 | |||
| 2795 | Ga0395898_0132814 | |||
| 2796 | Ga0395905_0009017 | |||
| 2797 | Ga0395905_0012637 | |||
| 2798 | Ga0395905_0015530 | |||
| 2799 | Ga0395905_0025270 | |||
| 2800 | Ga0395905_0025886 | |||
| 2801 | Ga0395905_0031850 | |||
| 2802 | Ga0395905_0083763 | |||
| 2803 | Ga0395905_0244718 | |||
| 2804 | Ga0395905_0523020 | |||
| 2805 | Ga0436364_0748271 | |||
| 2806 | Ga0395901_0000715 | |||
| 2807 | Ga0395901_0001760 | |||
| 2808 | Ga0395901_0072646 | |||
| 2809 | Ga0395901_0198955 | |||
| 2810 | Ga0395901_0433200 | |||
| 2811 | Ga0395901_0681071 | |||
| 2812 | Ga0395901_0766522 | |||
| 2813 | Ga0436365_0476052 | |||
| 2814 | Ga0436361_0129708 | |||
| 2815 | Ga0436361_0663813 | |||
| 2816 | Ga0436361_0928183 | |||
| 2817 | Ga0436363_0216924 | |||
| 2818 | Ga0436363_0283319 | |||
| 2819 | Ga0439436_0002769 | |||
| 2820 | Ga0439439_0020708 | |||
| 2821 | Ga0451787_683669 | |||
| 2822 | Ga0451789_0622405 | |||
| 2823 | Ga0451793_1344463 | |||
| 2824 | Ga0451800_0389109 | |||
| 2825 | Ga0451802_0053535 | |||
| 2826 | Ga0451837_1160533 | |||
| 2827 | Ga0439448_0004510 | |||
| 2828 | Ga0450906_004168 | |||
| 2829 | Ga0439458_0003180 | |||
| 2830 | Ga0439458_0016138 | |||
| 2831 | Ga0451577_0010744 | |||
| 2832 | Ga0466969_0014983 | |||
| 2833 | Ga0466972_0003347 | |||
| 2834 | Ga0466972_0010376 | |||
| 2835 | Ga0453683_0010101 | |||
| 2836 | Ga0466965_0005619 | |||
| 2837 | Ga0466966_0006129 | |||
| 2838 | Ga0466966_0019399 | |||
| 2839 | Ga0466966_0076585 | |||
| 2840 | Ga0466966_0133242 | |||
| 2841 | Ga0466961_0218336 | |||
| 2842 | Ga0466963_0018485 | |||
| 2843 | Ga0466963_0079955 | |||
| 2844 | Ga0466964_0000235 | |||
| 2845 | Ga0453684_0208094 | |||
| 2846 | Ga0466971_0216808 | |||
| 2847 | Ga0466968_0000415 | |||
| 2848 | Ga0466968_0007387 | |||
| 2849 | Ga0466970_0333302 | |||
| 2850 | Ga0466957_0000271 | |||
| 2851 | Ga0466957_0009540 | |||
| 2852 | Ga0466957_0072442 | |||
| 2853 | Ga0466960_0250857 | |||
| 2854 | Ga0466959_0002938 | |||
| 2855 | Ga0466959_0006494 | |||
| 2856 | Ga0466959_0006800 | |||
| 2857 | Ga0466959_0156857 | |||
| 2858 | Ga0451576_0001258 | |||
| 2859 | Ga0451576_0054023 | |||
| 2860 | Ga0451576_0278462 | |||
| 2861 | Ga0466958_0106493 | |||
| 2862 | Ga0466958_0227851 | |||
| 2863 | Ga0466967_0008678 | |||
| 2864 | Ga0466967_0082919 | |||
| 2865 | Ga0466967_0114991 | |||
| 2866 | Ga0466967_0191822 | |||
| 2867 | Ga0466967_0219628 | |||
| 2868 | Ga0466967_0819173 | |||
| 2869 | Ga0466967_1090519 | |||
| 2870 | Ga0495627_001489 | |||
| 2871 | Ga0495603_0065699 | |||
| 2872 | Ga0495603_0229061 | |||
| 2873 | Ga0495590_0000245 | |||
| 2874 | Ga0495590_0000893 | |||
| 2875 | Ga0495629_0011583 | |||
| 2876 | Ga0495629_0270571 | |||
| 2877 | Ga0495638_0000439 | |||
| 2878 | Ga0495638_0008167 | |||
