F495454

General Info

Members Datasets Scaffolds Average Seq Length
1716 597 3432 257

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0044861|Ga0496117_0044861_2236_3123
Length 295
Sequence LLQHSETGAAHRNERRLFNARAAVGCGVAINPGEVMRLDGKVAIVTGAASGIGKRIAEVYAENGAAVAIADINLDAANATAKELEATGAKAIGVKMDVTSEQEVDAGVADVVARLGHVDILVSNAGIQIVNPVDKFAYADWKKLVAIHLDGAFLTTRACLQAMYARGKGGSIIYMGSVHSKEASKLKAPYVAAKHGLVGLAKVVAKEGAEHGVRANVICPGFVRTPLVEKQIPEQAKELGISEADVIKNVMLKETVDGEFTTVDDVAQCALFLAGFETNALTGQSLVVSHGWFMQ

Samples

Sample ID Description Type Environment
1 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
13 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
14 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
77 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
80 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
81 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
82 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
87 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
88 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
106 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
107 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
108 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
109 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
110 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
113 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
114 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
115 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
116 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
117 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
118 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
119 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
120 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
122 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
123 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
124 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
125 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
126 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
127 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
128 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
129 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
131 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
138 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
147 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
159 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
162 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
163 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
164 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
165 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
166 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
170 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
171 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
172 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
173 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
179 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
180 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
182 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
183 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
185 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
186 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
187 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
190 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
192 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
261 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
262 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
263 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
267 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
268 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
269 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
271 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
272 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
273 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
274 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
275 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
276 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
277 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
278 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
279 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
280 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
281 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
282 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
283 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
284 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
285 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
286 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
287 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
288 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
289 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
290 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
291 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
292 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
293 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
294 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
295 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
296 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
297 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
298 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
299 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
300 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
301 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
302 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
303 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
304 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
305 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
306 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
307 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
308 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
309 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
310 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
311 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
312 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
313 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
314 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
315 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
316 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
317 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
318 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
319 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
320 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
321 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
322 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
323 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
324 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
325 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
326 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
327 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
328 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
329 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
330 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
331 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
332 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
333 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
334 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
335 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
336 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
337 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
338 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
339 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
340 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
341 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
342 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
343 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
344 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
345 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
346 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
347 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
348 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
349 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
350 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
351 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
352 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
353 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
354 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
355 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
356 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
357 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
358 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
359 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
360 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
361 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
362 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
363 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
364 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
365 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
366 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
367 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
368 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
369 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
370 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
371 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
372 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
373 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
374 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
375 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
376 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
377 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
378 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
379 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
380 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
381 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
382 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
383 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
384 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
385 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
386 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
387 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
388 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
389 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
390 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
391 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
392 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
393 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
394 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
395 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
396 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
397 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
398 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
399 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
400 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
401 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
402 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
403 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
404 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
405 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
406 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
407 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
408 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
409 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
410 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
411 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
412 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
413 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
414 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
415 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
416 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
417 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
418 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
419 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
420 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
421 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
422 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
423 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
424 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
425 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
426 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
427 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
428 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
429 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
430 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
431 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
432 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
433 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
434 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
435 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
436 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
437 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
438 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
439 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
440 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
441 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
442 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
443 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
444 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
445 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
446 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
447 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
448 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
449 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
450 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
452 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
453 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
454 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
465 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
470 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
471 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
472 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