| 2879 | Ga0495641_0067069 | |||
| 2880 | Ga0495641_0090628 | |||
| 2881 | Ga0495651_0001138 | |||
| 2882 | Ga0495651_0012632 | |||
| 2883 | Ga0495651_0031145 | |||
| 2884 | Ga0495651_0076662 | |||
| 2885 | Ga0495653_0007087 | |||
| 2886 | Ga0495653_0071517 | |||
| 2887 | Ga0495650_0000075 | |||
| 2888 | Ga0495650_0000215 | |||
| 2889 | Ga0495650_0033470 | |||
| 2890 | Ga0495650_0072877 | |||
| 2891 | Ga0495580_0076149 | |||
| 2892 | Ga0495582_0032532 | |||
| 2893 | Ga0495605_0000027 | |||
| 2894 | Ga0495605_0138811 | |||
| 2895 | Ga0495639_0076887 | |||
| 2896 | Ga0495662_0153159 | |||
| 2897 | Ga0495664_0007128 | |||
| 2898 | Ga0495664_0101700 | |||
| 2899 | Ga0495584_0001461 | |||
| 2900 | Ga0495584_0016429 | |||
| 2901 | Ga0495584_0019698 | |||
| 2902 | Ga0495584_0055561 | |||
| 2903 | Ga0495585_0064413 | |||
| 2904 | Ga0495585_0162785 | |||
| 2905 | Ga0495596_0032957 | |||
| 2906 | Ga0495596_0102211 | |||
| 2907 | Ga0495607_0000337 | |||
| 2908 | Ga0495607_0000754 | |||
| 2909 | Ga0495607_0004634 | |||
| 2910 | Ga0495607_0006533 | |||
| 2911 | Ga0495583_0000071 | |||
| 2912 | Ga0495583_0000122 | |||
| 2913 | Ga0495606_0000497 | |||
| 2914 | Ga0495606_0001806 | |||
| 2915 | Ga0495606_0004505 | |||
| 2916 | Ga0495606_0007233 | |||
| 2917 | Ga0495606_0110074 | |||
| 2918 | Ga0495608_0047614 | |||
| 2919 | Ga0495610_0004566 | |||
| 2920 | Ga0495610_0005943 | |||
| 2921 | Ga0495616_0000088 | |||
| 2922 | Ga0495616_0000318 | |||
| 2923 | Ga0495616_0001828 | |||
| 2924 | Ga0495616_0009569 | |||
| 2925 | Ga0495616_0022784 | |||
| 2926 | Ga0495616_0054343 | |||
| 2927 | Ga0495616_0115293 | |||
| 2928 | Ga0495618_0034445 | |||
| 2929 | Ga0495628_0001036 | |||
| 2930 | Ga0495628_0006847 | |||
| 2931 | Ga0495628_0118398 | |||
| 2932 | Ga0495628_0173989 | |||
| 2933 | Ga0495630_0075746 | |||
| 2934 | Ga0495631_0012715 | |||
| 2935 | Ga0495631_0047094 | |||
| 2936 | Ga0495631_0112480 | |||
| 2937 | Ga0495632_0000385 | |||
| 2938 | Ga0495632_0002332 | |||
| 2939 | Ga0495643_0000154 | |||
| 2940 | Ga0495643_0047939 | |||
| 2941 | Ga0495648_0034989 | |||
| 2942 | Ga0495663_0002266 | |||
| 2943 | Ga0495666_0011560 | |||
| 2944 | Ga0495666_0162121 | |||
| 2945 | Ga0495642_0020879 | |||
| 2946 | Ga0495642_0025329 | |||
| 2947 | Ga0495652_0007912 | |||
| 2948 | Ga0495652_0011509 | |||
| 2949 | Ga0495652_0097503 | |||
| 2950 | Ga0495665_0001290 | |||
| 2951 | Ga0495665_0034208 | |||
| 2952 | Ga0495665_0235598 | |||
| 2953 | Ga0495587_0011313 | |||
| 2954 | Ga0495587_0046603 | |||
| 2955 | Ga0495609_0000009 | |||
| 2956 | Ga0495609_0000124 | |||
| 2957 | Ga0495621_0001362 | |||
| 2958 | Ga0495621_0148442 | |||
| 2959 | Ga0495597_0142981 | |||
| 2960 | Ga0495645_0003363 | |||
| 2961 | Ga0495645_0058688 | |||
| 2962 | Ga0495645_0066983 | |||
| 2963 | Ga0495622_0000007 | |||
| 2964 | Ga0495622_0000427 | |||
| 2965 | Ga0495622_0001376 | |||
| 2966 | Ga0495622_0026543 | |||
| 2967 | Ga0495656_0270363 | |||
| 2968 | Ga0495668_0023138 | |||
| 2969 | Ga0495668_0067119 | |||
| 2970 | Ga0495634_0076029 | |||
| 2971 | Ga0495625_0020935 | |||
| 2972 | Ga0495625_0024501 | |||
| 2973 | Ga0495625_0039388 | |||
| 2974 | Ga0495635_0019638 | |||
| 2975 | Ga0495635_0156531 | |||
| 2976 | Ga0495661_0000032 | |||
| 2977 | Ga0495661_0000094 | |||
| 2978 | Ga0495661_0004034 | |||
| 2979 | Ga0495661_0005699 | |||
| 2980 | Ga0495661_0032246 | |||
| 2981 | Ga0495661_0147829 | |||
| 2982 | Ga0495588_0000055 | |||
| 2983 | Ga0495657_0076494 | |||
| 2984 | Ga0495657_0103445 | |||
| 2985 | Ga0495599_0004365 | |||
| 2986 | Ga0495623_0008428 | |||
| 2987 | Ga0495623_0042669 | |||
| 2988 | Ga0495646_0000769 | |||
| 2989 | Ga0495646_0101233 | |||
| 2990 | Ga0495658_0058970 | |||
| 2991 | Ga0495658_0503193 | |||
| 2992 | Ga0495669_0184053 | |||
| 2993 | Ga0495624_0003522 | |||
| 2994 | Ga0495624_0067380 | |||
| 2995 | Ga0495670_0006312 | |||
| 2996 | Ga0495670_0097903 | |||
| 2997 | Ga0495671_0022016 | |||
| 2998 | Ga0495649_0000286 | |||
| 2999 | Ga0495589_0000019 | |||
| 3000 | Ga0495589_0000148 | |||
| 3001 | Ga0495589_0046879 | |||
| 3002 | Ga0495600_0000302 | |||
| 3003 | Ga0495600_0000460 | |||
| 3004 | Ga0495660_0004474 | |||
| 3005 | Ga0495581_0001785 | |||
| 3006 | Ga0495581_0018356 | |||
| 3007 | Ga0495604_0083846 | |||
| 3008 | Ga0495604_0095241 | |||
| 3009 | Ga0495604_0138144 | |||
| 3010 | Ga0495674_0077717 | |||
| 3011 | Ga0495676_0246741 | |||
| 3012 | Ga0495680_0167858 | |||
| 3013 | Ga0495683_0205411 | |||
| 3014 | Ga0495687_000024 | |||
| 3015 | Ga0495687_000046 | |||
| 3016 | Ga0495687_000132 | |||
| 3017 | Ga0495687_000947 | |||
| 3018 | Ga0495675_0255198 | |||
| 3019 | Ga0495677_0000018 | |||
| 3020 | Ga0495677_0000059 | |||
| 3021 | Ga0495677_0000476 | |||
| 3022 | Ga0495677_0018821 | |||
| 3023 | Ga0495677_0044344 | |||
| 3024 | Ga0495673_0000163 | |||
| 3025 | Ga0495673_0000199 | |||
| 3026 | Ga0495681_0170031 | |||
| 3027 | Ga0495684_0006624 | |||
| 3028 | Ga0495686_0001232 | |||
| 3029 | Ga0495686_0008573 | |||
| 3030 | Ga0495593_0007919 | |||
| 3031 | Ga0495593_0024798 | |||
| 3032 | Ga0495593_0126683 | |||
| 3033 | Ga0495602_0011414 | |||
| 3034 | Ga0495602_0049139 | |||
| 3035 | Ga0495602_0056928 | |||
| 3036 | Ga0495602_0187276 | |||
| 3037 | Ga0495626_0000054 | |||
| 3038 | Ga0495626_0000683 | |||
| 3039 | Ga0495626_0001301 | |||
| 3040 | Ga0495626_0028157 | |||
| 3041 | Ga0496100_0497442 | |||
| 3042 | Ga0496101_0030143 | |||
| 3043 | Ga0496101_0722822 | |||
| 3044 | Ga0496102_0003046 | |||
| 3045 | Ga0496102_0669119 | |||
| 3046 | Ga0496103_0051171 | |||
| 3047 | Ga0496103_0208136 | |||