473 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
474 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
475 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
476 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
477 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
478 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
479 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
480 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
481 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
482 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
483 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
484 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
485 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
487 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
488 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
489 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
490 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
491 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
492 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
493 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
494 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
495 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
496 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
497 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
498 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
499 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
500 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
501 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
502 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
503 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
504 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
505 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
506 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
507 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
508 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
509 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
510 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
511 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
512 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
513 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
514 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
515 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
516 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
517 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
518 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
519 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
520 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
521 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
522 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
523 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
524 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
525 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
526 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
527 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
528 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
529 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
530 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
532 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
533 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
534 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
535 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
536 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
537 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
538 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
539 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
540 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
541 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
542 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
543 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
544 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
545 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
546 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
547 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
548 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
549 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
550 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
551 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
552 2643221583 Caulobacter sp. Root655 Isolate Unclassified
553 2643221629 Devosia sp. Root105 Isolate Unclassified
554 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
555 2643221662 Devosia sp. Root413D1 Isolate Unclassified
556 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
557 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
558 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
559 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
560 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
561 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
562 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
563 2818991436 Collimonas arenae 515 Isolate Unclassified
564 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
565 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
566 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
567 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
568 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
569 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
570 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
571 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
572 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
573 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
574 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
575 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
576 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
577 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
578 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
579 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
580 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
581 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
582 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
583 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
584 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
585 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
586 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
587 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
588 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
589 2919404418 Luteibacter sp. 3190 Isolate Unclassified
590 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
591 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
592 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
593 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
594 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
595 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
596 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
597 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.8
Metatranscriptomes 0.35
Isolates 3.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.23
Nodule 0.47
Rhizoplane 2.74
Rhizosphere 83.39
Stem 0
Stem Tuber 0
Unclassified 0.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496117_0044861 3300048920 Bacteria 3199
2 JGI24741J21665_1001217 3300001915 Bacteria 7572
3 JGI24740J21852_10007131 3300001979 Bacteria 4565
4 JGI24740J21852_10020119 3300001979 Bacteria 2336
5 JGI24740J21852_10068980 3300001979 Bacteria 952
6 JGI24739J22299_10012826 3300001989 Bacteria 3071
7 JGI24737J22298_10003471 3300001990 Bacteria 5564
8 JGI24744J21845_10004468 3300002077 Bacteria 2891
9 JGI25155J39150_1000532 3300002704 Bacteria 8900
10 JGI25155J39150_1000936 3300002704 Bacteria 3743
11 JGI25156J39149_1001026 3300002705 Bacteria 13042
12 JGI25156J39149_1004771 3300002705 Bacteria 4057
13 JGI25156J39149_1015034 3300002705 Bacteria 1568
14 JGI25156J39149_1021461 3300002705 Bacteria 1117
15 JGI25162J39368_1000001 3300002737 Bacteria 740113
16 JGI25162J39368_1005321 3300002737 Bacteria 2582
17 JGI25154J39366_1000871 3300002738 Bacteria 13042
18 JGI25154J39366_1000911 3300002738 Bacteria 12467
19 JGI25157J39369_1004172 3300002741 Bacteria 2699
20 JGI25157J39369_1004410 3300002741 Bacteria 2558
21 JGI25163J39215_1002601 3300002771 Bacteria 1770
22 JGI25164J39214_1000475 3300002772 Bacteria 19811
23 JGI25152J39213_1028232 3300002773 Bacteria 895
24 JGI25151J46595_10000913 3300003187 Bacteria 23081
25 JGI25151J46595_10006316 3300003187 Bacteria 5974
26 JGI25165J46597_1000001 3300003214 Bacteria 1111887
27 JGI25165J46597_1001366 3300003214 Bacteria 13559
28 JGI25153J46596_10000045 3300003215 Bacteria 149347
29 JGI25153J46596_10018640 3300003215 Bacteria 2688
30 rootH1_10019690 3300003316 Bacteria 4250
31 rootL2_10065722 3300003322 Bacteria 14285
32 Ga0055538_1000001 3300003751 Bacteria 1111887
33 Ga0055538_1000013 3300003751 Bacteria 348596
34 Ga0055539_1000001 3300003752 Bacteria 1111887
35 Ga0055539_1000018 3300003752 Bacteria 348596
36 Ga0055533_1000003 3300003756 Bacteria 1111887
37 Ga0055533_1000022 3300003756 Bacteria 348596
38 Ga0055532_1000017 3300003758 Bacteria 306880
39 Ga0055525_1000001 3300003759 Bacteria 1016948
40 Ga0055525_1000003 3300003759 Bacteria 962094
41 Ga0055525_1000024 3300003759 Bacteria 348596
42 Ga0055535_1006731 3300003761 Bacteria 2286
43 Ga0055526_1028622 3300003771 Bacteria 1679
44 Ga0055536_1004251 3300003781 Bacteria 7385
45 Ga0055536_1012671 3300003781 Bacteria 3108
46 Ga0055530_10036597 3300003791 Bacteria 1234
47 Ga0055540_1001616 3300003792 Bacteria 13119
48 Ga0055531_10002054 3300003794 Bacteria 13887
49 Ga0055541_1000001 3300003841 Bacteria 1111887
50 Ga0055541_1000013 3300003841 Bacteria 348596
51 Ga0065165_1000745 3300005262 Bacteria 44712
52 Ga0065712_10112677 3300005290 Bacteria 1796
53 Ga0065715_10321857 3300005293 Bacteria 1000
54 Ga0070658_10000881 3300005327 Bacteria 25676
55 Ga0070658_10093058 3300005327 Bacteria 2486
56 Ga0070658_10138067 3300005327 Bacteria 2035
57 Ga0070658_10156267 3300005327 Bacteria 1912
58 Ga0070658_10224133 3300005327 Bacteria 1591
59 Ga0070658_10382575 3300005327 Bacteria 1207
60 Ga0070658_10505211 3300005327 Bacteria 1044
61 Ga0070658_10664089 3300005327 Bacteria 904
62 Ga0070676_10018089 3300005328 Bacteria 3902
63 Ga0070676_10073008 3300005328 Bacteria 2064
64 Ga0070676_10155875 3300005328 Bacteria 1466
65 Ga0070683_100009560 3300005329 Bacteria 8300
66 Ga0070683_100096695 3300005329 Bacteria 2778
67 Ga0070683_100102161 3300005329 Bacteria 2700
68 Ga0070683_100122436 3300005329 Bacteria 2458
69 Ga0070683_100262653 3300005329 Bacteria 1642
70 Ga0070683_100306077 3300005329 Bacteria 1512
71 Ga0070683_100496211 3300005329 Bacteria 1166
72 Ga0070690_100000396 3300005330 Bacteria 22104
73 Ga0070690_100001314 3300005330 Bacteria 12919
74 Ga0070670_100000011 3300005331 Bacteria 263074
75 Ga0070670_100009125 3300005331 Bacteria 8476
76 Ga0070670_100063773 3300005331 Bacteria 3162
77 Ga0070670_100142839 3300005331 Bacteria 2070
78 Ga0070670_100453730 3300005331 Bacteria 1136
79 Ga0070677_10000119 3300005333 Bacteria 26083
80 Ga0070677_10052611 3300005333 Bacteria 1653
81 Ga0068869_100000465 3300005334 Bacteria 22413
82 Ga0068869_100000575 3300005334 Bacteria 20597
83 Ga0068869_100030458 3300005334 Bacteria 3787
84 Ga0068869_100038379 3300005334 Bacteria 3414
85 Ga0070666_10000097 3300005335 Bacteria 60322
86 Ga0070666_10000198 3300005335 Bacteria 40959
87 Ga0070666_10004931 3300005335 Bacteria 8163
88 Ga0070666_10005202 3300005335 Bacteria 7969
89 Ga0070666_10029401 3300005335 Bacteria 3612
90 Ga0070666_10033779 3300005335 Bacteria 3387
91 Ga0070666_10050374 3300005335 Bacteria 2801
92 Ga0070666_10190636 3300005335 Bacteria 1440
93 Ga0070666_10377766 3300005335 Bacteria 1017
94 Ga0070680_100011206 3300005336 Bacteria 6935
95 Ga0070680_100100287 3300005336 Bacteria 2403
96 Ga0070680_100463638 3300005336 Bacteria 1082
97 Ga0070682_100059155 3300005337 Bacteria 2419
98 Ga0070682_100080367 3300005337 Bacteria 2108
99 Ga0070682_100126734 3300005337 Bacteria 1722
100 Ga0068868_100016774 3300005338 Bacteria 5446
101 Ga0068868_100038492 3300005338 Bacteria 3712
102 Ga0068868_100060073 3300005338 Bacteria 3008
103 Ga0068868_100161524 3300005338 Bacteria 1850
104 Ga0068868_100187168 3300005338 Bacteria 1720
105 Ga0068868_100353230 3300005338 Bacteria 1259
106 Ga0070660_100002548 3300005339 Bacteria 12490
107 Ga0070660_100006229 3300005339 Bacteria 8260
108 Ga0070660_100028777 3300005339 Bacteria 4160
109 Ga0070660_100081744 3300005339 Bacteria 2536
110 Ga0070689_100003279 3300005340 Bacteria 10743
111 Ga0070689_100037597 3300005340 Bacteria 3701
112 Ga0070689_100347195 3300005340 Bacteria 1244
113 Ga0070691_10031910 3300005341 Bacteria 2472
114 Ga0070687_100001236 3300005343 Bacteria 8866
115 Ga0070687_100174327 3300005343 Bacteria 1283
116 Ga0070661_100000128 3300005344 Bacteria 63056
117 Ga0070661_100010705 3300005344 Bacteria 6382
118 Ga0070661_100067383 3300005344 Bacteria 2630
119 Ga0070661_100167629 3300005344 Bacteria 1666
120 Ga0070692_10005521 3300005345 Bacteria 5402
121 Ga0070692_10074102 3300005345 Bacteria 1820
122 Ga0070692_10339447 3300005345 Bacteria 930
123 Ga0070668_100000193 3300005347 Bacteria 39976
124 Ga0070668_100000218 3300005347 Bacteria 36854
125 Ga0070668_100006659 3300005347 Bacteria 8561
126 Ga0070668_100105539 3300005347 Bacteria 2237
127 Ga0070668_100243131 3300005347 Bacteria 1492
128 Ga0070668_100344960 3300005347 Bacteria 1259
129 Ga0070669_100001298 3300005353 Bacteria 18042
130 Ga0070669_100006029 3300005353 Bacteria 8744
131 Ga0070669_100048564 3300005353 Bacteria 3098
132 Ga0070669_100073260 3300005353 Bacteria 2537
133 Ga0070675_100007099 3300005354 Bacteria 8625
134 Ga0070675_100059143 3300005354 Bacteria 3161
135 Ga0070675_100303980 3300005354 Bacteria 1406
136 Ga0070671_100000026 3300005355 Bacteria 120482
137 Ga0070671_100001435 3300005355 Bacteria 17804
138 Ga0070671_100016327 3300005355 Bacteria 6004
139 Ga0070671_100033885 3300005355 Bacteria 4225
140 Ga0070671_100053322 3300005355 Bacteria 3361
141 Ga0070671_100086404 3300005355 Bacteria 2624
142 Ga0070671_100262836 3300005355 Bacteria 1467
143 Ga0070671_100322402 3300005355 Bacteria 1317
144 Ga0070674_100000686 3300005356 Bacteria 17130
145 Ga0070674_100000953 3300005356 Bacteria 15095
146 Ga0070674_100021719 3300005356 Bacteria 4127
147 Ga0070674_100047070 3300005356 Bacteria 2953
148 Ga0070673_100054732 3300005364 Bacteria 3140
149 Ga0070673_100067881 3300005364 Bacteria 2853
150 Ga0070673_100757118 3300005364 Bacteria 895
151 Ga0070688_100001706 3300005365 Bacteria 10967
152 Ga0070688_100006308 3300005365 Bacteria 6330
153 Ga0070659_100006519 3300005366 Bacteria 8429
154 Ga0070659_100015651 3300005366 Bacteria 5682
155 Ga0070659_100019145 3300005366 Bacteria 5180
156 Ga0070659_100222101 3300005366 Bacteria 1559
157 Ga0070659_100288472 3300005366 Bacteria 1366
158 Ga0070659_100494006 3300005366 Bacteria 1042
159 Ga0070667_100000010 3300005367 Bacteria 273500
160 Ga0070667_100000092 3300005367 Bacteria 111329
161 Ga0070667_100001339 3300005367 Bacteria 22088
162 Ga0070667_100004143 3300005367 Bacteria 12254
163 Ga0070667_100011628 3300005367 Bacteria 7277
164 Ga0070667_100011752 3300005367 Bacteria 7234
165 Ga0070667_100028507 3300005367 Bacteria 4649
166 Ga0070667_100028612 3300005367 Bacteria 4640
167 Ga0070667_100031890 3300005367 Bacteria 4392
168 Ga0070667_100108091 3300005367 Bacteria 2409
169 Ga0070667_100453085 3300005367 Bacteria 1172
170 Ga0070703_10080915 3300005406 Bacteria 1106
171 Ga0070714_100070954 3300005435 Bacteria 3011
172 Ga0070714_100071156 3300005435 Bacteria 3007
173 Ga0070714_100158133 3300005435 Bacteria 2048
174 Ga0070713_100001639 3300005436 Bacteria 14365
175 Ga0070713_100045084 3300005436 Bacteria 3611
176 Ga0070713_100051803 3300005436 Bacteria 3396
177 Ga0070710_10048246 3300005437 Bacteria 2378
178 Ga0070701_10015406 3300005438 Bacteria 3530
179 Ga0070701_10078065 3300005438 Bacteria 1786
180 Ga0070711_100027185 3300005439 Bacteria 3754
181 Ga0070705_100000278 3300005440 Bacteria 30604
182 Ga0070705_100027619 3300005440 Bacteria 3101
183 Ga0070700_100050934 3300005441 Bacteria 2576
184 Ga0070700_100288273 3300005441 Bacteria 1193
185 Ga0070708_100008135 3300005445 Bacteria 8410
186 Ga0070663_100001469 3300005455 Bacteria 12964
187 Ga0070663_100010345 3300005455 Bacteria 5815
188 Ga0070663_100019991 3300005455 Bacteria 4424
189 Ga0070663_100083587 3300005455 Bacteria 2351
190 Ga0070663_100114868 3300005455 Bacteria 2027
191 Ga0070678_100002532 3300005456 Bacteria 10018
192 Ga0070678_100019947 3300005456 Bacteria 4387
193 Ga0070678_100043700 3300005456 Bacteria 3194
194 Ga0070678_100043774 3300005456 Bacteria 3192
195 Ga0070678_100092086 3300005456 Bacteria 2328
196 Ga0070662_100005207 3300005457 Bacteria 8298
197 Ga0070662_100042067 3300005457 Bacteria 3262
198 Ga0070662_100067285 3300005457 Bacteria 2630
199 Ga0070662_100105738 3300005457 Bacteria 2137
200 Ga0070662_100426214 3300005457 Bacteria 1098
201 Ga0070681_10048741 3300005458 Bacteria 4232
202 Ga0070681_10088290 3300005458 Bacteria 3052
203 Ga0070681_10252343 3300005458 Bacteria 1676
204 Ga0068867_100201114 3300005459 Bacteria 1595
205 Ga0068867_100416876 3300005459 Bacteria 1136
206 Ga0070685_10000035 3300005466 Bacteria 81433
207 Ga0070685_10000657 3300005466 Bacteria 18906
208 Ga0070685_10001172 3300005466 Bacteria 14028
209 Ga0070706_100000099 3300005467 Bacteria 105782
210 Ga0070706_100198822 3300005467 Bacteria 1872
211 Ga0070706_100392642 3300005467 Bacteria 1291
212 Ga0070707_100002214 3300005468 Bacteria 18546
213 Ga0070707_100245113 3300005468 Bacteria 1744
214 Ga0070698_100072846 3300005471 Bacteria 3442
215 Ga0070699_100079247 3300005518 Bacteria 2861
216 Ga0070699_100285563 3300005518 Bacteria 1478
217 Ga0070699_100434818 3300005518 Bacteria 1189
218 Ga0070679_100002575 3300005530 Bacteria 16471
219 Ga0070679_100124967 3300005530 Bacteria 2555
220 Ga0070684_100030135 3300005535 Bacteria 4608
221 Ga0070684_100128207 3300005535 Bacteria 2287
222 Ga0070697_100067912 3300005536 Bacteria 2917
223 Ga0070697_100264684 3300005536 Bacteria 1473
224 Ga0068853_100000208 3300005539 Bacteria 41514
225 Ga0068853_100002117 3300005539 Bacteria 14743
226 Ga0068853_100006289 3300005539 Bacteria 9417
227 Ga0068853_100017942 3300005539 Bacteria 5848
228 Ga0068853_100049630 3300005539 Bacteria 3607
229 Ga0068853_100129047 3300005539 Bacteria 2261
230 Ga0068853_100246922 3300005539 Bacteria 1637
231 Ga0068853_100494924 3300005539 Bacteria 1154
232 Ga0070672_100284056 3300005543 Bacteria 1400
233 Ga0070686_100002031 3300005544 Bacteria 11223
234 Ga0070686_100011604 3300005544 Bacteria 5003
235 Ga0070695_100038331 3300005545 Bacteria 3024
236 Ga0070696_100023647 3300005546 Bacteria 4177
237 Ga0070693_100001786 3300005547 Bacteria 9798
238 Ga0070693_100003714 3300005547 Bacteria 7140
239 Ga0070693_100008954 3300005547 Bacteria 4966
240 Ga0070693_100069111 3300005547 Bacteria 2075
241 Ga0070693_100178477 3300005547 Bacteria 1366
242 Ga0070665_100008420 3300005548 Bacteria 10434
243 Ga0070665_100011217 3300005548 Bacteria 9061
244 Ga0070665_100041022 3300005548 Bacteria 4651
245 Ga0070665_100224656 3300005548 Bacteria 1878
246 Ga0070665_100893809 3300005548 Bacteria 901
247 Ga0070704_100139795 3300005549 Bacteria 1889
248 Ga0070704_100637147 3300005549 Bacteria 940
249 Ga0068855_100001112 3300005563 Bacteria 33452
250 Ga0068855_100031910 3300005563 Bacteria 6288
251 Ga0068855_100046378 3300005563 Bacteria 5138
252 Ga0068855_100106520 3300005563 Bacteria 3222
253 Ga0068855_100169572 3300005563 Bacteria 2472
254 Ga0068855_100201083 3300005563 Bacteria 2243
255 Ga0068855_100215511 3300005563 Bacteria 2155
256 Ga0068855_100259113 3300005563 Bacteria 1938
257 Ga0068855_100354717 3300005563 Bacteria 1615
258 Ga0068855_100965212 3300005563 Bacteria 897
259 Ga0070664_100004070 3300005564 Bacteria 11746
260 Ga0070664_100004390 3300005564 Bacteria 11330
261 Ga0070664_100007970 3300005564 Bacteria 8556
262 Ga0070664_100015258 3300005564 Bacteria 6279
263 Ga0070664_100040629 3300005564 Bacteria 3922
264 Ga0070664_100056523 3300005564 Bacteria 3334
265 Ga0070664_100299834 3300005564 Bacteria 1452
266 Ga0068857_100001298 3300005577 Bacteria 19635
267 Ga0068857_100042462 3300005577 Bacteria 4035
268 Ga0068857_100062934 3300005577 Bacteria 3298
269 Ga0068857_100064096 3300005577 Bacteria 3267
270 Ga0068857_100113602 3300005577 Bacteria 2435
271 Ga0068857_100166783 3300005577 Bacteria 2000
272 Ga0068854_100000631 3300005578 Bacteria 20858
273 Ga0068854_100003249 3300005578 Bacteria 10128
274 Ga0068854_100005790 3300005578 Bacteria 7823
275 Ga0068854_100020998 3300005578 Bacteria 4426
276 Ga0068854_100048403 3300005578 Bacteria 3033
277 Ga0068854_100097292 3300005578 Bacteria 2200
278 Ga0068854_100537789 3300005578 Bacteria 989
279 Ga0068854_100563536 3300005578 Bacteria 968
280 Ga0068856_100009926 3300005614 Bacteria 9248
281 Ga0068856_100033906 3300005614 Bacteria 4999
282 Ga0068856_100146127 3300005614 Bacteria 2372
283 Ga0068856_100174008 3300005614 Bacteria 2165
284 Ga0068856_100196292 3300005614 Bacteria 2032
285 Ga0068856_100555778 3300005614 Bacteria 1169
286 Ga0070702_100003317 3300005615 Bacteria 7183
287 Ga0070702_100063587 3300005615 Bacteria 2155
288 Ga0070702_100087798 3300005615 Bacteria 1879
289 Ga0070702_100099523 3300005615 Bacteria 1781
290 Ga0070702_100260815 3300005615 Bacteria 1180
291 Ga0068852_100006990 3300005616 Bacteria 8212
292 Ga0068852_100029077 3300005616 Bacteria 4534
293 Ga0068852_100057093 3300005616 Bacteria 3376
294 Ga0068852_100078321 3300005616 Bacteria 2924
295 Ga0068852_100508765 3300005616 Bacteria 1200
296 Ga0068852_100674102 3300005616 Bacteria 1043
297 Ga0068859_100004578 3300005617 Bacteria 14104
298 Ga0068859_100005284 3300005617 Bacteria 13129
299 Ga0068859_100015514 3300005617 Bacteria 7654
300 Ga0068859_100023206 3300005617 Bacteria 6225
301 Ga0068859_100034851 3300005617 Bacteria 5050
302 Ga0068859_100036938 3300005617 Bacteria 4903
303 Ga0068859_100037450 3300005617 Bacteria 4867
304 Ga0068859_100168722 3300005617 Bacteria 2269
305 Ga0068859_100169934 3300005617 Bacteria 2261
306 Ga0068859_100575449 3300005617 Bacteria 1220
307 Ga0068864_100000020 3300005618 Bacteria 263460
308 Ga0068864_100001107 3300005618 Bacteria 22544
309 Ga0068864_100003260 3300005618 Bacteria 13407
310 Ga0068864_100006188 3300005618 Bacteria 9814
311 Ga0068864_100081663 3300005618 Bacteria 2834
312 Ga0068864_100315068 3300005618 Bacteria 1468
313 Ga0068866_10000329 3300005718 Bacteria 22440
314 Ga0068866_10009330 3300005718 Bacteria 4161
315 Ga0068866_10078377 3300005718 Bacteria 1768
316 Ga0068861_100001745 3300005719 Bacteria 13962
317 Ga0068851_10002098 3300005834 Bacteria 8767
318 Ga0068851_10124710 3300005834 Bacteria 1387
319 Ga0068851_10136773 3300005834 Bacteria 1329
320 Ga0068870_10000064 3300005840 Bacteria 33109
321 Ga0068863_100000124 3300005841 Bacteria 80821
322 Ga0068863_100000158 3300005841 Bacteria 71918
323 Ga0068863_100002017 3300005841 Bacteria 20118
324 Ga0068863_100005398 3300005841 Bacteria 12607
325 Ga0068863_100018111 3300005841 Bacteria 6744
326 Ga0068863_100084338 3300005841 Bacteria 3011
327 Ga0068863_100090044 3300005841 Bacteria 2909
328 Ga0068863_100106067 3300005841 Bacteria 2673
329 Ga0068863_100189636 3300005841 Bacteria 1975
330 Ga0068863_100510423 3300005841 Bacteria 1184
331 Ga0068858_100000149 3300005842 Bacteria 73242
332 Ga0068858_100001385 3300005842 Bacteria 24970
333 Ga0068858_100017303 3300005842 Bacteria 6761
334 Ga0068858_100020053 3300005842 Bacteria 6252
335 Ga0068858_100021949 3300005842 Bacteria 5962
336 Ga0068858_100027784 3300005842 Bacteria 5256
337 Ga0068858_100057078 3300005842 Bacteria 3608
338 Ga0068858_100124252 3300005842 Bacteria 2415
339 Ga0068858_100290673 3300005842 Bacteria 1558
340 Ga0068858_100360929 3300005842 Bacteria 1392
341 Ga0068858_100599094 3300005842 Bacteria 1069
342 Ga0068860_100000595 3300005843 Bacteria 43142
343 Ga0068860_100000822 3300005843 Bacteria 34721
344 Ga0068860_100002442 3300005843 Bacteria 19521
345 Ga0068860_100012152 3300005843 Bacteria 8482
346 Ga0068860_100014589 3300005843 Bacteria 7688
347 Ga0068860_100015601 3300005843 Bacteria 7419
348 Ga0068860_100024545 3300005843 Bacteria 5824
349 Ga0068860_100674316 3300005843 Bacteria 1043
350 Ga0068862_100000076 3300005844 Bacteria 117053
351 Ga0068862_100001389 3300005844 Bacteria 22423
352 Ga0068862_100005977 3300005844 Bacteria 10132
353 Ga0068862_100048526 3300005844 Bacteria 3625
354 Ga0081455_10004545 3300005937 Bacteria 15491
355 Ga0081455_10025273 3300005937 Bacteria 5486
356 Ga0081455_10143094 3300005937 Bacteria 1854
357 Ga0081540_1000427 3300005983 Bacteria 41566
358 Ga0081540_1002493 3300005983 Bacteria 14983
359 Ga0081539_10001566 3300005985 Bacteria 37942
360 Ga0081539_10007546 3300005985 Bacteria 9851
361 Ga0070717_10010659 3300006028 Bacteria 6948
362 Ga0075365_10165380 3300006038 Bacteria 1543
363 Ga0075368_10095739 3300006042 Bacteria 1217
364 Ga0075364_10039817 3300006051 Bacteria 3047
365 Ga0075432_10108217 3300006058 Bacteria 1033
366 Ga0070716_100165335 3300006173 Bacteria 1438
367 Ga0070712_100017186 3300006175 Bacteria 4680
368 Ga0070712_100188560 3300006175 Bacteria 1612
369 Ga0075362_10000561 3300006177 Bacteria 10840
370 Ga0075362_10097862 3300006177 Bacteria 1369
371 Ga0075366_10175374 3300006195 Bacteria 1301
372 Ga0097621_100003928 3300006237 Bacteria 10297
373 Ga0097621_100030727 3300006237 Bacteria 4256
374 Ga0097621_100058699 3300006237 Bacteria 3148
375 Ga0097621_100150918 3300006237 Bacteria 1993
376 Ga0068871_100017442 3300006358 Bacteria 5434
377 Ga0068871_100050328 3300006358 Bacteria 3370
378 Ga0068871_100307144 3300006358 Bacteria 1394
379 Ga0068871_100430844 3300006358 Bacteria 1179
380 Ga0068871_100599825 3300006358 Bacteria 1001
381 Ga0075428_100056037 3300006844 Bacteria 4318
382 Ga0075431_100025533 3300006847 Bacteria 6057
383 Ga0075433_10002066 3300006852 Bacteria 15176
384 Ga0075434_100250202 3300006871 Bacteria 1791
385 Ga0075429_100318394 3300006880 Bacteria 1361
386 Ga0068865_100000156 3300006881 Bacteria 37229
387 Ga0068865_100020079 3300006881 Bacteria 4332
388 Ga0068865_100307182 3300006881 Bacteria 1271
389 Ga0068865_100378074 3300006881 Bacteria 1154
390 Ga0068865_100477208 3300006881 Bacteria 1036
391 Ga0075436_100123709 3300006914 Bacteria 1811
392 Ga0075436_100151751 3300006914 Bacteria 1631
393 Ga0097620_100004578 3300006931 Bacteria 14104
394 Ga0097620_100005284 3300006931 Bacteria 13129
395 Ga0097620_100015515 3300006931 Bacteria 7654
396 Ga0097620_100023205 3300006931 Bacteria 6225
397 Ga0097620_100034851 3300006931 Bacteria 5050
398 Ga0097620_100036943 3300006931 Bacteria 4903
399 Ga0097620_100037450 3300006931 Bacteria 4867
400 Ga0097620_100168722 3300006931 Bacteria 2269
401 Ga0097620_100169948 3300006931 Bacteria 2261
402 Ga0097620_100219185 3300006931 Bacteria 1990
403 Ga0097620_100575330 3300006931 Bacteria 1220
404 Ga0099794_10084111 3300007265 Bacteria 1573
405 Ga0105251_10051665 3300009011 Bacteria 1959
406 Ga0105240_10008057 3300009093 Bacteria 15158
407 Ga0105240_10009257 3300009093 Bacteria 13968
408 Ga0105240_10025571 3300009093 Bacteria 7754
409 Ga0105240_10033209 3300009093 Bacteria 6670
410 Ga0105240_10046532 3300009093 Bacteria 5497
411 Ga0105240_10081467 3300009093 Bacteria 3977
412 Ga0105240_10203320 3300009093 Bacteria 2320
413 Ga0105240_10657937 3300009093 Bacteria 1147
414 Ga0111539_10011533 3300009094 Bacteria 11090
415 Ga0111539_10975374 3300009094 Bacteria 985
416 Ga0111539_11087882 3300009094 Bacteria 929
417 Ga0105245_10000426 3300009098 Bacteria 39349
418 Ga0105245_10006948 3300009098 Bacteria 9924
419 Ga0105245_10031246 3300009098 Bacteria 4711
420 Ga0105245_10121273 3300009098 Bacteria 2443
421 Ga0105245_10159162 3300009098 Bacteria 2141
422 Ga0105245_10192878 3300009098 Bacteria 1952
423 Ga0105245_10198731 3300009098 Bacteria 1924
424 Ga0105247_10003007 3300009101 Bacteria 11171
425 Ga0105247_10016993 3300009101 Bacteria 4365
426 Ga0105247_10091599 3300009101 Bacteria 1931
427 Ga0105247_10453021 3300009101 Bacteria 925
428 Ga0114129_10209601 3300009147 Bacteria 2635
429 Ga0114129_10434991 3300009147 Bacteria 1723
430 Ga0105243_10001511 3300009148 Bacteria 20313
431 Ga0105243_10002592 3300009148 Bacteria 15081
432 Ga0105243_10031015 3300009148 Bacteria 4120
433 Ga0105243_10121472 3300009148 Bacteria 2203
434 Ga0105243_10136646 3300009148 Bacteria 2086
435 Ga0105243_10253318 3300009148 Bacteria 1573
436 Ga0105243_10631189 3300009148 Bacteria 1036
437 Ga0105241_10001288 3300009174 Bacteria 19136
438 Ga0105241_10002134 3300009174 Bacteria 14955
439 Ga0105241_10005667 3300009174 Bacteria 9214
440 Ga0105241_10124958 3300009174 Bacteria 2076
441 Ga0105241_10156844 3300009174 Bacteria 1867
442 Ga0105241_10492730 3300009174 Bacteria 1091
443 Ga0105242_10022105 3300009176 Bacteria 4998
444 Ga0105242_10234054 3300009176 Bacteria 1648
445 Ga0105242_10243646 3300009176 Bacteria 1617
446 Ga0105242_10250334 3300009176 Bacteria 1596
447 Ga0105242_10497334 3300009176 Bacteria 1159
448 Ga0105248_10001654 3300009177 Bacteria 24795
449 Ga0105248_10018646 3300009177 Bacteria 7672
450 Ga0105248_10078430 3300009177 Bacteria 3712
451 Ga0105248_10080447 3300009177 Bacteria 3662
452 Ga0105248_10356291 3300009177 Bacteria 1647