| 3048 | Ga0496103_0239513 | |||
| 3049 | Ga0496105_0288617 | |||
| 3050 | Ga0496106_0064665 | |||
| 3051 | Ga0496106_0275132 | |||
| 3052 | Ga0496106_0361909 | |||
| 3053 | Ga0496107_0000027 | |||
| 3054 | Ga0496107_0100304 | |||
| 3055 | Ga0496107_0199673 | |||
| 3056 | Ga0496108_0724010 | |||
| 3057 | Ga0496109_0003908 | |||
| 3058 | Ga0496109_0009801 | |||
| 3059 | Ga0496109_0023139 | |||
| 3060 | Ga0496109_0149227 | |||
| 3061 | Ga0496109_0251673 | |||
| 3062 | Ga0496109_0394737 | |||
| 3063 | Ga0496109_0454945 | |||
| 3064 | Ga0496110_0009845 | |||
| 3065 | Ga0496110_0052917 | |||
| 3066 | Ga0496110_0088567 | |||
| 3067 | Ga0496110_0681512 | |||
| 3068 | Ga0496110_0742893 | |||
| 3069 | Ga0496111_0007923 | |||
| 3070 | Ga0496112_0001433 | |||
| 3071 | Ga0496112_0002904 | |||
| 3072 | Ga0496112_0051152 | |||
| 3073 | Ga0496112_0190148 | |||
| 3074 | Ga0496113_0011411 | |||
| 3075 | Ga0496113_0101328 | |||
| 3076 | Ga0496114_0038708 | |||
| 3077 | Ga0496114_0106590 | |||
| 3078 | Ga0496114_0151381 | |||
| 3079 | Ga0496114_0201638 | |||
| 3080 | Ga0496115_0000002 | |||
| 3081 | Ga0496115_0014651 | |||
| 3082 | Ga0496115_0208790 | |||
| 3083 | Ga0496116_0014477 | |||
| 3084 | Ga0496116_0034118 | |||
| 3085 | Ga0496116_0130384 | |||
| 3086 | Ga0496118_0000559 | |||
| 3087 | Ga0496118_0000565 | |||
| 3088 | Ga0496118_0003882 | |||
| 3089 | Ga0496118_0009060 | |||
| 3090 | Ga0496118_0150034 | |||
| 3091 | Ga0496120_0096251 | |||
| 3092 | Ga0496121_0000059 | |||
| 3093 | Ga0496121_0000763 | |||
| 3094 | Ga0496121_0063308 | |||
| 3095 | Ga0496121_0243345 | |||
| 3096 | Ga0496122_0000501 | |||
| 3097 | Ga0496122_0002154 | |||
| 3098 | Ga0496122_0002573 | |||
| 3099 | Ga0496123_0000029 | |||
| 3100 | Ga0496123_0002577 | |||
| 3101 | Ga0496123_0074939 | |||
| 3102 | Ga0496124_0000226 | |||
| 3103 | Ga0496124_0000306 | |||
| 3104 | Ga0496124_0004880 | |||
| 3105 | Ga0496124_0031755 | |||
| 3106 | Ga0496125_0005346 | |||
| 3107 | Ga0496125_0024695 | |||
| 3108 | Ga0496125_0171540 | |||
| 3109 | Ga0496125_0267672 | |||
| 3110 | Ga0496126_0000052 | |||
| 3111 | Ga0496126_0019169 | |||
| 3112 | Ga0496126_0067028 | |||
| 3113 | Ga0496126_0168660 | |||
| 3114 | Ga0496126_0548948 | |||
| 3115 | Ga0501309_002235 | |||
| 3116 | Ga0495678_001117 | |||
| 3117 | Ga0495678_002508 | |||
| 3118 | Ga0495678_005616 | |||
| 3119 | Ga0495682_0008940 | |||
| 3120 | Ga0495682_0028829 | |||
| 3121 | Ga0501292_006670 | |||
| 3122 | Ga0501031_0002712 | |||
| 3123 | Ga0501031_0078143 | |||
| 3124 | Ga0501031_0109746 | |||
| 3125 | Ga0501032_0006069 | |||
| 3126 | Ga0501032_0011007 | |||
| 3127 | Ga0501032_0012880 | |||
| 3128 | Ga0501032_0084696 | |||
| 3129 | Ga0501032_0732474 | |||
| 3130 | Ga0501033_0003340 | |||
| 3131 | Ga0501033_0042973 | |||
| 3132 | Ga0501033_0117854 | |||
| 3133 | Ga0501033_0135239 | |||
| 3134 | Ga0501034_0000242 | |||
| 3135 | Ga0501034_0000245 | |||
| 3136 | Ga0501034_0005369 | |||
| 3137 | Ga0501034_0006882 | |||
| 3138 | Ga0501034_0014233 | |||
| 3139 | Ga0501036_0011156 | |||
| 3140 | Ga0501036_0101038 | |||
| 3141 | Ga0501036_0115335 | |||
| 3142 | Ga0501036_0175700 | |||
| 3143 | Ga0501036_0387272 | |||
| 3144 | Ga0501036_0586298 | |||
| 3145 | Ga0501037_0004205 | |||
| 3146 | Ga0501037_0017736 | |||
| 3147 | Ga0501037_0024296 | |||
| 3148 | Ga0501037_0101560 | |||
| 3149 | Ga0501037_0153391 | |||
| 3150 | Ga0501037_0201653 | |||
| 3151 | Ga0501037_0253082 | |||
| 3152 | Ga0501038_0002716 | |||
| 3153 | Ga0501038_0004923 | |||
| 3154 | Ga0501038_0011201 | |||
| 3155 | Ga0501038_0030294 | |||
| 3156 | Ga0501038_0084083 | |||
| 3157 | Ga0501038_0175774 | |||
| 3158 | Ga0501038_0352330 | |||
| 3159 | Ga0501039_0010025 | |||
| 3160 | Ga0501039_0010465 | |||
| 3161 | Ga0501039_0020230 | |||
| 3162 | Ga0501039_0069685 | |||
| 3163 | Ga0501039_0142408 | |||
| 3164 | Ga0501039_0271286 | |||
| 3165 | Ga0501040_0077616 | |||
| 3166 | Ga0501040_0078028 | |||
| 3167 | Ga0501040_0229025 | |||
| 3168 | Ga0501040_0268897 | |||
| 3169 | Ga0501040_0323391 | |||
| 3170 | Ga0501040_0325569 | |||
| 3171 | Ga0501041_0017939 | |||
| 3172 | Ga0501041_0018502 | |||
| 3173 | Ga0501041_0243055 | |||
| 3174 | Ga0501042_0008235 | |||
| 3175 | Ga0501042_0041030 | |||
| 3176 | Ga0501042_0113169 | |||
| 3177 | Ga0501042_0120129 | |||
| 3178 | Ga0501043_0002911 | |||
| 3179 | Ga0501043_0041516 | |||
| 3180 | Ga0501043_0048633 | |||
| 3181 | Ga0501043_0098165 | |||
| 3182 | Ga0501043_0137542 | |||
| 3183 | Ga0501043_0472679 | |||
| 3184 | Ga0501043_0482858 | |||
| 3185 | Ga0501043_0494370 | |||
| 3186 | Ga0501046_0006273 | |||
| 3187 | Ga0501046_0028467 | |||
| 3188 | Ga0501046_0036929 | |||
| 3189 | Ga0501046_0131771 | |||
| 3190 | Ga0501046_0132074 | |||
| 3191 | Ga0501046_0174670 | |||
| 3192 | Ga0501046_0180154 | |||
| 3193 | Ga0501046_0393622 | |||
| 3194 | Ga0501047_0000054 | |||
| 3195 | Ga0501047_0000530 | |||
| 3196 | Ga0501047_0001045 | |||
| 3197 | Ga0501047_0001922 | |||
| 3198 | Ga0501047_0010962 | |||
| 3199 | Ga0501047_0019383 | |||
| 3200 | Ga0501047_0037961 | |||
| 3201 | Ga0501047_0107100 | |||
| 3202 | Ga0501047_0136566 | |||
| 3203 | Ga0501047_0151061 | |||
| 3204 | Ga0501047_0244419 | |||
| 3205 | Ga0501047_0396114 | |||
| 3206 | Ga0501048_0033223 | |||
| 3207 | Ga0501067_0000246 | |||
| 3208 | Ga0501067_0001614 | |||
| 3209 | Ga0501067_0262370 | |||
| 3210 | Ga0501068_0001112 | |||
| 3211 | Ga0501068_0042130 | |||
| 3212 | Ga0501068_0045491 | |||
| 3213 | Ga0501068_0092243 | |||
| 3214 | Ga0501069_0001146 | |||
| 3215 | Ga0501069_0042165 | |||
| 3216 | Ga0501070_0001709 | |||
| 3217 | Ga0501070_0022433 | |||