453 Ga0105248_10726277 3300009177 Bacteria 1121
454 Ga0105237_10000846 3300009545 Bacteria 41712
455 Ga0105237_10005975 3300009545 Bacteria 13636
456 Ga0105237_10017079 3300009545 Bacteria 7529
457 Ga0105237_10045629 3300009545 Bacteria 4409
458 Ga0105237_10060141 3300009545 Bacteria 3801
459 Ga0105237_10116221 3300009545 Bacteria 2668
460 Ga0105237_10182470 3300009545 Bacteria 2098
461 Ga0105237_10385201 3300009545 Bacteria 1407
462 Ga0105237_10485789 3300009545 Bacteria 1241
463 Ga0105238_10000315 3300009551 Bacteria 52804
464 Ga0105238_10000738 3300009551 Bacteria 34144
465 Ga0105238_10000970 3300009551 Bacteria 29353
466 Ga0105238_10001651 3300009551 Bacteria 22387
467 Ga0105238_10007091 3300009551 Bacteria 11215
468 Ga0105238_10055112 3300009551 Bacteria 3991
469 Ga0105238_10058971 3300009551 Bacteria 3846
470 Ga0105238_10059574 3300009551 Bacteria 3824
471 Ga0105238_10204236 3300009551 Bacteria 1952
472 Ga0105249_10001740 3300009553 Bacteria 19004
473 Ga0105249_10008085 3300009553 Bacteria 9169
474 Ga0105249_10025022 3300009553 Bacteria 5371
475 Ga0105249_10026131 3300009553 Bacteria 5258
476 Ga0105249_10828253 3300009553 Bacteria 990
477 Ga0105239_10003874 3300010375 Bacteria 18150
478 Ga0105239_10012419 3300010375 Bacteria 9485
479 Ga0105239_10023370 3300010375 Bacteria 6807
480 Ga0105239_10033029 3300010375 Bacteria 5683
481 Ga0105239_10071697 3300010375 Bacteria 3806
482 Ga0105239_10098427 3300010375 Bacteria 3233
483 Ga0105239_10135092 3300010375 Bacteria 2746
484 Ga0105239_10252927 3300010375 Bacteria 1979
485 Ga0105239_10266586 3300010375 Bacteria 1926
486 Ga0105239_10326532 3300010375 Bacteria 1731
487 Ga0105239_10447165 3300010375 Bacteria 1466
488 Ga0105239_10695697 3300010375 Bacteria 1162
489 Ga0105246_10184458 3300011119 Bacteria 1610
490 Ga0105246_10350127 3300011119 Bacteria 1210
491 Ga0105246_10411453 3300011119 Bacteria 1126
492 Ga0157327_1005580 3300012512 Bacteria 1026
493 Ga0157373_10003695 3300013100 Bacteria 11579
494 Ga0157373_10009307 3300013100 Bacteria 7263
495 Ga0157371_10000290 3300013102 Bacteria 67914
496 Ga0157371_10021286 3300013102 Bacteria 4762
497 Ga0157371_10026749 3300013102 Bacteria 4190
498 Ga0157371_10066081 3300013102 Bacteria 2561
499 Ga0157371_10281668 3300013102 Bacteria 1201
500 Ga0157370_10024107 3300013104 Bacteria 6031
501 Ga0157370_10034755 3300013104 Bacteria 4904
502 Ga0157370_10038592 3300013104 Bacteria 4620
503 Ga0157370_10051023 3300013104 Bacteria 3953
504 Ga0157370_10053167 3300013104 Bacteria 3863
505 Ga0157369_10004891 3300013105 Bacteria 15715
506 Ga0157369_10025478 3300013105 Bacteria 6567
507 Ga0157369_10055121 3300013105 Bacteria 4291
508 Ga0157369_10073706 3300013105 Bacteria 3662
509 Ga0157369_10174535 3300013105 Bacteria 2263
510 Ga0157369_10642752 3300013105 Bacteria 1094
511 Ga0157374_10034837 3300013296 Bacteria 4602
512 Ga0157374_10043797 3300013296 Bacteria 4136
513 Ga0157374_10145194 3300013296 Bacteria 2305
514 Ga0157374_10246213 3300013296 Bacteria 1758
515 Ga0157378_10000005 3300013297 Bacteria 197893
516 Ga0157378_10004739 3300013297 Bacteria 11919
517 Ga0157378_10033327 3300013297 Bacteria 4553
518 Ga0157378_10051328 3300013297 Bacteria 3670
519 Ga0157378_10052920 3300013297 Bacteria 3613
520 Ga0157378_10235164 3300013297 Bacteria 1748
521 Ga0157378_10760789 3300013297 Bacteria 992
522 Ga0163162_10000673 3300013306 Bacteria 31751
523 Ga0163162_10001215 3300013306 Bacteria 24072
524 Ga0163162_10020730 3300013306 Bacteria 6461
525 Ga0163162_10066191 3300013306 Bacteria 3662
526 Ga0163162_10081725 3300013306 Bacteria 3302
527 Ga0163162_10102951 3300013306 Bacteria 2949
528 Ga0163162_10109449 3300013306 Bacteria 2860
529 Ga0163162_10526200 3300013306 Bacteria 1312
530 Ga0157372_10000417 3300013307 Bacteria 46710
531 Ga0157372_10072947 3300013307 Bacteria 3868
532 Ga0157372_10115555 3300013307 Bacteria 3076
533 Ga0157372_10117118 3300013307 Bacteria 3055
534 Ga0157372_10139434 3300013307 Bacteria 2793
535 Ga0157372_10205175 3300013307 Bacteria 2284
536 Ga0157372_10493075 3300013307 Bacteria 1428
537 Ga0157372_10528095 3300013307 Bacteria 1376
538 Ga0157372_10703453 3300013307 Bacteria 1176
539 Ga0157372_10986455 3300013307 Bacteria 976
540 Ga0157375_10109937 3300013308 Bacteria 2853
541 Ga0157375_10574579 3300013308 Bacteria 1288
542 Ga0163163_10000358 3300014325 Bacteria 43838
543 Ga0163163_10001487 3300014325 Bacteria 19846
544 Ga0163163_10009750 3300014325 Bacteria 8600
545 Ga0163163_10046355 3300014325 Bacteria 4271
546 Ga0157380_10009680 3300014326 Bacteria 6910
547 Ga0157380_10052493 3300014326 Bacteria 3229
548 Ga0157380_10190059 3300014326 Bacteria 1812
549 Ga0182008_10040838 3300014497 Bacteria 2315
550 Ga0182008_10090525 3300014497 Bacteria 1508
551 Ga0182008_10253313 3300014497 Bacteria 909
552 Ga0157377_10002948 3300014745 Bacteria 7610
553 Ga0157377_10004717 3300014745 Bacteria 6313
554 Ga0157377_10018176 3300014745 Bacteria 3652
555 Ga0157377_10176438 3300014745 Bacteria 1340
556 Ga0157379_10000219 3300014968 Bacteria 44603
557 Ga0157379_10001710 3300014968 Bacteria 18170
558 Ga0157379_10028114 3300014968 Bacteria 5005
559 Ga0157379_10190898 3300014968 Bacteria 1851
560 Ga0157379_10284767 3300014968 Bacteria 1504
561 Ga0157379_10392262 3300014968 Bacteria 1275
562 Ga0157376_10005857 3300014969 Bacteria 8620
563 Ga0157376_10019920 3300014969 Bacteria 5180
564 Ga0157376_10027680 3300014969 Bacteria 4497
565 Ga0157376_10092402 3300014969 Bacteria 2623
566 Ga0157376_10501089 3300014969 Bacteria 1193
567 Ga0182006_1002125 3300015261 Bacteria 11043
568 Ga0182006_1114020 3300015261 Bacteria 946
569 Ga0182007_10004010 3300015262 Bacteria 6794
570 Ga0182007_10009816 3300015262 Bacteria 3822
571 Ga0182007_10014265 3300015262 Bacteria 3003
572 Ga0182005_1001650 3300015265 Bacteria 8674
573 Ga0163161_10013133 3300017792 Bacteria 5756
574 Ga0163161_10179432 3300017792 Bacteria 1623
575 Ga0163161_10428626 3300017792 Bacteria 1065
576 Ga0206356_11636764 3300020070 Bacteria 2604
577 Ga0206353_10673777 3300020082 Bacteria 2014
578 Ga0154015_1664260 3300020610 Bacteria 1660
579 Ga0213872_10002518 3300021361 Bacteria 10700
580 Ga0213872_10005752 3300021361 Bacteria 6307
581 Ga0228598_1001753 3300024227 Bacteria 4748
582 Ga0209435_100015 3300025206 Bacteria 321177
583 Ga0209435_100288 3300025206 Bacteria 12225
584 Ga0209760_101484 3300025207 Bacteria 2458
585 Ga0209784_100004 3300025224 Bacteria 1378156
586 Ga0209784_100005 3300025224 Bacteria 1040422
587 Ga0209566_100004 3300025225 Bacteria 1531866
588 Ga0209566_100005 3300025225 Bacteria 1040422
589 Ga0209674_100006 3300025226 Bacteria 1531866
590 Ga0209674_100009 3300025226 Bacteria 1040422
591 Ga0209674_100249 3300025226 Bacteria 45253
592 Ga0209147_100004 3300025229 Bacteria 1371850
593 Ga0209563_100007 3300025230 Bacteria 1579402
594 Ga0209563_100009 3300025230 Bacteria 1378156
595 Ga0209563_100012 3300025230 Bacteria 1040422
596 Ga0207427_100149 3300025231 Bacteria 78920
597 Ga0207427_100485 3300025231 Bacteria 21493
598 Ga0209437_100004 3300025233 Bacteria 1378156
599 Ga0209437_100623 3300025233 Bacteria 21500
600 Ga0209437_101358 3300025233 Bacteria 6327
601 Ga0209437_102147 3300025233 Bacteria 3963
602 Ga0209258_100298 3300025242 Bacteria 81047
603 Ga0209258_100391 3300025242 Bacteria 55848
604 Ga0209646_1000040 3300025246 Bacteria 347867
605 Ga0209646_1000105 3300025246 Bacteria 163453
606 Ga0209026_1000034 3300025250 Bacteria 306953
607 Ga0209026_1002619 3300025250 Bacteria 6572
608 Ga0209677_100005 3300025253 Bacteria 1378156
609 Ga0209677_100006 3300025253 Bacteria 1040422
610 Ga0209677_102934 3300025253 Bacteria 5961
611 Ga0209759_1000234 3300025256 Bacteria 83099
612 Ga0209759_1000569 3300025256 Bacteria 37040
613 Ga0209759_1003262 3300025256 Bacteria 6556
614 Ga0209759_1009116 3300025256 Bacteria 3031
615 Ga0209129_1003748 3300025258 Bacteria 6418
616 Ga0209233_1000005 3300025261 Bacteria 1531866
617 Ga0209233_1000046 3300025261 Bacteria 470971
618 Ga0209455_1024715 3300025272 Bacteria 1105
619 Ga0209676_1000214 3300025292 Bacteria 127818
620 Ga0209676_1001207 3300025292 Bacteria 27585
621 Ga0209676_1001472 3300025292 Bacteria 21882
622 Ga0209025_1000217 3300025294 Bacteria 137909
623 Ga0209564_1000518 3300025295 Bacteria 63204
624 Ga0209758_1000007 3300025297 Bacteria 1270410
625 Ga0209758_1000246 3300025297 Bacteria 111041
626 Ga0209758_1025772 3300025297 Bacteria 2568
627 Ga0209050_1000412 3300025298 Bacteria 79647
628 Ga0209050_1016288 3300025298 Bacteria 3053
629 Ga0209050_1021718 3300025298 Bacteria 2330
630 Ga0209051_1000150 3300025303 Bacteria 132005
631 Ga0209051_1001731 3300025303 Bacteria 17386
632 Ga0209257_1000275 3300025304 Bacteria 116952
633 Ga0209257_1027391 3300025304 Bacteria 1898
634 Ga0207656_10078311 3300025321 Bacteria 1481
635 Ga0207656_10137601 3300025321 Bacteria 1149
636 Ga0207713_1058962 3300025735 Bacteria 1475
637 Ga0207682_10000195 3300025893 Bacteria 27484
638 Ga0207692_10155699 3300025898 Bacteria 1312
639 Ga0207642_10002118 3300025899 Bacteria 6140
640 Ga0207642_10003463 3300025899 Bacteria 4983
641 Ga0207710_10013630 3300025900 Bacteria 3420
642 Ga0207710_10021487 3300025900 Bacteria 2766
643 Ga0207710_10078286 3300025900 Bacteria 1529
644 Ga0207688_10000941 3300025901 Bacteria 14730
645 Ga0207688_10008007 3300025901 Bacteria 5751
646 Ga0207688_10041064 3300025901 Bacteria 2572
647 Ga0207688_10067336 3300025901 Bacteria 2026
648 Ga0207680_10000139 3300025903 Bacteria 34616
649 Ga0207680_10012162 3300025903 Bacteria 4377
650 Ga0207680_10030483 3300025903 Bacteria 3042
651 Ga0207680_10052954 3300025903 Bacteria 2434
652 Ga0207680_10135755 3300025903 Bacteria 1626
653 Ga0207680_10325307 3300025903 Bacteria 1076
654 Ga0207647_10001601 3300025904 Bacteria 17389
655 Ga0207647_10006149 3300025904 Bacteria 8742
656 Ga0207647_10018431 3300025904 Bacteria 4720
657 Ga0207647_10026218 3300025904 Bacteria 3816
658 Ga0207647_10193919 3300025904 Bacteria 1177
659 Ga0207685_10016666 3300025905 Bacteria 2357
660 Ga0207645_10001126 3300025907 Bacteria 22114
661 Ga0207645_10054434 3300025907 Bacteria 2555
662 Ga0207645_10104429 3300025907 Bacteria 1830
663 Ga0207645_10321824 3300025907 Bacteria 1032
664 Ga0207643_10000016 3300025908 Bacteria 121792
665 Ga0207643_10161337 3300025908 Bacteria 1349
666 Ga0207705_10000103 3300025909 Bacteria 97511
667 Ga0207705_10018494 3300025909 Bacteria 4982
668 Ga0207705_10073161 3300025909 Bacteria 2486
669 Ga0207705_10143497 3300025909 Bacteria 1785
670 Ga0207705_10220347 3300025909 Bacteria 1441
671 Ga0207705_10223869 3300025909 Bacteria 1430
672 Ga0207684_10000047 3300025910 Bacteria 244386
673 Ga0207684_10089073 3300025910 Bacteria 2629
674 Ga0207684_10099982 3300025910 Bacteria 2478
675 Ga0207684_10249305 3300025910 Bacteria 1532
676 Ga0207654_10000465 3300025911 Bacteria 23187
677 Ga0207654_10052584 3300025911 Bacteria 2348
678 Ga0207654_10060903 3300025911 Bacteria 2207
679 Ga0207654_10266698 3300025911 Bacteria 1153
680 Ga0207654_10283850 3300025911 Bacteria 1121
681 Ga0207707_10068750 3300025912 Bacteria 3087
682 Ga0207707_10095782 3300025912 Bacteria 2594
683 Ga0207707_10133932 3300025912 Bacteria 2167
684 Ga0207707_10179584 3300025912 Bacteria 1848
685 Ga0207695_10000573 3300025913 Bacteria 75332
686 Ga0207695_10000692 3300025913 Bacteria 66089
687 Ga0207695_10008225 3300025913 Bacteria 13100
688 Ga0207695_10011367 3300025913 Bacteria 10790
689 Ga0207695_10023120 3300025913 Bacteria 7035
690 Ga0207695_10029200 3300025913 Bacteria 6099
691 Ga0207695_10049343 3300025913 Bacteria 4439
692 Ga0207695_10133319 3300025913 Bacteria 2440
693 Ga0207695_10207643 3300025913 Bacteria 1871
694 Ga0207695_10323282 3300025913 Bacteria 1432
695 Ga0207671_10004004 3300025914 Bacteria 14314
696 Ga0207671_10004486 3300025914 Bacteria 13303
697 Ga0207671_10008804 3300025914 Bacteria 8500
698 Ga0207671_10030356 3300025914 Bacteria 4031
699 Ga0207671_10185971 3300025914 Bacteria 1618
700 Ga0207671_10264815 3300025914 Bacteria 1353
701 Ga0207671_10452994 3300025914 Bacteria 1022
702 Ga0207693_10000589 3300025915 Bacteria 32554
703 Ga0207693_10072584 3300025915 Bacteria 2694
704 Ga0207663_10016219 3300025916 Bacteria 4125
705 Ga0207660_10021224 3300025917 Bacteria 4366
706 Ga0207660_10522756 3300025917 Bacteria 964
707 Ga0207662_10000003 3300025918 Bacteria 148717
708 Ga0207662_10019928 3300025918 Bacteria 3822
709 Ga0207657_10000009 3300025919 Bacteria 187503
710 Ga0207657_10002371 3300025919 Bacteria 20373
711 Ga0207657_10003372 3300025919 Bacteria 17076
712 Ga0207657_10053293 3300025919 Bacteria 3505
713 Ga0207657_10099027 3300025919 Bacteria 2422
714 Ga0207657_10144866 3300025919 Bacteria 1938
715 Ga0207649_10000275 3300025920 Bacteria 40550
716 Ga0207649_10003334 3300025920 Bacteria 8787
717 Ga0207649_10010372 3300025920 Bacteria 5117
718 Ga0207649_10059933 3300025920 Bacteria 2390
719 Ga0207652_10057060 3300025921 Bacteria 3362
720 Ga0207652_10063748 3300025921 Bacteria 3188
721 Ga0207646_10035640 3300025922 Bacteria 4493
722 Ga0207681_10000362 3300025923 Bacteria 32331
723 Ga0207681_10004343 3300025923 Bacteria 8747
724 Ga0207681_10042876 3300025923 Bacteria 3025
725 Ga0207681_10076669 3300025923 Bacteria 2348
726 Ga0207681_10140936 3300025923 Bacteria 1795
727 Ga0207681_10178151 3300025923 Bacteria 1617
728 Ga0207694_10000128 3300025924 Bacteria 78863
729 Ga0207694_10000505 3300025924 Bacteria 35291
730 Ga0207694_10006279 3300025924 Bacteria 9075
731 Ga0207694_10007293 3300025924 Bacteria 8389
732 Ga0207694_10023433 3300025924 Bacteria 4685
733 Ga0207694_10024178 3300025924 Bacteria 4613
734 Ga0207694_10028217 3300025924 Bacteria 4279
735 Ga0207694_10520965 3300025924 Bacteria 996
736 Ga0207650_10000025 3300025925 Bacteria 265351
737 Ga0207650_10000692 3300025925 Bacteria 26357
738 Ga0207650_10021626 3300025925 Bacteria 4545
739 Ga0207650_10022454 3300025925 Bacteria 4466
740 Ga0207650_10125334 3300025925 Bacteria 2004
741 Ga0207650_10268968 3300025925 Bacteria 1385
742 Ga0207659_10002164 3300025926 Bacteria 11667
743 Ga0207659_10124115 3300025926 Bacteria 1983
744 Ga0207659_10266995 3300025926 Bacteria 1395
745 Ga0207687_10000184 3300025927 Bacteria 41508
746 Ga0207687_10001005 3300025927 Bacteria 19137
747 Ga0207687_10014501 3300025927 Bacteria 5158
748 Ga0207687_10030914 3300025927 Bacteria 3615
749 Ga0207687_10035875 3300025927 Bacteria 3376
750 Ga0207687_10421197 3300025927 Bacteria 1102
751 Ga0207687_10629811 3300025927 Bacteria 906
752 Ga0207700_10042359 3300025928 Bacteria 3337
753 Ga0207700_10052903 3300025928 Bacteria 3039
754 Ga0207644_10000063 3300025931 Bacteria 78017
755 Ga0207644_10000394 3300025931 Bacteria 28414
756 Ga0207644_10011338 3300025931 Bacteria 5895
757 Ga0207644_10020788 3300025931 Bacteria 4464
758 Ga0207644_10032906 3300025931 Bacteria 3620
759 Ga0207690_10002703 3300025932 Bacteria 10701
760 Ga0207690_10019874 3300025932 Bacteria 4140
761 Ga0207690_10057867 3300025932 Bacteria 2620
762 Ga0207706_10000283 3300025933 Bacteria 55425
763 Ga0207706_10006684 3300025933 Bacteria 10666
764 Ga0207706_10077774 3300025933 Bacteria 2918
765 Ga0207706_10085325 3300025933 Bacteria 2776
766 Ga0207706_10615217 3300025933 Bacteria 932
767 Ga0207686_10001013 3300025934 Bacteria 16644
768 Ga0207686_10004410 3300025934 Bacteria 7551
769 Ga0207686_10046620 3300025934 Bacteria 2675
770 Ga0207709_10000708 3300025935 Bacteria 26838
771 Ga0207709_10004486 3300025935 Bacteria 8057
772 Ga0207709_10071277 3300025935 Bacteria 2206
773 Ga0207709_10084664 3300025935 Bacteria 2053
774 Ga0207709_10453607 3300025935 Bacteria 992
775 Ga0207670_10000805 3300025936 Bacteria 16356
776 Ga0207670_10030039 3300025936 Bacteria 3469
777 Ga0207669_10000292 3300025937 Bacteria 22979
778 Ga0207669_10000331 3300025937 Bacteria 21620
779 Ga0207669_10125716 3300025937 Bacteria 1751
780 Ga0207669_10150555 3300025937 Bacteria 1629
781 Ga0207704_10000761 3300025938 Bacteria 14186
782 Ga0207704_10015537 3300025938 Bacteria 3882
783 Ga0207704_10183674 3300025938 Bacteria 1514
784 Ga0207704_10204749 3300025938 Bacteria 1447
785 Ga0207704_10270914 3300025938 Bacteria 1285
786 Ga0207704_10395005 3300025938 Bacteria 1090
787 Ga0207665_10019597 3300025939 Bacteria 4448
788 Ga0207665_10279987 3300025939 Bacteria 1241
789 Ga0207691_10001649 3300025940 Bacteria 22114
790 Ga0207691_10024020 3300025940 Bacteria 5734
791 Ga0207711_10000157 3300025941 Bacteria 73266
792 Ga0207711_10000291 3300025941 Bacteria 53588
793 Ga0207711_10001136 3300025941 Bacteria 25406
794 Ga0207711_10001959 3300025941 Bacteria 18703
795 Ga0207711_10083588 3300025941 Bacteria 2793
796 Ga0207711_10115778 3300025941 Bacteria 2389
797 Ga0207689_10000009 3300025942 Bacteria 127375
798 Ga0207689_10008955 3300025942 Bacteria 8678
799 Ga0207689_10040023 3300025942 Bacteria 3880
800 Ga0207689_10125276 3300025942 Bacteria 2114
801 Ga0207661_10092935 3300025944 Bacteria 2516
802 Ga0207661_10102334 3300025944 Bacteria 2408
803 Ga0207661_10115324 3300025944 Bacteria 2279
804 Ga0207661_10497480 3300025944 Bacteria 1114
805 Ga0207679_10000458 3300025945 Bacteria 28788
806 Ga0207679_10025262 3300025945 Bacteria 4083
807 Ga0207679_10092308 3300025945 Bacteria 2345
808 Ga0207679_10109447 3300025945 Bacteria 2177
809 Ga0207679_10193017 3300025945 Bacteria 1695
810 Ga0207679_10382166 3300025945 Bacteria 1235
811 Ga0207679_10435874 3300025945 Bacteria 1159
812 Ga0207667_10000001 3300025949 Bacteria 1178522
813 Ga0207667_10000444 3300025949 Bacteria 55540
814 Ga0207667_10016347 3300025949 Bacteria 8388
815 Ga0207667_10020050 3300025949 Bacteria 7444
816 Ga0207667_10024289 3300025949 Bacteria 6657
817 Ga0207667_10043989 3300025949 Bacteria 4736
818 Ga0207667_10115403 3300025949 Bacteria 2768
819 Ga0207667_10156409 3300025949 Bacteria 2345
820 Ga0207667_10205533 3300025949 Bacteria 2019
821 Ga0207667_10416538 3300025949 Bacteria 1367
822 Ga0207667_10449987 3300025949 Bacteria 1309
823 Ga0207667_10533435 3300025949 Bacteria 1188
824 Ga0207667_10704729 3300025949 Bacteria 1012
825 Ga0207651_10000183 3300025960 Bacteria 27331
826 Ga0207651_10040815 3300025960 Bacteria 3074
827 Ga0207651_10054872 3300025960 Bacteria 2733
828 Ga0207651_10194689 3300025960 Bacteria 1620
829 Ga0207651_10413227 3300025960 Bacteria 1150
830 Ga0207712_10001593 3300025961 Bacteria 15281
831 Ga0207712_10002835 3300025961 Bacteria 11102
832 Ga0207712_10011209 3300025961 Bacteria 5709
833 Ga0207712_10054026 3300025961 Bacteria 2820
834 Ga0207712_10277417 3300025961 Bacteria 1367
835 Ga0207712_10437856 3300025961 Bacteria 1106
836 Ga0207712_10507913 3300025961 Bacteria 1031
837 Ga0207668_10000165 3300025972 Bacteria 45827
838 Ga0207668_10009504 3300025972 Bacteria 5834
839 Ga0207668_10091926 3300025972 Bacteria 2231
840 Ga0207668_10098026 3300025972 Bacteria 2171
841 Ga0207668_10099090 3300025972 Bacteria 2161
842 Ga0207668_10107899 3300025972 Bacteria 2083
843 Ga0207668_10142820 3300025972 Bacteria 1843
844 Ga0207640_10001565 3300025981 Bacteria 12291
845 Ga0207640_10008836 3300025981 Bacteria 5609
846 Ga0207640_10053191 3300025981 Bacteria 2642
847 Ga0207640_10106284 3300025981 Bacteria 1979
848 Ga0207658_10000008 3300025986 Bacteria 265351
849 Ga0207658_10000141 3300025986 Bacteria 75673
850 Ga0207658_10004695 3300025986 Bacteria 9464
851 Ga0207658_10011172 3300025986 Bacteria 6116
852 Ga0207658_10025007 3300025986 Bacteria 4179
853 Ga0207658_10025524 3300025986 Bacteria 4138
854 Ga0207658_10037857 3300025986 Bacteria 3470
855 Ga0207658_10043470 3300025986 Bacteria 3266
856 Ga0207658_10071615 3300025986 Bacteria 2625
857 Ga0207658_10132789 3300025986 Bacteria 2003
858 Ga0207658_10560325 3300025986 Bacteria 1023
859 Ga0207677_10000028 3300026023 Bacteria 125165
860 Ga0207677_10001996 3300026023 Bacteria 10780
861 Ga0207677_10260649 3300026023 Bacteria 1413
862 Ga0207677_10267264 3300026023 Bacteria 1397
863 Ga0207677_10304942 3300026023 Bacteria 1317
864 Ga0207677_10469875 3300026023 Bacteria 1081
865 Ga0207703_10000050 3300026035 Bacteria 145849
866 Ga0207703_10000730 3300026035 Bacteria 32306
867 Ga0207703_10000775 3300026035 Bacteria 31437
868 Ga0207703_10002326 3300026035 Bacteria 16598
869 Ga0207703_10010882 3300026035 Bacteria 7093
870 Ga0207703_10023963 3300026035 Bacteria 4801
871 Ga0207703_10025290 3300026035 Bacteria 4669
872 Ga0207703_10332347 3300026035 Bacteria 1394
873 Ga0207639_10001036 3300026041 Bacteria 18873
874 Ga0207639_10003764 3300026041 Bacteria 10207
875 Ga0207639_10005208 3300026041 Bacteria 8771
876 Ga0207639_10005329 3300026041 Bacteria 8685
877 Ga0207639_10009099 3300026041 Bacteria 6843
878 Ga0207639_10037840 3300026041 Bacteria 3586
879 Ga0207639_10067422 3300026041 Bacteria 2784
880 Ga0207639_10082217 3300026041 Bacteria 2553
881 Ga0207639_10146153 3300026041 Bacteria 1975
882 Ga0207639_10217772 3300026041 Bacteria 1647
883 Ga0207639_10301156 3300026041 Bacteria 1417
884 Ga0207639_10348395 3300026041 Bacteria 1322
885 Ga0207639_10395414 3300026041 Bacteria 1244
886 Ga0207639_10397056 3300026041 Bacteria 1242
887 Ga0207639_10693795 3300026041 Bacteria 944
888 Ga0207678_10002449 3300026067 Bacteria 16870
889 Ga0207678_10006228 3300026067 Bacteria 10596
890 Ga0207678_10008968 3300026067 Bacteria 8803
891 Ga0207678_10010216 3300026067 Bacteria 8239
892 Ga0207678_10011956 3300026067 Bacteria 7622
893 Ga0207678_10046182 3300026067 Bacteria 3767
894 Ga0207678_10057773 3300026067 Bacteria 3339
895 Ga0207678_10089763 3300026067 Bacteria 2627
896 Ga0207678_10104114 3300026067 Bacteria 2422
897 Ga0207678_10147235 3300026067 Bacteria 2010
898 Ga0207678_10366960 3300026067 Bacteria 1243
899 Ga0207708_10006313 3300026075 Bacteria 8787
900 Ga0207708_10245596 3300026075 Bacteria 1441
901 Ga0207702_10001345 3300026078 Bacteria 24582
902 Ga0207702_10003495 3300026078 Bacteria 14317
903 Ga0207702_10012547 3300026078 Bacteria 7047
904 Ga0207702_10025685 3300026078 Bacteria 4889
905 Ga0207702_10029127 3300026078 Bacteria 4593
906 Ga0207702_10102507 3300026078 Bacteria 2529
907 Ga0207702_10404403 3300026078 Bacteria 1317
908 Ga0207702_10575685 3300026078 Bacteria 1103
909 Ga0207641_10000118 3300026088 Bacteria 117721
910 Ga0207641_10000193 3300026088 Bacteria 83308
911 Ga0207641_10003787 3300026088 Bacteria 13269
912 Ga0207641_10004315 3300026088 Bacteria 12349
913 Ga0207641_10031368 3300026088 Bacteria 4408
914 Ga0207641_10032091 3300026088 Bacteria 4360
915 Ga0207641_10040969 3300026088 Bacteria 3881
916 Ga0207641_10052521 3300026088 Bacteria 3452
917 Ga0207641_10056001 3300026088 Bacteria 3350
918 Ga0207648_10000279 3300026089 Bacteria 55317
919 Ga0207648_10044153 3300026089 Bacteria 3911
920 Ga0207648_10056971 3300026089 Bacteria 3410
921 Ga0207648_10148462 3300026089 Bacteria 2068
922 Ga0207648_10156359 3300026089 Bacteria 2013
923 Ga0207648_10200762 3300026089 Bacteria 1768
924 Ga0207676_10000024 3300026095 Bacteria 265351
925 Ga0207676_10000312 3300026095 Bacteria 41651
926 Ga0207676_10004121 3300026095 Bacteria 10262
927 Ga0207676_10004895 3300026095 Bacteria 9488
928 Ga0207676_10005657 3300026095 Bacteria 8850
929 Ga0207676_10008079 3300026095 Bacteria 7478
930 Ga0207676_10039477 3300026095 Bacteria 3611
931 Ga0207676_10080263 3300026095 Bacteria 2648
932 Ga0207676_10101118 3300026095 Bacteria 2390
933 Ga0207674_10000103 3300026116 Bacteria 97454
934 Ga0207674_10000881 3300026116 Bacteria 39300
935 Ga0207674_10002555 3300026116 Bacteria 22911
936 Ga0207674_10008403 3300026116 Bacteria 11932
937 Ga0207674_10011957 3300026116 Bacteria 9731
938 Ga0207674_10050271 3300026116 Bacteria 4260
939 Ga0207674_10053743 3300026116 Bacteria 4104
940 Ga0207674_10095789 3300026116 Bacteria 2953
941 Ga0207674_10130942 3300026116 Bacteria 2472
942 Ga0207674_10233707 3300026116 Bacteria 1786
943 Ga0207675_100000005 3300026118 Bacteria 199965
944 Ga0207675_100003128 3300026118 Bacteria 16233
945 Ga0207675_100041220 3300026118 Bacteria 4311
946 Ga0207675_100241708 3300026118 Bacteria 1745
947 Ga0207675_100297415 3300026118 Bacteria 1571
948 Ga0207683_10000089 3300026121 Bacteria 72911
949 Ga0207683_10001013 3300026121 Bacteria 25627
950 Ga0207683_10001682 3300026121 Bacteria 19793
951 Ga0207683_10040657 3300026121 Bacteria 4058
952 Ga0207683_10328249 3300026121 Bacteria 1402
953 Ga0207698_10001282 3300026142 Bacteria 14654
954 Ga0207698_10002146 3300026142 Bacteria 11651
955 Ga0207698_10010548 3300026142 Bacteria 5946
956 Ga0207698_10011002 3300026142 Bacteria 5849
957 Ga0207698_10630146 3300026142 Bacteria 1060
958 Ga0207698_10664284 3300026142 Bacteria 1034
959 Ga0209281_1007736 3300027111 Bacteria 2669
960 Ga0209813_10038558 3300027866 Bacteria 1444
961 Ga0207428_10010847 3300027907 Bacteria 8119
962 Ga0268266_10000001 3300028379 Bacteria 4040580
963 Ga0268266_10000559 3300028379 Bacteria 51883
964 Ga0268266_10001954 3300028379 Bacteria 23169
965 Ga0268266_10010714 3300028379 Bacteria 7989
966 Ga0268266_10013898 3300028379 Bacteria 6932
967 Ga0268266_10084764 3300028379 Bacteria 2768
968 Ga0268266_10200327 3300028379 Bacteria 1827
969 Ga0268266_10370867 3300028379 Bacteria 1348
970 Ga0268266_10616766 3300028379 Bacteria 1043
971 Ga0268265_10000054 3300028380 Bacteria 165504
972 Ga0268265_10000538 3300028380 Bacteria 38660
973 Ga0268265_10000598 3300028380 Bacteria 36284
974 Ga0268265_10020292 3300028380 Bacteria 4636
975 Ga0268265_10037420 3300028380 Bacteria 3562
976 Ga0268265_10367365 3300028380 Bacteria 1319
977 Ga0268264_10000173 3300028381 Bacteria 138426
978 Ga0268264_10000323 3300028381 Bacteria 75489
979 Ga0268264_10001476 3300028381 Bacteria 21939
980 Ga0268264_10003353 3300028381 Bacteria 13843
981 Ga0268264_10003867 3300028381 Bacteria 12847
982 Ga0268264_10009955 3300028381 Bacteria 7872
983 Ga0268264_10016107 3300028381 Bacteria 6125
984 Ga0268264_10037615 3300028381 Bacteria 3990
985 Ga0268264_10073259 3300028381 Bacteria 2906
986 Ga0307515_10000154 3300028794 Bacteria 166582
987 Ga0307515_10004744 3300028794 Bacteria 27847
988 Ga0307515_10073073 3300028794 Bacteria 4616
989 Ga0307515_10262275 3300028794 Bacteria 1462
990 Ga0307511_10072246 3300030521 Bacteria 2508
991 Ga0307512_10024522 3300030522 Bacteria 5365
992 Ga0265762_1006198 3300030760 Bacteria 2143
993 Ga0265330_10026996 3300031235 Bacteria 2595
994 Ga0265328_10000305 3300031239 Bacteria 22931
995 Ga0265328_10010362 3300031239 Bacteria 3756
996 Ga0265328_10014633 3300031239 Bacteria 3086
997 Ga0265328_10145334 3300031239 Bacteria 890
998 Ga0265331_10000005 3300031250 Bacteria 465192
999 Ga0265331_10001445 3300031250 Bacteria 17455
1000 Ga0265331_10001990 3300031250 Bacteria 14269
1001 Ga0265331_10004390 3300031250 Bacteria 8824
1002 Ga0265327_10066157 3300031251 Bacteria 1825
1003 Ga0265316_10001750 3300031344 Bacteria 22990
1004 Ga0265316_10294962 3300031344 Bacteria 1182
1005 Ga0307513_10005286 3300031456 Bacteria 17089
1006 Ga0307509_10001286 3300031507 Bacteria 42598
1007 Ga0307408_100029787 3300031548 Bacteria 3785
1008 Ga0265314_10000595 3300031711 Bacteria 45508
1009 Ga0265314_10004707 3300031711 Bacteria 12526
1010 Ga0265314_10079146 3300031711 Bacteria 2174
1011 Ga0307516_10057185 3300031730 Bacteria 3800
1012 Ga0307516_10491163 3300031730 Bacteria 882
1013 Ga0307412_10002057 3300031911 Bacteria 11167
1014 Ga0307412_10021192 3300031911 Bacteria 3966
1015 Ga0307409_100622917 3300031995 Bacteria 1069
1016 Ga0307416_100110706 3300032002 Bacteria 2419
1017 Ga0307416_100150505 3300032002 Bacteria 2133
1018 Ga0307411_10030049 3300032005 Bacteria 3327
1019 Ga0307411_10233142 3300032005 Bacteria 1436
1020 Ga0307507_10089135 3300033179 Bacteria 2656
1021 Ga0307510_10002924 3300033180 Bacteria 19645
1022 Ga0307510_10038410 3300033180 Bacteria 5293
1023 Ga0307510_10210097 3300033180 Bacteria 1469
1024 Ga0373958_0002456 3300034819 Bacteria 2600
1025 Ga0373926_0111039 3300035083 Bacteria 1030
1026 Ga0373923_0043737 3300035111 Bacteria 1854
1027 Ga0373932_0018271 3300035112 Bacteria 1810
1028 Ga0373936_0009456 3300035113 Bacteria 3676
1029 Ga0373936_0090957 3300035113 Bacteria 1279
1030 Ga0373941_0006795 3300035115 Bacteria 2772
1031 Ga0373945_0025975 3300035116 Bacteria 2038
1032 Ga0373953_0006322 3300035117 Bacteria 3898
1033 Ga0373954_0008296 3300035118 Bacteria 4557
1034 Ga0373954_0063653 3300035118 Bacteria 1743
1035 Ga0373956_0012525 3300035119 Bacteria 3517
1036 Ga0373943_0003378 3300035170 Bacteria 7255
1037 Ga0373943_0009425 3300035170 Bacteria 4376
1038 Ga0373943_0035578 3300035170 Bacteria 2381
1039 Ga0373946_0057194 3300035171 Bacteria 1649
1040 Ga0373942_0003016 3300035207 Bacteria 3988
1041 Ga0373961_0001242 3300035241 Bacteria 7820
1042 Ga0373924_0043006 3300035410 Bacteria 1855
1043 Ga0373931_0012753 3300035691 Bacteria 4078
1044 Ga0373935_0032485 3300035692 Bacteria 3244
1045 Ga0373935_0128506 3300035692 Bacteria 1700
1046 Ga0373927_0003672 3300035695 Bacteria 10930
1047 Ga0373927_0096268 3300035695 Bacteria 1924
1048 Ga0373927_0170458 3300035695 Bacteria 1427
1049 Ga0373933_0117769 3300035724 Bacteria 1661
1050 Ga0373947_0001397 3300035725 Bacteria 14855
1051 Ga0373947_0106013 3300035725 Bacteria 1771
1052 Ga0373937_0009697 3300036401 Bacteria 8392
1053 Ga0373937_0352850 3300036401 Bacteria 1393
1054 Ga0316584_0205226 3300036712 Bacteria 1453
1055 Ga0373925_0003939 3300037068 Bacteria 11333
1056 Ga0373925_0011747 3300037068 Bacteria 6335
1057 Ga0373925_0183437 3300037068 Bacteria 1658
1058 Ga0395899_0001400 3300037312 Bacteria 20673
1059 Ga0395899_0004896 3300037312 Bacteria 10422
1060 Ga0395899_0099577 3300037312 Bacteria 2100
1061 Ga0395899_0162548 3300037312 Bacteria 1576
1062 Ga0395899_0180807 3300037312 Bacteria 1481