| 3218 | Ga0501070_0040094 | |||
| 3219 | Ga0501070_0588875 | |||
| 3220 | Ga0501071_0016873 | |||
| 3221 | Ga0501071_0059742 | |||
| 3222 | Ga0501071_0096852 | |||
| 3223 | Ga0501072_0000311 | |||
| 3224 | Ga0501072_0042779 | |||
| 3225 | Ga0501072_0050205 | |||
| 3226 | Ga0501072_0089288 | |||
| 3227 | Ga0501072_0107511 | |||
| 3228 | Ga0501073_0005005 | |||
| 3229 | Ga0501073_0009083 | |||
| 3230 | Ga0501073_0013151 | |||
| 3231 | Ga0501073_0052608 | |||
| 3232 | Ga0501073_0083452 | |||
| 3233 | Ga0501073_0188684 | |||
| 3234 | Ga0501073_0280077 | |||
| 3235 | Ga0501074_0052622 | |||
| 3236 | Ga0501075_0001489 | |||
| 3237 | Ga0501075_0069062 | |||
| 3238 | Ga0501076_0015138 | |||
| 3239 | Ga0501076_0291253 | |||
| 3240 | Ga0501077_0002291 | |||
| 3241 | Ga0501077_0057276 | |||
| 3242 | Ga0501077_0075324 | |||
| 3243 | Ga0501077_0153892 | |||
| 3244 | Ga0501079_0002396 | |||
| 3245 | Ga0501079_0109044 | |||
| 3246 | Ga0501079_0170978 | |||
| 3247 | Ga0501079_0314632 | |||
| 3248 | Ga0501080_0000041 | |||
| 3249 | Ga0501080_0000948 | |||
| 3250 | Ga0501080_0019336 | |||
| 3251 | Ga0501080_0034009 | |||
| 3252 | Ga0501080_0044991 | |||
| 3253 | Ga0501080_0147707 | |||
| 3254 | Ga0501080_0181785 | |||
| 3255 | Ga0501080_0280712 | |||
| 3256 | Ga0501081_0026718 | |||
| 3257 | Ga0501081_0029564 | |||
| 3258 | Ga0501081_0097941 | |||
| 3259 | Ga0501081_0105657 | |||
| 3260 | Ga0501081_0119993 | |||
| 3261 | Ga0501081_0312421 | |||
| 3262 | Ga0501083_0000540 | |||
| 3263 | Ga0501083_0010398 | |||
| 3264 | Ga0501083_0153110 | |||
| 3265 | Ga0501035_0000020 | |||
| 3266 | Ga0501035_0008087 | |||
| 3267 | Ga0501035_0032641 | |||
| 3268 | Ga0501035_0039185 | |||
| 3269 | Ga0501044_0000007 | |||
| 3270 | Ga0501044_0001497 | |||
| 3271 | Ga0501044_0004637 | |||
| 3272 | Ga0501044_0005669 | |||
| 3273 | Ga0501044_0005977 | |||
| 3274 | Ga0501044_0055955 | |||
| 3275 | Ga0501044_0472832 | |||
| 3276 | Ga0501045_0044337 | |||
| 3277 | Ga0501045_0108382 | |||
| 3278 | Ga0501045_0195520 | |||
| 3279 | Ga0501045_0310082 | |||
| 3280 | Ga0501045_0435684 | |||
| 3281 | nmdc:mga0yw44_112785_c1 | |||
| 3282 | nmdc:mga0yw44_27614_c1 | |||
| 3283 | nmdc:mga07m45_2441_c1 | |||
| 3284 | nmdc:mga05p37_87743_c1 | |||
| 3285 | nmdc:mga06r32_98492_c1 | |||
| 3286 | nmdc:mga08y16_336973_c1 | |||
| 3287 | nmdc:mga08y16_4539_c1 | |||
| 3288 | nmdc:mga0n895_111129_c1 | |||
| 3289 | nmdc:mga0n895_1836_c1 | |||
| 3290 | nmdc:mga0n895_209183_c1 | |||
| 3291 | nmdc:mga0n895_481473_c1 | |||
| 3292 | nmdc:mga0rr50_162534_c1 | |||
| 3293 | nmdc:mga08x19_302481_c1 | |||
| 3294 | nmdc:mga0a205_256861_c1 | |||
| 3295 | nmdc:mga0a205_2579_c1 | |||
| 3296 | nmdc:mga0a205_688321_c1 | |||
| 3297 | Ga0495601_0000619 | |||
| 3298 | Ga0495601_0027002 | |||