1063 Ga0395900_0003405 3300037418 Bacteria 17181
1064 Ga0395900_0014128 3300037418 Bacteria 8153
1065 Ga0395900_0019708 3300037418 Bacteria 6876
1066 Ga0395900_0053959 3300037418 Bacteria 4137
1067 Ga0395900_0080388 3300037418 Bacteria 3349
1068 Ga0395900_0121199 3300037418 Bacteria 2683
1069 Ga0395900_0125446 3300037418 Bacteria 2633
1070 Ga0395900_0174570 3300037418 Bacteria 2186
1071 Ga0395900_0533252 3300037418 Bacteria 1120
1072 Ga0395898_0003681 3300037466 Bacteria 17022
1073 Ga0395898_0008334 3300037466 Bacteria 10958
1074 Ga0395898_0012207 3300037466 Bacteria 8885
1075 Ga0395898_0015516 3300037466 Bacteria 7812
1076 Ga0395898_0033102 3300037466 Bacteria 5159
1077 Ga0395898_0049703 3300037466 Bacteria 4108
1078 Ga0395898_0069491 3300037466 Bacteria 3407
1079 Ga0395898_0132814 3300037466 Bacteria 2383
1080 Ga0395905_0009017 3300037471 Bacteria 9786
1081 Ga0395905_0012637 3300037471 Bacteria 8122
1082 Ga0395905_0015530 3300037471 Bacteria 7236
1083 Ga0395905_0025270 3300037471 Bacteria 5601
1084 Ga0395905_0025886 3300037471 Bacteria 5529
1085 Ga0395905_0031850 3300037471 Bacteria 4962
1086 Ga0395905_0083763 3300037471 Bacteria 2987
1087 Ga0395905_0244718 3300037471 Bacteria 1676
1088 Ga0395905_0523020 3300037471 Bacteria 1087
1089 Ga0436364_0748271 3300037853 Bacteria 3125
1090 Ga0395901_0000715 3300038443 Bacteria 37852
1091 Ga0395901_0001760 3300038443 Bacteria 22342
1092 Ga0395901_0072646 3300038443 Bacteria 3586
1093 Ga0395901_0198955 3300038443 Bacteria 2100
1094 Ga0395901_0433200 3300038443 Bacteria 1347
1095 Ga0395901_0681071 3300038443 Bacteria 1028
1096 Ga0395901_0766522 3300038443 Bacteria 956
1097 Ga0436365_0476052 3300039437 Bacteria 2126
1098 Ga0436361_0129708 3300039447 Bacteria 10947
1099 Ga0436361_0663813 3300039447 Bacteria 1674
1100 Ga0436361_0928183 3300039447 Bacteria 11188
1101 Ga0436363_0216924 3300039450 Bacteria 1757
1102 Ga0436363_0283319 3300039450 Bacteria 3571
1103 Ga0439436_0002769 3300041404 Bacteria 5304
1104 Ga0439439_0020708 3300041406 Bacteria 1636
1105 Ga0451787_683669 3300041441 Bacteria 3141
1106 Ga0451789_0622405 3300041443 Bacteria 1093
1107 Ga0451793_1344463 3300041452 Bacteria 7396
1108 Ga0451800_0389109 3300041459 Bacteria 1223
1109 Ga0451802_0053535 3300041460 Bacteria 5889
1110 Ga0451837_1160533 3300041494 Bacteria 1831
1111 Ga0439448_0004510 3300042005 Bacteria 3933
1112 Ga0450906_004168 3300042145 Bacteria 3051
1113 Ga0439458_0003180 3300042157 Bacteria 3892
1114 Ga0439458_0016138 3300042157 Bacteria 1697
1115 Ga0451577_0010744 3300042876 Bacteria 8712
1116 Ga0466969_0014983 3300044656 Bacteria 4067
1117 Ga0466972_0003347 3300044658 Bacteria 7947
1118 Ga0466972_0010376 3300044658 Bacteria 4677
1119 Ga0453683_0010101 3300044673 Bacteria 6271
1120 Ga0466965_0005619 3300044683 Bacteria 5658
1121 Ga0466966_0006129 3300044684 Bacteria 7944
1122 Ga0466966_0019399 3300044684 Bacteria 4474
1123 Ga0466966_0076585 3300044684 Bacteria 2088
1124 Ga0466966_0133242 3300044684 Bacteria 1520
1125 Ga0466961_0218336 3300044693 Bacteria 1175
1126 Ga0466963_0018485 3300044694 Bacteria 4359
1127 Ga0466963_0079955 3300044694 Bacteria 2212
1128 Ga0466964_0000235 3300044706 Bacteria 15877
1129 Ga0453684_0208094 3300044712 Bacteria 2276
1130 Ga0466971_0216808 3300044719 Bacteria 906
1131 Ga0466968_0000415 3300044735 Bacteria 14183
1132 Ga0466968_0007387 3300044735 Bacteria 4177
1133 Ga0466970_0333302 3300044765 Bacteria 859
1134 Ga0466957_0000271 3300044842 Bacteria 25090
1135 Ga0466957_0009540 3300044842 Bacteria 5542
1136 Ga0466957_0072442 3300044842 Bacteria 2133
1137 Ga0466960_0250857 3300044901 Bacteria 983
1138 Ga0466959_0002938 3300045049 Bacteria 10998
1139 Ga0466959_0006494 3300045049 Bacteria 8104
1140 Ga0466959_0006800 3300045049 Bacteria 7968
1141 Ga0466959_0156857 3300045049 Bacteria 1602
1142 Ga0451576_0001258 3300045051 Bacteria 44537
1143 Ga0451576_0054023 3300045051 Bacteria 4206
1144 Ga0451576_0278462 3300045051 Bacteria 1749
1145 Ga0466958_0106493 3300045836 Bacteria 1748
1146 Ga0466958_0227851 3300045836 Bacteria 1190
1147 Ga0466967_0008678 3300045976 Bacteria 7478
1148 Ga0466967_0082919 3300045976 Bacteria 2898
1149 Ga0466967_0114991 3300045976 Bacteria 2477
1150 Ga0466967_0191822 3300045976 Bacteria 1931
1151 Ga0466967_0219628 3300045976 Bacteria 1805
1152 Ga0466967_0819173 3300045976 Bacteria 924
1153 Ga0466967_1090519 3300045976 Bacteria 795
1154 Ga0495627_001489 3300046453 Bacteria 13555
1155 Ga0495603_0065699 3300046455 Bacteria 2138
1156 Ga0495603_0229061 3300046455 Bacteria 1071
1157 Ga0495590_0000245 3300046457 Bacteria 29532
1158 Ga0495590_0000893 3300046457 Bacteria 13364
1159 Ga0495629_0011583 3300046459 Bacteria 6404
1160 Ga0495629_0270571 3300046459 Bacteria 1167
1161 Ga0495638_0000439 3300046460 Bacteria 50194
1162 Ga0495638_0008167 3300046460 Bacteria 7441
1163 Ga0495641_0067069 3300046461 Bacteria 1614
1164 Ga0495641_0090628 3300046461 Bacteria 1366
1165 Ga0495651_0001138 3300046462 Bacteria 20564
1166 Ga0495651_0012632 3300046462 Bacteria 6516
1167 Ga0495651_0031145 3300046462 Bacteria 4161
1168 Ga0495651_0076662 3300046462 Bacteria 2532
1169 Ga0495653_0007087 3300046463 Bacteria 9192
1170 Ga0495653_0071517 3300046463 Bacteria 2593
1171 Ga0495650_0000075 3300046471 Bacteria 250589
1172 Ga0495650_0000215 3300046471 Bacteria 122533
1173 Ga0495650_0033470 3300046471 Bacteria 2287
1174 Ga0495650_0072877 3300046471 Bacteria 1343
1175 Ga0495580_0076149 3300046472 Bacteria 2340
1176 Ga0495582_0032532 3300046473 Bacteria 2868
1177 Ga0495605_0000027 3300046474 Bacteria 220680
1178 Ga0495605_0138811 3300046474 Bacteria 1092
1179 Ga0495639_0076887 3300046475 Bacteria 1549
1180 Ga0495662_0153159 3300046476 Bacteria 1135
1181 Ga0495664_0007128 3300046477 Bacteria 6198
1182 Ga0495664_0101700 3300046477 Bacteria 1732
1183 Ga0495584_0001461 3300046491 Bacteria 14195
1184 Ga0495584_0016429 3300046491 Bacteria 3774
1185 Ga0495584_0019698 3300046491 Bacteria 3428
1186 Ga0495584_0055561 3300046491 Bacteria 1992
1187 Ga0495585_0064413 3300046492 Bacteria 2010
1188 Ga0495585_0162785 3300046492 Bacteria 1157
1189 Ga0495596_0032957 3300046500 Bacteria 2063
1190 Ga0495596_0102211 3300046500 Bacteria 1113
1191 Ga0495607_0000337 3300046501 Bacteria 48518
1192 Ga0495607_0000754 3300046501 Bacteria 31011
1193 Ga0495607_0004634 3300046501 Bacteria 10066
1194 Ga0495607_0006533 3300046501 Bacteria 8197
1195 Ga0495583_0000071 3300046506 Bacteria 183691
1196 Ga0495583_0000122 3300046506 Bacteria 132255
1197 Ga0495606_0000497 3300046507 Bacteria 64227
1198 Ga0495606_0001806 3300046507 Bacteria 27233
1199 Ga0495606_0004505 3300046507 Bacteria 13879
1200 Ga0495606_0007233 3300046507 Bacteria 10004
1201 Ga0495606_0110074 3300046507 Bacteria 1663
1202 Ga0495608_0047614 3300046511 Bacteria 2849
1203 Ga0495610_0004566 3300046512 Bacteria 10178
1204 Ga0495610_0005943 3300046512 Bacteria 8548
1205 Ga0495616_0000088 3300046513 Bacteria 77629
1206 Ga0495616_0000318 3300046513 Bacteria 38489
1207 Ga0495616_0001828 3300046513 Bacteria 14412
1208 Ga0495616_0009569 3300046513 Bacteria 5657
1209 Ga0495616_0022784 3300046513 Bacteria 3378
1210 Ga0495616_0054343 3300046513 Bacteria 1986
1211 Ga0495616_0115293 3300046513 Bacteria 1245
1212 Ga0495618_0034445 3300046514 Bacteria 3175
1213 Ga0495628_0001036 3300046516 Bacteria 25436
1214 Ga0495628_0006847 3300046516 Bacteria 9907
1215 Ga0495628_0118398 3300046516 Bacteria 2033
1216 Ga0495628_0173989 3300046516 Bacteria 1631
1217 Ga0495630_0075746 3300046517 Bacteria 2535
1218 Ga0495631_0012715 3300046518 Bacteria 4102
1219 Ga0495631_0047094 3300046518 Bacteria 1894
1220 Ga0495631_0112480 3300046518 Bacteria 1171
1221 Ga0495632_0000385 3300046519 Bacteria 42145
1222 Ga0495632_0002332 3300046519 Bacteria 14575
1223 Ga0495643_0000154 3300046522 Bacteria 112250
1224 Ga0495643_0047939 3300046522 Bacteria 2311
1225 Ga0495648_0034989 3300046524 Bacteria 3261
1226 Ga0495663_0002266 3300046525 Bacteria 5847
1227 Ga0495666_0011560 3300046526 Bacteria 4400
1228 Ga0495666_0162121 3300046526 Bacteria 1037
1229 Ga0495642_0020879 3300046528 Bacteria 2575
1230 Ga0495642_0025329 3300046528 Bacteria 2351
1231 Ga0495652_0007912 3300046529 Bacteria 9759
1232 Ga0495652_0011509 3300046529 Bacteria 8000
1233 Ga0495652_0097503 3300046529 Bacteria 2391
1234 Ga0495665_0001290 3300046531 Bacteria 13376
1235 Ga0495665_0034208 3300046531 Bacteria 2717
1236 Ga0495665_0235598 3300046531 Bacteria 944
1237 Ga0495587_0011313 3300046536 Bacteria 5656
1238 Ga0495587_0046603 3300046536 Bacteria 2572
1239 Ga0495609_0000009 3300046538 Bacteria 354860
1240 Ga0495609_0000124 3300046538 Bacteria 84411
1241 Ga0495621_0001362 3300046539 Bacteria 6318
1242 Ga0495621_0148442 3300046539 Bacteria 921
1243 Ga0495597_0142981 3300046542 Bacteria 986
1244 Ga0495645_0003363 3300046543 Bacteria 10842
1245 Ga0495645_0058688 3300046543 Bacteria 2791
1246 Ga0495645_0066983 3300046543 Bacteria 2593
1247 Ga0495622_0000007 3300046557 Bacteria 239352
1248 Ga0495622_0000427 3300046557 Bacteria 27809
1249 Ga0495622_0001376 3300046557 Bacteria 12403
1250 Ga0495622_0026543 3300046557 Bacteria 2704
1251 Ga0495656_0270363 3300046615 Bacteria 863
1252 Ga0495668_0023138 3300046616 Bacteria 3546
1253 Ga0495668_0067119 3300046616 Bacteria 1973
1254 Ga0495634_0076029 3300046642 Bacteria 2205
1255 Ga0495625_0020935 3300046660 Bacteria 5042
1256 Ga0495625_0024501 3300046660 Bacteria 4592
1257 Ga0495625_0039388 3300046660 Bacteria 3451
1258 Ga0495635_0019638 3300046663 Bacteria 4707
1259 Ga0495635_0156531 3300046663 Bacteria 1551
1260 Ga0495661_0000032 3300046665 Bacteria 170076
1261 Ga0495661_0000094 3300046665 Bacteria 109394
1262 Ga0495661_0004034 3300046665 Bacteria 10697
1263 Ga0495661_0005699 3300046665 Bacteria 8814
1264 Ga0495661_0032246 3300046665 Bacteria 3313
1265 Ga0495661_0147829 3300046665 Bacteria 1271
1266 Ga0495588_0000055 3300046674 Bacteria 280059
1267 Ga0495657_0076494 3300046675 Bacteria 2174
1268 Ga0495657_0103445 3300046675 Bacteria 1812
1269 Ga0495599_0004365 3300046678 Bacteria 8374
1270 Ga0495623_0008428 3300046679 Bacteria 6697
1271 Ga0495623_0042669 3300046679 Bacteria 2889
1272 Ga0495646_0000769 3300046680 Bacteria 17863
1273 Ga0495646_0101233 3300046680 Bacteria 1652
1274 Ga0495658_0058970 3300046683 Bacteria 2197
1275 Ga0495658_0503193 3300046683 Bacteria 775
1276 Ga0495669_0184053 3300046684 Bacteria 996
1277 Ga0495624_0003522 3300046690 Bacteria 11607
1278 Ga0495624_0067380 3300046690 Bacteria 2233
1279 Ga0495670_0006312 3300046691 Bacteria 5821
1280 Ga0495670_0097903 3300046691 Bacteria 1508
1281 Ga0495671_0022016 3300046692 Bacteria 3343
1282 Ga0495649_0000286 3300046694 Bacteria 44673
1283 Ga0495589_0000019 3300046794 Bacteria 200814
1284 Ga0495589_0000148 3300046794 Bacteria 65054
1285 Ga0495589_0046879 3300046794 Bacteria 2143
1286 Ga0495600_0000302 3300046809 Bacteria 26375
1287 Ga0495600_0000460 3300046809 Bacteria 21142
1288 Ga0495660_0004474 3300046810 Bacteria 8453
1289 Ga0495581_0001785 3300047315 Bacteria 12020
1290 Ga0495581_0018356 3300047315 Bacteria 4062
1291 Ga0495604_0083846 3300047317 Bacteria 2381
1292 Ga0495604_0095241 3300047317 Bacteria 2199
1293 Ga0495604_0138144 3300047317 Bacteria 1744
1294 Ga0495674_0077717 3300047319 Bacteria 2853
1295 Ga0495676_0246741 3300047321 Bacteria 1220
1296 Ga0495680_0167858 3300047322 Bacteria 1590
1297 Ga0495683_0205411 3300047323 Bacteria 886
1298 Ga0495687_000024 3300047443 Bacteria 316676
1299 Ga0495687_000046 3300047443 Bacteria 210412
1300 Ga0495687_000132 3300047443 Bacteria 114685
1301 Ga0495687_000947 3300047443 Bacteria 29896
1302 Ga0495675_0255198 3300047444 Bacteria 1052
1303 Ga0495677_0000018 3300047445 Bacteria 120412
1304 Ga0495677_0000059 3300047445 Bacteria 62937
1305 Ga0495677_0000476 3300047445 Bacteria 17122
1306 Ga0495677_0018821 3300047445 Bacteria 2504
1307 Ga0495677_0044344 3300047445 Bacteria 1630
1308 Ga0495673_0000163 3300047469 Bacteria 114230
1309 Ga0495673_0000199 3300047469 Bacteria 93637
1310 Ga0495681_0170031 3300047470 Bacteria 902
1311 Ga0495684_0006624 3300047471 Bacteria 8984
1312 Ga0495686_0001232 3300047472 Bacteria 29230
1313 Ga0495686_0008573 3300047472 Bacteria 7486
1314 Ga0495593_0007919 3300047673 Bacteria 6190
1315 Ga0495593_0024798 3300047673 Bacteria 3320
1316 Ga0495593_0126683 3300047673 Bacteria 1298
1317 Ga0495602_0011414 3300048088 Bacteria 9187
1318 Ga0495602_0049139 3300048088 Bacteria 3781
1319 Ga0495602_0056928 3300048088 Bacteria 3434
1320 Ga0495602_0187276 3300048088 Bacteria 1590
1321 Ga0495626_0000054 3300048091 Bacteria 154997
1322 Ga0495626_0000683 3300048091 Bacteria 32511
1323 Ga0495626_0001301 3300048091 Bacteria 20372
1324 Ga0495626_0028157 3300048091 Bacteria 2726
1325 Ga0496100_0497442 3300048903 Bacteria 939
1326 Ga0496101_0030143 3300048904 Bacteria 3801
1327 Ga0496101_0722822 3300048904 Bacteria 786
1328 Ga0496102_0003046 3300048905 Bacteria 14198
1329 Ga0496102_0669119 3300048905 Bacteria 961
1330 Ga0496103_0051171 3300048906 Bacteria 2556
1331 Ga0496103_0208136 3300048906 Bacteria 1258
1332 Ga0496103_0239513 3300048906 Bacteria 1167
1333 Ga0496105_0288617 3300048908 Bacteria 1321
1334 Ga0496106_0064665 3300048909 Bacteria 2783
1335 Ga0496106_0275132 3300048909 Bacteria 1348
1336 Ga0496106_0361909 3300048909 Bacteria 1165
1337 Ga0496107_0000027 3300048910 Bacteria 108619
1338 Ga0496107_0100304 3300048910 Bacteria 2122
1339 Ga0496107_0199673 3300048910 Bacteria 1487
1340 Ga0496108_0724010 3300048911 Bacteria 862
1341 Ga0496109_0003908 3300048912 Bacteria 12450
1342 Ga0496109_0009801 3300048912 Bacteria 8179
1343 Ga0496109_0023139 3300048912 Bacteria 5512
1344 Ga0496109_0149227 3300048912 Bacteria 2188
1345 Ga0496109_0251673 3300048912 Bacteria 1664
1346 Ga0496109_0394737 3300048912 Bacteria 1307
1347 Ga0496109_0454945 3300048912 Bacteria 1209
1348 Ga0496110_0009845 3300048913 Bacteria 7746
1349 Ga0496110_0052917 3300048913 Bacteria 3568
1350 Ga0496110_0088567 3300048913 Bacteria 2765
1351 Ga0496110_0681512 3300048913 Bacteria 929
1352 Ga0496110_0742893 3300048913 Bacteria 884
1353 Ga0496111_0007923 3300048914 Bacteria 7006
1354 Ga0496112_0001433 3300048915 Bacteria 18299
1355 Ga0496112_0002904 3300048915 Bacteria 13953
1356 Ga0496112_0051152 3300048915 Bacteria 4052
1357 Ga0496112_0190148 3300048915 Bacteria 2015
1358 Ga0496113_0011411 3300048916 Bacteria 5924
1359 Ga0496113_0101328 3300048916 Bacteria 2232
1360 Ga0496114_0038708 3300048917 Bacteria 3946
1361 Ga0496114_0106590 3300048917 Bacteria 2398
1362 Ga0496114_0151381 3300048917 Bacteria 2013
1363 Ga0496114_0201638 3300048917 Bacteria 1742
1364 Ga0496115_0000002 3300048918 Bacteria 365286
1365 Ga0496115_0014651 3300048918 Bacteria 5939
1366 Ga0496115_0208790 3300048918 Bacteria 1613
1367 Ga0496116_0014477 3300048919 Bacteria 6294
1368 Ga0496116_0034118 3300048919 Bacteria 3597