| 3299 | Ga0495601_0080021 | |||
| 3300 | Ga0495601_0105027 | |||
| 3301 | Ga0495601_0370724 | |||
| 3302 | Ga0495612_0049443 | |||
| 3303 | Ga0495612_0059876 | |||
| 3304 | Ga0500610_0000267 | |||
| 3305 | Ga0500635_0000599 | |||
| 3306 | Ga0500635_0006359 | |||
| 3307 | Ga0495595_0094456 | |||
| 3308 | Ga0495619_0010992 | |||
| 3309 | Ga0495619_0063579 | |||
| 3310 | Ga0495619_0113389 | |||
| 3311 | Ga0495619_0276924 | |||
| 3312 | Ga0500578_0000159 | |||
| 3313 | Ga0500578_0226560 | |||
| 3314 | Ga0500643_022601 | |||
| 3315 | Ga0500646_0057531 | |||
| 3316 | Ga0500583_0033904 | |||
| 3317 | Ga0500651_0000152 | |||
| 3318 | Ga0500651_0026080 | |||
| 3319 | Ga0500555_048049 | |||
| 3320 | Ga0500556_0003675 | |||
| 3321 | Ga0500562_015873 | |||
| 3322 | Ga0500572_035346 | |||
| 3323 | Ga0500594_0008119 | |||
| 3324 | Ga0500595_001693 | |||
| 3325 | Ga0500595_003554 | |||
| 3326 | Ga0500595_004549 | |||
| 3327 | Ga0500597_000644 | |||
| 3328 | Ga0500608_009663 | |||
| 3329 | Ga0500614_000810 | |||
| 3330 | Ga0500642_0151645 | |||
| 3331 | Ga0500559_0000134 | |||
| 3332 | Ga0500559_0013982 | |||
| 3333 | Ga0500559_0089463 | |||
| 3334 | Ga0500568_0006484 | |||
| 3335 | Ga0500574_000582 | |||
| 3336 | Ga0500590_030679 | |||
| 3337 | Ga0500616_0001521 | |||
| 3338 | Ga0500616_0006629 | |||
| 3339 | Ga0500616_0056629 | |||
| 3340 | Ga0500619_000197 | |||
| 3341 | Ga0500622_0001649 | |||
| 3342 | Ga0500622_0013626 | |||
| 3343 | Ga0500636_0002608 | |||
| 3344 | Ga0500636_0004757 | |||
| 3345 | Ga0500636_0025332 | |||
| 3346 | Ga0500637_0193605 | |||
| 3347 | Ga0500645_043222 | |||
| 3348 | Ga0500596_000833 | |||
| 3349 | Ga0501084_0026615 | |||
| 3350 | Ga0501084_0077867 | |||
| 3351 | Ga0501084_0095591 | |||
| 3352 | Ga0501084_0102949 | |||
| 3353 | Ga0500661_001796 | |||
| 3354 | Ga0587077_021922 | |||
| 3355 | Ga0501082_0000055 | |||
| 3356 | Ga0501082_0008399 | |||
| 3357 | Ga0501082_0010362 | |||
| 3358 | Ga0501082_0013384 | |||
| 3359 | Ga0501082_0062907 | |||
| 3360 | Ga0501082_0124504 | |||
| 3361 | Ga0501082_0174214 | |||
| 3362 | Ga0501082_0202445 | |||
| 3363 | Ga0466962_0057076 | |||
| 3364 | Ga0530510_0051863 | |||
| 3365 | Ga0530510_0272557 | |||
| 3366 | Ga0530510_0504912 | |||
| 3367 | 2501082551 | |||
| 3368 | 2501408500 | |||
| 3369 | 2511086115 | |||
| 3370 | 2511096234 | |||
| 3371 | 2511103043 | |||
| 3372 | 2511123262 | |||
| 3373 | 2511250699 | |||
| 3374 | 2511383157 | |||
| 3375 | 2513556425 | |||
| 3376 | 2513564445 | |||
| 3377 | 2513999798 | |||
| 3378 | 2521557177 | |||
| 3379 | 2550696552 | |||
| 3380 | 2553007701 | |||
| 3381 | 2585148116 | |||
| 3382 | 2585270420 | |||
| 3383 | 2585387752 | |||
| 3384 | 2585397939 | |||
| 3385 | 2643926618 | |||
| 3386 | 2644168236 | |||
| 3387 | 2644302001 | |||
| 3388 | 2644348928 | |||