1369 Ga0496116_0130384 3300048919 Bacteria 1435
1370 Ga0496118_0000559 3300048921 Bacteria 61311
1371 Ga0496118_0000565 3300048921 Bacteria 61226
1372 Ga0496118_0003882 3300048921 Bacteria 18351
1373 Ga0496118_0009060 3300048921 Bacteria 10142
1374 Ga0496118_0150034 3300048921 Bacteria 1461
1375 Ga0496120_0096251 3300048923 Bacteria 1573
1376 Ga0496121_0000059 3300048924 Bacteria 278177
1377 Ga0496121_0000763 3300048924 Bacteria 59158
1378 Ga0496121_0063308 3300048924 Bacteria 3023
1379 Ga0496121_0243345 3300048924 Bacteria 1252
1380 Ga0496122_0000501 3300048925 Bacteria 81470
1381 Ga0496122_0002154 3300048925 Bacteria 28898
1382 Ga0496122_0002573 3300048925 Bacteria 25486
1383 Ga0496123_0000029 3300048926 Bacteria 295871
1384 Ga0496123_0002577 3300048926 Bacteria 22061
1385 Ga0496123_0074939 3300048926 Bacteria 2091
1386 Ga0496124_0000226 3300048927 Bacteria 110448
1387 Ga0496124_0000306 3300048927 Bacteria 90641
1388 Ga0496124_0004880 3300048927 Bacteria 15426
1389 Ga0496124_0031755 3300048927 Bacteria 4671
1390 Ga0496125_0005346 3300048928 Bacteria 14333
1391 Ga0496125_0024695 3300048928 Bacteria 5519
1392 Ga0496125_0171540 3300048928 Bacteria 1457
1393 Ga0496125_0267672 3300048928 Bacteria 1067
1394 Ga0496126_0000052 3300048929 Bacteria 312383
1395 Ga0496126_0019169 3300048929 Bacteria 6745
1396 Ga0496126_0067028 3300048929 Bacteria 3208
1397 Ga0496126_0168660 3300048929 Bacteria 1867
1398 Ga0496126_0548948 3300048929 Bacteria 917
1399 Ga0501309_002235 3300049129 Bacteria 2058
1400 Ga0495678_001117 3300049459 Bacteria 22317
1401 Ga0495678_002508 3300049459 Bacteria 12363
1402 Ga0495678_005616 3300049459 Bacteria 6863
1403 Ga0495682_0008940 3300049460 Bacteria 3928
1404 Ga0495682_0028829 3300049460 Bacteria 2056
1405 Ga0501292_006670 3300049515 Bacteria 1648
1406 Ga0501031_0002712 3300049568 Bacteria 11269
1407 Ga0501031_0078143 3300049568 Bacteria 2156
1408 Ga0501031_0109746 3300049568 Bacteria 1801
1409 Ga0501032_0006069 3300049569 Bacteria 8902
1410 Ga0501032_0011007 3300049569 Bacteria 6503
1411 Ga0501032_0012880 3300049569 Bacteria 5961
1412 Ga0501032_0084696 3300049569 Bacteria 2107
1413 Ga0501032_0732474 3300049569 Bacteria 626
1414 Ga0501033_0003340 3300049570 Bacteria 13243
1415 Ga0501033_0042973 3300049570 Bacteria 3367
1416 Ga0501033_0117854 3300049570 Bacteria 1929
1417 Ga0501033_0135239 3300049570 Bacteria 1783
1418 Ga0501034_0000242 3300049571 Bacteria 101072
1419 Ga0501034_0000245 3300049571 Bacteria 100221
1420 Ga0501034_0005369 3300049571 Bacteria 14029
1421 Ga0501034_0006882 3300049571 Bacteria 12159
1422 Ga0501034_0014233 3300049571 Bacteria 8200
1423 Ga0501036_0011156 3300049572 Bacteria 7433
1424 Ga0501036_0101038 3300049572 Bacteria 2440
1425 Ga0501036_0115335 3300049572 Bacteria 2269
1426 Ga0501036_0175700 3300049572 Bacteria 1803
1427 Ga0501036_0387272 3300049572 Bacteria 1166
1428 Ga0501036_0586298 3300049572 Bacteria 925
1429 Ga0501037_0004205 3300049573 Bacteria 10439
1430 Ga0501037_0017736 3300049573 Bacteria 5238
1431 Ga0501037_0024296 3300049573 Bacteria 4482
1432 Ga0501037_0101560 3300049573 Bacteria 2075
1433 Ga0501037_0153391 3300049573 Bacteria 1645
1434 Ga0501037_0201653 3300049573 Unclassified 1406
1435 Ga0501037_0253082 3300049573 Bacteria 1232
1436 Ga0501038_0002716 3300049574 Bacteria 16504
1437 Ga0501038_0004923 3300049574 Bacteria 12404
1438 Ga0501038_0011201 3300049574 Bacteria 8188
1439 Ga0501038_0030294 3300049574 Bacteria 4789
1440 Ga0501038_0084083 3300049574 Bacteria 2678
1441 Ga0501038_0175774 3300049574 Bacteria 1730
1442 Ga0501038_0352330 3300049574 Bacteria 1146
1443 Ga0501039_0010025 3300049575 Bacteria 7225
1444 Ga0501039_0010465 3300049575 Bacteria 7069
1445 Ga0501039_0020230 3300049575 Bacteria 5102
1446 Ga0501039_0069685 3300049575 Bacteria 2731
1447 Ga0501039_0142408 3300049575 Bacteria 1883
1448 Ga0501039_0271286 3300049575 Bacteria 1333
1449 Ga0501040_0077616 3300049576 Bacteria 2298
1450 Ga0501040_0078028 3300049576 Bacteria 2291
1451 Ga0501040_0229025 3300049576 Bacteria 1323
1452 Ga0501040_0268897 3300049576 Bacteria 1217
1453 Ga0501040_0323391 3300049576 Bacteria 1103
1454 Ga0501040_0325569 3300049576 Bacteria 1099
1455 Ga0501041_0017939 3300049577 Bacteria 4213
1456 Ga0501041_0018502 3300049577 Bacteria 4150
1457 Ga0501041_0243055 3300049577 Bacteria 1131
1458 Ga0501042_0008235 3300049578 Bacteria 6871
1459 Ga0501042_0041030 3300049578 Bacteria 3290
1460 Ga0501042_0113169 3300049578 Bacteria 1954
1461 Ga0501042_0120129 3300049578 Bacteria 1892
1462 Ga0501043_0002911 3300049579 Bacteria 14286
1463 Ga0501043_0041516 3300049579 Bacteria 3614
1464 Ga0501043_0048633 3300049579 Bacteria 3334
1465 Ga0501043_0098165 3300049579 Bacteria 2302
1466 Ga0501043_0137542 3300049579 Bacteria 1913
1467 Ga0501043_0472679 3300049579 Bacteria 939
1468 Ga0501043_0482858 3300049579 Bacteria 927
1469 Ga0501043_0494370 3300049579 Bacteria 914
1470 Ga0501046_0006273 3300049580 Bacteria 10547
1471 Ga0501046_0028467 3300049580 Bacteria 4549
1472 Ga0501046_0036929 3300049580 Bacteria 3928
1473 Ga0501046_0131771 3300049580 Bacteria 1896
1474 Ga0501046_0132074 3300049580 Bacteria 1893
1475 Ga0501046_0174670 3300049580 Bacteria 1610
1476 Ga0501046_0180154 3300049580 Bacteria 1580
1477 Ga0501046_0393622 3300049580 Bacteria 1001
1478 Ga0501047_0000054 3300049581 Bacteria 149749
1479 Ga0501047_0000530 3300049581 Bacteria 41265
1480 Ga0501047_0001045 3300049581 Bacteria 27629
1481 Ga0501047_0001922 3300049581 Bacteria 19965
1482 Ga0501047_0010962 3300049581 Bacteria 8576
1483 Ga0501047_0019383 3300049581 Bacteria 6525
1484 Ga0501047_0037961 3300049581 Bacteria 4659
1485 Ga0501047_0107100 3300049581 Bacteria 2677
1486 Ga0501047_0136566 3300049581 Bacteria 2332
1487 Ga0501047_0151061 3300049581 Bacteria 2198
1488 Ga0501047_0244419 3300049581 Bacteria 1644
1489 Ga0501047_0396114 3300049581 Bacteria 1214
1490 Ga0501048_0033223 3300049582 Bacteria 3728
1491 Ga0501067_0000246 3300049583 Bacteria 29961
1492 Ga0501067_0001614 3300049583 Bacteria 12352
1493 Ga0501067_0262370 3300049583 Bacteria 962
1494 Ga0501068_0001112 3300049584 Bacteria 14222
1495 Ga0501068_0042130 3300049584 Bacteria 2745
1496 Ga0501068_0045491 3300049584 Bacteria 2645
1497 Ga0501068_0092243 3300049584 Bacteria 1870
1498 Ga0501069_0001146 3300049585 Bacteria 12815
1499 Ga0501069_0042165 3300049585 Bacteria 2524
1500 Ga0501070_0001709 3300049586 Bacteria 19474
1501 Ga0501070_0022433 3300049586 Bacteria 5287
1502 Ga0501070_0040094 3300049586 Bacteria 3906
1503 Ga0501070_0588875 3300049586 Bacteria 887
1504 Ga0501071_0016873 3300049587 Bacteria 5023
1505 Ga0501071_0059742 3300049587 Bacteria 2759
1506 Ga0501071_0096852 3300049587 Bacteria 2172
1507 Ga0501072_0000311 3300049588 Bacteria 34577
1508 Ga0501072_0042779 3300049588 Bacteria 3559
1509 Ga0501072_0050205 3300049588 Bacteria 3285
1510 Ga0501072_0089288 3300049588 Bacteria 2446
1511 Ga0501072_0107511 3300049588 Bacteria 2219
1512 Ga0501073_0005005 3300049589 Bacteria 9942
1513 Ga0501073_0009083 3300049589 Bacteria 7336
1514 Ga0501073_0013151 3300049589 Bacteria 6032
1515 Ga0501073_0052608 3300049589 Bacteria 2851
1516 Ga0501073_0083452 3300049589 Bacteria 2223
1517 Ga0501073_0188684 3300049589 Bacteria 1426
1518 Ga0501073_0280077 3300049589 Bacteria 1150
1519 Ga0501074_0052622 3300049590 Bacteria 2938
1520 Ga0501075_0001489 3300049591 Bacteria 15266
1521 Ga0501075_0069062 3300049591 Bacteria 2670
1522 Ga0501076_0015138 3300049592 Bacteria 5823
1523 Ga0501076_0291253 3300049592 Bacteria 1338
1524 Ga0501077_0002291 3300049593 Bacteria 11528
1525 Ga0501077_0057276 3300049593 Bacteria 2475
1526 Ga0501077_0075324 3300049593 Bacteria 2137
1527 Ga0501077_0153892 3300049593 Bacteria 1459
1528 Ga0501079_0002396 3300049741 Bacteria 13591
1529 Ga0501079_0109044 3300049741 Bacteria 2150
1530 Ga0501079_0170978 3300049741 Bacteria 1694
1531 Ga0501079_0314632 3300049741 Bacteria 1225
1532 Ga0501080_0000041 3300049742 Bacteria 81554
1533 Ga0501080_0000948 3300049742 Bacteria 23724
1534 Ga0501080_0019336 3300049742 Bacteria 6310
1535 Ga0501080_0034009 3300049742 Bacteria 4759
1536 Ga0501080_0044991 3300049742 Bacteria 4109
1537 Ga0501080_0147707 3300049742 Bacteria 2173
1538 Ga0501080_0181785 3300049742 Bacteria 1934
1539 Ga0501080_0280712 3300049742 Bacteria 1514
1540 Ga0501081_0026718 3300049743 Bacteria 3894
1541 Ga0501081_0029564 3300049743 Bacteria 3703
1542 Ga0501081_0097941 3300049743 Bacteria 2070
1543 Ga0501081_0105657 3300049743 Bacteria 1995
1544 Ga0501081_0119993 3300049743 Bacteria 1872
1545 Ga0501081_0312421 3300049743 Bacteria 1154
1546 Ga0501083_0000540 3300049744 Bacteria 24122
1547 Ga0501083_0010398 3300049744 Bacteria 6550
1548 Ga0501083_0153110 3300049744 Bacteria 1510
1549 Ga0501035_0000020 3300049822 Bacteria 221605
1550 Ga0501035_0008087 3300049822 Bacteria 9800
1551 Ga0501035_0032641 3300049822 Bacteria 4736
1552 Ga0501035_0039185 3300049822 Bacteria 4289
1553 Ga0501044_0000007 3300049823 Bacteria 283429
1554 Ga0501044_0001497 3300049823 Bacteria 27374
1555 Ga0501044_0004637 3300049823 Bacteria 15387
1556 Ga0501044_0005669 3300049823 Bacteria 13840
1557 Ga0501044_0005977 3300049823 Bacteria 13463
1558 Ga0501044_0055955 3300049823 Bacteria 4049
1559 Ga0501044_0472832 3300049823 Bacteria 1157
1560 Ga0501045_0044337 3300049824 Bacteria 3239
1561 Ga0501045_0108382 3300049824 Bacteria 2058
1562 Ga0501045_0195520 3300049824 Bacteria 1507
1563 Ga0501045_0310082 3300049824 Bacteria 1174
1564 Ga0501045_0435684 3300049824 Bacteria 975
1565 nmdc:mga0yw44_112785_c1 3300050492 Bacteria 1744
1566 nmdc:mga0yw44_27614_c1 3300050492 Bacteria 3253
1567 nmdc:mga07m45_2441_c1 3300050496 Bacteria 8725
1568 nmdc:mga05p37_87743_c1 3300050507 Bacteria 1972
1569 nmdc:mga06r32_98492_c1 3300050510 Bacteria 2866
1570 nmdc:mga08y16_336973_c1 3300050511 Bacteria 1551
1571 nmdc:mga08y16_4539_c1 3300050511 Bacteria 14468
1572 nmdc:mga0n895_111129_c1 3300050512 Bacteria 2756
1573 nmdc:mga0n895_1836_c1 3300050512 Bacteria 16193
1574 nmdc:mga0n895_209183_c1 3300050512 Bacteria 1981
1575 nmdc:mga0n895_481473_c1 3300050512 Bacteria 1251
1576 nmdc:mga0rr50_162534_c1 3300050513 Bacteria 1813
1577 nmdc:mga08x19_302481_c1 3300050514 Bacteria 1111
1578 nmdc:mga0a205_256861_c1 3300050515 Bacteria 1626
1579 nmdc:mga0a205_2579_c1 3300050515 Bacteria 15986
1580 nmdc:mga0a205_688321_c1 3300050515 Bacteria 872
1581 Ga0495601_0000619 3300053077 Bacteria 18911
1582 Ga0495601_0027002 3300053077 Bacteria 3547
1583 Ga0495601_0080021 3300053077 Bacteria 2096
1584 Ga0495601_0105027 3300053077 Bacteria 1826
1585 Ga0495601_0370724 3300053077 Bacteria 930
1586 Ga0495612_0049443 3300053078 Bacteria 1725
1587 Ga0495612_0059876 3300053078 Bacteria 1576
1588 Ga0500610_0000267 3300053079 Bacteria 15829
1589 Ga0500635_0000599 3300053080 Bacteria 9546
1590 Ga0500635_0006359 3300053080 Bacteria 3150
1591 Ga0495595_0094456 3300053084 Bacteria 1438
1592 Ga0495619_0010992 3300053085 Bacteria 5698
1593 Ga0495619_0063579 3300053085 Bacteria 2459
1594 Ga0495619_0113389 3300053085 Bacteria 1854
1595 Ga0495619_0276924 3300053085 Bacteria 1162
1596 Ga0500578_0000159 3300053086 Bacteria 79246
1597 Ga0500578_0226560 3300053086 Bacteria 1134
1598 Ga0500643_022601 3300053087 Bacteria 2021
1599 Ga0500646_0057531 3300053090 Bacteria 1136
1600 Ga0500583_0033904 3300053092 Bacteria 2265
1601 Ga0500651_0000152 3300053093 Bacteria 44325
1602 Ga0500651_0026080 3300053093 Bacteria 3670
1603 Ga0500555_048049 3300053103 Bacteria 1173
1604 Ga0500556_0003675 3300053104 Bacteria 4463
1605 Ga0500562_015873 3300053108 Bacteria 1934
1606 Ga0500572_035346 3300053111 Bacteria 1421
1607 Ga0500594_0008119 3300053118 Bacteria 2387
1608 Ga0500595_001693 3300053119 Bacteria 11555
1609 Ga0500595_003554 3300053119 Bacteria 7241
1610 Ga0500595_004549 3300053119 Bacteria 6193
1611 Ga0500597_000644 3300053120 Bacteria 7681
1612 Ga0500608_009663 3300053122 Bacteria 4106
1613 Ga0500614_000810 3300053123 Bacteria 7903
1614 Ga0500642_0151645 3300053130 Bacteria 1088
1615 Ga0500559_0000134 3300053136 Bacteria 56963
1616 Ga0500559_0013982 3300053136 Bacteria 3392
1617 Ga0500559_0089463 3300053136 Bacteria 1408
1618 Ga0500568_0006484 3300053139 Bacteria 5868
1619 Ga0500574_000582 3300053141 Bacteria 4706
1620 Ga0500590_030679 3300053148 Bacteria 2788
1621 Ga0500616_0001521 3300053153 Bacteria 21858
1622 Ga0500616_0006629 3300053153 Bacteria 7543
1623 Ga0500616_0056629 3300053153 Bacteria 2045
1624 Ga0500619_000197 3300053154 Bacteria 13926
1625 Ga0500622_0001649 3300053156 Bacteria 17443
1626 Ga0500622_0013626 3300053156 Bacteria 4383
1627 Ga0500636_0002608 3300053177 Bacteria 10004
1628 Ga0500636_0004757 3300053177 Bacteria 7698
1629 Ga0500636_0025332 3300053177 Bacteria 3505
1630 Ga0500637_0193605 3300053178 Bacteria 1161
1631 Ga0500645_043222 3300053730 Bacteria 1327
1632 Ga0500596_000833 3300053735 Bacteria 6111
1633 Ga0501084_0026615 3300054114 Bacteria 4828
1634 Ga0501084_0077867 3300054114 Bacteria 2779
1635 Ga0501084_0095591 3300054114 Bacteria 2495
1636 Ga0501084_0102949 3300054114 Bacteria 2398
1637 Ga0500661_001796 3300055283 Bacteria 4044
1638 Ga0587077_021922 3300059493 Bacteria 1139
1639 Ga0501082_0000055 3300060353 Bacteria 80800
1640 Ga0501082_0008399 3300060353 Bacteria 8908
1641 Ga0501082_0010362 3300060353 Bacteria 8027
1642 Ga0501082_0013384 3300060353 Bacteria 7054
1643 Ga0501082_0062907 3300060353 Bacteria 3195
1644 Ga0501082_0124504 3300060353 Bacteria 2235
1645 Ga0501082_0174214 3300060353 Bacteria 1871
1646 Ga0501082_0202445 3300060353 Bacteria 1727
1647 Ga0466962_0057076 3300061719 Bacteria 1864
1648 Ga0530510_0051863 3300061734 Bacteria 2964
1649 Ga0530510_0272557 3300061734 Bacteria 1263
1650 Ga0530510_0504912 3300061734 Bacteria 917
1651 2501082551 2501025502 Bacteria 9641094
1652 2501408500 2501025504 Bacteria 8008976
1653 2511086115 2510917013 Bacteria 9951648
1654 2511096234 2510917014 Bacteria 8296963
1655 2511103043 2510917015 Bacteria 7950052
1656 2511123262 2510917020 Bacteria 5657507
1657 2511250699 2511231003 Bacteria 5606035
1658 2511383157 2511231026 Bacteria 5225445
1659 2513556425 2513237082 Bacteria 8640282
1660 2513564445 2513237083 Bacteria 8410967
1661 2513999798 2513237159 Bacteria 6810126
1662 2521557177 2521172590 Bacteria 5047645
1663 2550696552 2548876994 Bacteria 4904866
1664 2553007701 2551306416 Bacteria 6152985
1665 2585148116 2582581279 Bacteria 4980720
1666 2585270420 2582581306 Bacteria 6450535
1667 2585387752 2582581865 Bacteria 6644329
1668 2585397939 2582581866 Bacteria 6859583
1669 2643926618 2643221583 Bacteria 5218014
1670 2644168236 2643221629 Bacteria 5850260
1671 2644302001 2643221654 Bacteria 5273570
1672 2644348928 2643221662 Bacteria 5851492
1673 2676476635 2675903058 Bacteria 6822861
1674 2721025362 2718218334 Bacteria 4765486