| 3389 | 2676476635 | |||
| 3390 | 2721025362 | |||
| 3391 | 2792746261 | |||
| 3392 | 2808983385 | |||
| 3393 | 2809128614 | |||
| 3394 | 2809148235 | |||
| 3395 | 2810362959 | |||
| 3396 | 2819543941 | |||
| 3397 | 2819564385 | |||
| 3398 | 2819591907 | |||
| 3399 | 2819617028 | |||
| 3400 | 2819618666 | |||
| 3401 | 2827630638 | |||
| 3402 | 2837683533 | |||
| 3403 | 2842526370 | |||
| 3404 | 2842915831 | |||
| 3405 | 2852620343 | |||
| 3406 | 2856292673 | |||
| 3407 | 2857360875 | |||
| 3408 | 2883087930 | |||
| 3409 | 2884219490 | |||
| 3410 | 2884812893 | |||
| 3411 | 2884840681 | |||
| 3412 | 2884855938 | |||
| 3413 | 2894821435 | |||
| 3414 | 2896157137 | |||
| 3415 | 2904440114 | |||
| 3416 | 2904442630 | |||
| 3417 | 2904465028 | |||
| 3418 | 2904530950 | |||
| 3419 | 2904587417 | |||
| 3420 | 2904592548 | |||
| 3421 | 2904604660 | |||
| 3422 | 2919050472 | |||
| 3423 | 2919082491 | |||
| 3424 | 2919407140 | |||
| 3425 | 2923515805 | |||
| 3426 | 2928118605 | |||
| 3427 | 2928133403 | |||
| 3428 | 637075200 | |||
| 3429 | 8003960874 | |||
| 3430 | 8045865973 | |||
| 3431 | 8056064425 | |||
| 3432 | 8057163447 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8dt1-assembly1.cif.gz_C | crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with nad | 0.99 | 3 | 259 |
| 4trr-assembly1.cif.gz_D | crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 | 0.9867 | 3 | 259 |
| 4trr-assembly2.cif.gz_F | crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 | 0.9861 | 3 | 259 |
| 8dt1-assembly1.cif.gz_D | crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with nad | 0.9842 | 3 | 259 |
| 8dt1-assembly1.cif.gz_A | crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with nad | 0.9842 | 3 | 259 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4trrG00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9811 | 4 | 259 | 3.40.50.720 |
| 4trrC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9806 | 1 | 259 | 3.40.50.720 |
| 4trrC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9768 | 1 | 259 | 3.40.50.720 |
| 4trrG00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9768 | 4 | 259 | 3.40.50.720 |
| af_Q6PKH6_18_219_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9684 | 3 | 181 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N0QKI9-F1-model_v4 | NAD(P)-binding protein | 0.9895 | 3 | 126 |
GO:0005829
GO:0009688 GO:0010301 |
| AF-A0A2J1DVF9-F1-model_v4 | Short-chain dehydrogenase | 0.9851 | 3 | 158 |
GO:0006633
GO:0016616 GO:0048038 |
| AF-A0A2W6T3P7-F1-model_v4 | Short-chain dehydrogenase | 0.9817 | 3 | 184 |
GO:0016491
|
| AF-S3JGM5-F1-model_v4 | Glucose 1-dehydrogenase 2 (EC 1.1.1.47) | 0.9805 | 3 | 164 |
GO:0047936
|
| AF-A0A7C3JPF9-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.979 | 1 | 126 |
GO:0016491
|