1675 2792746261 2791355123 Bacteria 8049106
1676 2808983385 2808606386 Bacteria 4471946
1677 2809128614 2808606415 Bacteria 4576710
1678 2809148235 2808606419 Bacteria 4576925
1679 2810362959 2808606700 Bacteria 3482157
1680 2819543941 2818991436 Bacteria 5376622
1681 2819564385 2818991440 Bacteria 4774720
1682 2819591907 2818991445 Bacteria 4955017
1683 2819617028 2818991449 Bacteria 5518009
1684 2819618666 2818991449 Bacteria 5518009
1685 2827630638 2827628540 Bacteria 6858585
1686 2837683533 2837678835 Bacteria 5252418
1687 2842526370 2842521101 Bacteria 6569494
1688 2842915831 2842914999 Bacteria 4419378
1689 2852620343 2852618963 Bacteria 4577824
1690 2856292673 2856287931 Bacteria 7223934
1691 2857360875 2857357740 Bacteria 9937880
1692 2883087930 2883087390 Bacteria 9532701
1693 2884219490 2884215851 Bacteria 4554841
1694 2884812893 2884811622 Bacteria 5552861
1695 2884840681 2884836552 Bacteria 5219991
1696 2884855938 2884852848 Bacteria 5221161
1697 2894821435 2894817345 Bacteria 4892941
1698 2896157137 2896154374 Bacteria 5221518
1699 2904440114 2904439833 Bacteria 5931679
1700 2904442630 2904439833 Bacteria 5931679
1701 2904465028 2904463128 Bacteria 4775606
1702 2904530950 2904530477 Bacteria 5876334
1703 2904587417 2904584206 Bacteria 6028872
1704 2904592548 2904589729 Bacteria 6113573
1705 2904604660 2904601388 Bacteria 5884906
1706 2919050472 2919046199 Bacteria 5567169
1707 2919082491 2919079590 Bacteria 5946433
1708 2919407140 2919404418 Bacteria 4232372
1709 2923515805 2923510766 Bacteria 5926163
1710 2928118605 2928115317 Bacteria 6477646
1711 2928133403 2928130867 Bacteria 5467269
1712 637075200 637000159 Bacteria 7596297
1713 8003960874 8003955200 Bacteria 8601927
1714 8045865973 8045864390 Bacteria 5043873
1715 8056064425 8056060235 Bacteria 7259403
1716 8057163447 8057160832 Bacteria 3268302
1717 Ga0496117_0044861
1718 JGI24741J21665_1001217
1719 JGI24740J21852_10007131
1720 JGI24740J21852_10020119
1721 JGI24740J21852_10068980
1722 JGI24739J22299_10012826
1723 JGI24737J22298_10003471
1724 JGI24744J21845_10004468
1725 JGI25155J39150_1000532
1726 JGI25155J39150_1000936
1727 JGI25156J39149_1001026
1728 JGI25156J39149_1004771
1729 JGI25156J39149_1015034
1730 JGI25156J39149_1021461
1731 JGI25162J39368_1000001
1732 JGI25162J39368_1005321
1733 JGI25154J39366_1000871
1734 JGI25154J39366_1000911
1735 JGI25157J39369_1004172
1736 JGI25157J39369_1004410
1737 JGI25163J39215_1002601
1738 JGI25164J39214_1000475
1739 JGI25152J39213_1028232
1740 JGI25151J46595_10000913
1741 JGI25151J46595_10006316
1742 JGI25165J46597_1000001
1743 JGI25165J46597_1001366
1744 JGI25153J46596_10000045
1745 JGI25153J46596_10018640
1746 rootH1_10019690
1747 rootL2_10065722
1748 Ga0055538_1000001
1749 Ga0055538_1000013
1750 Ga0055539_1000001
1751 Ga0055539_1000018
1752 Ga0055533_1000003
1753 Ga0055533_1000022
1754 Ga0055532_1000017
1755 Ga0055525_1000001
1756 Ga0055525_1000003
1757 Ga0055525_1000024
1758 Ga0055535_1006731
1759 Ga0055526_1028622
1760 Ga0055536_1004251
1761 Ga0055536_1012671
1762 Ga0055530_10036597
1763 Ga0055540_1001616
1764 Ga0055531_10002054
1765 Ga0055541_1000001
1766 Ga0055541_1000013
1767 Ga0065165_1000745
1768 Ga0065712_10112677
1769 Ga0065715_10321857
1770 Ga0070658_10000881
1771 Ga0070658_10093058
1772 Ga0070658_10138067
1773 Ga0070658_10156267
1774 Ga0070658_10224133
1775 Ga0070658_10382575
1776 Ga0070658_10505211
1777 Ga0070658_10664089
1778 Ga0070676_10018089
1779 Ga0070676_10073008
1780 Ga0070676_10155875
1781 Ga0070683_100009560
1782 Ga0070683_100096695
1783 Ga0070683_100102161
1784 Ga0070683_100122436
1785 Ga0070683_100262653
1786 Ga0070683_100306077
1787 Ga0070683_100496211
1788 Ga0070690_100000396
1789 Ga0070690_100001314
1790 Ga0070670_100000011
1791 Ga0070670_100009125
1792 Ga0070670_100063773
1793 Ga0070670_100142839
1794 Ga0070670_100453730
1795 Ga0070677_10000119
1796 Ga0070677_10052611
1797 Ga0068869_100000465
1798 Ga0068869_100000575
1799 Ga0068869_100030458
1800 Ga0068869_100038379
1801 Ga0070666_10000097
1802 Ga0070666_10000198
1803 Ga0070666_10004931
1804 Ga0070666_10005202
1805 Ga0070666_10029401
1806 Ga0070666_10033779
1807 Ga0070666_10050374
1808 Ga0070666_10190636
1809 Ga0070666_10377766
1810 Ga0070680_100011206
1811 Ga0070680_100100287
1812 Ga0070680_100463638
1813 Ga0070682_100059155
1814 Ga0070682_100080367
1815 Ga0070682_100126734
1816 Ga0068868_100016774
1817 Ga0068868_100038492
1818 Ga0068868_100060073
1819 Ga0068868_100161524
1820 Ga0068868_100187168
1821 Ga0068868_100353230
1822 Ga0070660_100002548
1823 Ga0070660_100006229
1824 Ga0070660_100028777
1825 Ga0070660_100081744
1826 Ga0070689_100003279
1827 Ga0070689_100037597
1828 Ga0070689_100347195
1829 Ga0070691_10031910
1830 Ga0070687_100001236
1831 Ga0070687_100174327
1832 Ga0070661_100000128
1833 Ga0070661_100010705
1834 Ga0070661_100067383
1835 Ga0070661_100167629
1836 Ga0070692_10005521
1837 Ga0070692_10074102
1838 Ga0070692_10339447
1839 Ga0070668_100000193
1840 Ga0070668_100000218
1841 Ga0070668_100006659
1842 Ga0070668_100105539
1843 Ga0070668_100243131
1844 Ga0070668_100344960
1845 Ga0070669_100001298
1846 Ga0070669_100006029
1847 Ga0070669_100048564
1848 Ga0070669_100073260
1849 Ga0070675_100007099
1850 Ga0070675_100059143
1851 Ga0070675_100303980
1852 Ga0070671_100000026
1853 Ga0070671_100001435
1854 Ga0070671_100016327
1855 Ga0070671_100033885
1856 Ga0070671_100053322
1857 Ga0070671_100086404
1858 Ga0070671_100262836
1859 Ga0070671_100322402
1860 Ga0070674_100000686
1861 Ga0070674_100000953
1862 Ga0070674_100021719
1863 Ga0070674_100047070
1864 Ga0070673_100054732
1865 Ga0070673_100067881
1866 Ga0070673_100757118
1867 Ga0070688_100001706
1868 Ga0070688_100006308
1869 Ga0070659_100006519
1870 Ga0070659_100015651
1871 Ga0070659_100019145
1872 Ga0070659_100222101
1873 Ga0070659_100288472
1874 Ga0070659_100494006
1875 Ga0070667_100000010
1876 Ga0070667_100000092
1877 Ga0070667_100001339
1878 Ga0070667_100004143
1879 Ga0070667_100011628
1880 Ga0070667_100011752
1881 Ga0070667_100028507
1882 Ga0070667_100028612
1883 Ga0070667_100031890
1884 Ga0070667_100108091
1885 Ga0070667_100453085
1886 Ga0070703_10080915
1887 Ga0070714_100070954
1888 Ga0070714_100071156
1889 Ga0070714_100158133
1890 Ga0070713_100001639
1891 Ga0070713_100045084
1892 Ga0070713_100051803
1893 Ga0070710_10048246
1894 Ga0070701_10015406
1895 Ga0070701_10078065
1896 Ga0070711_100027185
1897 Ga0070705_100000278
1898 Ga0070705_100027619
1899 Ga0070700_100050934
1900 Ga0070700_100288273
1901 Ga0070708_100008135
1902 Ga0070663_100001469
1903 Ga0070663_100010345
1904 Ga0070663_100019991
1905 Ga0070663_100083587
1906 Ga0070663_100114868
1907 Ga0070678_100002532
1908 Ga0070678_100019947
1909 Ga0070678_100043700
1910 Ga0070678_100043774
1911 Ga0070678_100092086
1912 Ga0070662_100005207
1913 Ga0070662_100042067
1914 Ga0070662_100067285
1915 Ga0070662_100105738
1916 Ga0070662_100426214
1917 Ga0070681_10048741
1918 Ga0070681_10088290
1919 Ga0070681_10252343
1920 Ga0068867_100201114
1921 Ga0068867_100416876
1922 Ga0070685_10000035
1923 Ga0070685_10000657
1924 Ga0070685_10001172
1925 Ga0070706_100000099
1926 Ga0070706_100198822
1927 Ga0070706_100392642
1928 Ga0070707_100002214
1929 Ga0070707_100245113
1930 Ga0070698_100072846
1931 Ga0070699_100079247
1932 Ga0070699_100285563
1933 Ga0070699_100434818
1934 Ga0070679_100002575
1935 Ga0070679_100124967
1936 Ga0070684_100030135
1937 Ga0070684_100128207
1938 Ga0070697_100067912
1939 Ga0070697_100264684
1940 Ga0068853_100000208
1941 Ga0068853_100002117
1942 Ga0068853_100006289
1943 Ga0068853_100017942
1944 Ga0068853_100049630
1945 Ga0068853_100129047
1946 Ga0068853_100246922
1947 Ga0068853_100494924
1948 Ga0070672_100284056
1949 Ga0070686_100002031
1950 Ga0070686_100011604
1951 Ga0070695_100038331
1952 Ga0070696_100023647
1953 Ga0070693_100001786
1954 Ga0070693_100003714
1955 Ga0070693_100008954
1956 Ga0070693_100069111
1957 Ga0070693_100178477
1958 Ga0070665_100008420
1959 Ga0070665_100011217
1960 Ga0070665_100041022
1961 Ga0070665_100224656
1962 Ga0070665_100893809
1963 Ga0070704_100139795
1964 Ga0070704_100637147
1965 Ga0068855_100001112
1966 Ga0068855_100031910
1967 Ga0068855_100046378
1968 Ga0068855_100106520
1969 Ga0068855_100169572
1970 Ga0068855_100201083
1971 Ga0068855_100215511
1972 Ga0068855_100259113
1973 Ga0068855_100354717
1974 Ga0068855_100965212
1975 Ga0070664_100004070
1976 Ga0070664_100004390
1977 Ga0070664_100007970
1978 Ga0070664_100015258
1979 Ga0070664_100040629
1980 Ga0070664_100056523
1981 Ga0070664_100299834
1982 Ga0068857_100001298
1983 Ga0068857_100042462
1984 Ga0068857_100062934
1985 Ga0068857_100064096
1986 Ga0068857_100113602
1987 Ga0068857_100166783
1988 Ga0068854_100000631
1989 Ga0068854_100003249
1990 Ga0068854_100005790
1991 Ga0068854_100020998
1992 Ga0068854_100048403
1993 Ga0068854_100097292
1994 Ga0068854_100537789
1995 Ga0068854_100563536
1996 Ga0068856_100009926
1997 Ga0068856_100033906
1998 Ga0068856_100146127
1999 Ga0068856_100174008
2000 Ga0068856_100196292
2001 Ga0068856_100555778
2002 Ga0070702_100003317
2003 Ga0070702_100063587
2004 Ga0070702_100087798
2005 Ga0070702_100099523
2006 Ga0070702_100260815
2007 Ga0068852_100006990
2008 Ga0068852_100029077
2009 Ga0068852_100057093
2010 Ga0068852_100078321
2011 Ga0068852_100508765
2012 Ga0068852_100674102
2013 Ga0068859_100004578
2014 Ga0068859_100005284
2015 Ga0068859_100015514
2016 Ga0068859_100023206
2017 Ga0068859_100034851
2018 Ga0068859_100036938
2019 Ga0068859_100037450
2020 Ga0068859_100168722
2021 Ga0068859_100169934
2022 Ga0068859_100575449
2023 Ga0068864_100000020
2024 Ga0068864_100001107
2025 Ga0068864_100003260
2026 Ga0068864_100006188
2027 Ga0068864_100081663
2028 Ga0068864_100315068
2029 Ga0068866_10000329
2030 Ga0068866_10009330
2031 Ga0068866_10078377
2032 Ga0068861_100001745
2033 Ga0068851_10002098
2034 Ga0068851_10124710
2035 Ga0068851_10136773
2036 Ga0068870_10000064
2037 Ga0068863_100000124
2038 Ga0068863_100000158
2039 Ga0068863_100002017
2040 Ga0068863_100005398
2041 Ga0068863_100018111
2042 Ga0068863_100084338
2043 Ga0068863_100090044
2044 Ga0068863_100106067
2045 Ga0068863_100189636
2046 Ga0068863_100510423
2047 Ga0068858_100000149
2048 Ga0068858_100001385
2049 Ga0068858_100017303
2050 Ga0068858_100020053
2051 Ga0068858_100021949
2052 Ga0068858_100027784
2053 Ga0068858_100057078
2054 Ga0068858_100124252
2055 Ga0068858_100290673
2056 Ga0068858_100360929
2057 Ga0068858_100599094
2058 Ga0068860_100000595
2059 Ga0068860_100000822
2060 Ga0068860_100002442
2061 Ga0068860_100012152
2062 Ga0068860_100014589
2063 Ga0068860_100015601
2064 Ga0068860_100024545
2065 Ga0068860_100674316
2066 Ga0068862_100000076
2067 Ga0068862_100001389
2068 Ga0068862_100005977
2069 Ga0068862_100048526
2070 Ga0081455_10004545
2071 Ga0081455_10025273
2072 Ga0081455_10143094
2073 Ga0081540_1000427
2074 Ga0081540_1002493
2075 Ga0081539_10001566
2076 Ga0081539_10007546
2077 Ga0070717_10010659
2078 Ga0075365_10165380
2079 Ga0075368_10095739
2080 Ga0075364_10039817
2081 Ga0075432_10108217
2082 Ga0070716_100165335
2083 Ga0070712_100017186
2084 Ga0070712_100188560
2085 Ga0075362_10000561
2086 Ga0075362_10097862
2087 Ga0075366_10175374
2088 Ga0097621_100003928
2089 Ga0097621_100030727
2090 Ga0097621_100058699
2091 Ga0097621_100150918
2092 Ga0068871_100017442
2093 Ga0068871_100050328
2094 Ga0068871_100307144
2095 Ga0068871_100430844
2096 Ga0068871_100599825
2097 Ga0075428_100056037
2098 Ga0075431_100025533
2099 Ga0075433_10002066
2100 Ga0075434_100250202
2101 Ga0075429_100318394
2102 Ga0068865_100000156
2103 Ga0068865_100020079
2104 Ga0068865_100307182
2105 Ga0068865_100378074
2106 Ga0068865_100477208
2107 Ga0075436_100123709
2108 Ga0075436_100151751
2109 Ga0097620_100004578
2110 Ga0097620_100005284
2111 Ga0097620_100015515
2112 Ga0097620_100023205
2113 Ga0097620_100034851
2114 Ga0097620_100036943
2115 Ga0097620_100037450
2116 Ga0097620_100168722
2117 Ga0097620_100169948
2118 Ga0097620_100219185
2119 Ga0097620_100575330
2120 Ga0099794_10084111
2121 Ga0105251_10051665
2122 Ga0105240_10008057
2123 Ga0105240_10009257
2124 Ga0105240_10025571
2125 Ga0105240_10033209
2126 Ga0105240_10046532
2127 Ga0105240_10081467
2128 Ga0105240_10203320
2129 Ga0105240_10657937
2130 Ga0111539_10011533
2131 Ga0111539_10975374
2132 Ga0111539_11087882
2133 Ga0105245_10000426
2134 Ga0105245_10006948
2135 Ga0105245_10031246
2136 Ga0105245_10121273
2137 Ga0105245_10159162
2138 Ga0105245_10192878
2139 Ga0105245_10198731
2140 Ga0105247_10003007
2141 Ga0105247_10016993
2142 Ga0105247_10091599
2143 Ga0105247_10453021
2144 Ga0114129_10209601
2145 Ga0114129_10434991
2146 Ga0105243_10001511
2147 Ga0105243_10002592
2148 Ga0105243_10031015
2149 Ga0105243_10121472
2150 Ga0105243_10136646
2151 Ga0105243_10253318
2152 Ga0105243_10631189
2153 Ga0105241_10001288
2154 Ga0105241_10002134
2155 Ga0105241_10005667
2156 Ga0105241_10124958
2157 Ga0105241_10156844
2158 Ga0105241_10492730
2159 Ga0105242_10022105
2160 Ga0105242_10234054
2161 Ga0105242_10243646
2162 Ga0105242_10250334
2163 Ga0105242_10497334
2164 Ga0105248_10001654
2165 Ga0105248_10018646
2166 Ga0105248_10078430
2167 Ga0105248_10080447
2168 Ga0105248_10356291
2169 Ga0105248_10726277
2170 Ga0105237_10000846
2171 Ga0105237_10005975
2172 Ga0105237_10017079
2173 Ga0105237_10045629
2174 Ga0105237_10060141
2175 Ga0105237_10116221
2176 Ga0105237_10182470
2177 Ga0105237_10385201
2178 Ga0105237_10485789
2179 Ga0105238_10000315
2180 Ga0105238_10000738
2181 Ga0105238_10000970
2182 Ga0105238_10001651
2183 Ga0105238_10007091
2184 Ga0105238_10055112
2185 Ga0105238_10058971
2186 Ga0105238_10059574
2187 Ga0105238_10204236
2188 Ga0105249_10001740
2189 Ga0105249_10008085
2190 Ga0105249_10025022
2191 Ga0105249_10026131
2192 Ga0105249_10828253
2193 Ga0105239_10003874
2194 Ga0105239_10012419
2195 Ga0105239_10023370
2196 Ga0105239_10033029
2197 Ga0105239_10071697
2198 Ga0105239_10098427
2199 Ga0105239_10135092
2200 Ga0105239_10252927
2201 Ga0105239_10266586
2202 Ga0105239_10326532
2203 Ga0105239_10447165
2204 Ga0105239_10695697
2205 Ga0105246_10184458
2206 Ga0105246_10350127
2207 Ga0105246_10411453
2208 Ga0157327_1005580
2209 Ga0157373_10003695
2210 Ga0157373_10009307
2211 Ga0157371_10000290
2212 Ga0157371_10021286
2213 Ga0157371_10026749
2214 Ga0157371_10066081
2215 Ga0157371_10281668
2216 Ga0157370_10024107
2217 Ga0157370_10034755
2218 Ga0157370_10038592
2219 Ga0157370_10051023
2220 Ga0157370_10053167
2221 Ga0157369_10004891
2222 Ga0157369_10025478
2223 Ga0157369_10055121
2224 Ga0157369_10073706
2225 Ga0157369_10174535
2226 Ga0157369_10642752
2227 Ga0157374_10034837
2228 Ga0157374_10043797
2229 Ga0157374_10145194
2230 Ga0157374_10246213
2231 Ga0157378_10000005
2232 Ga0157378_10004739
2233 Ga0157378_10033327
2234 Ga0157378_10051328
2235 Ga0157378_10052920
2236 Ga0157378_10235164
2237 Ga0157378_10760789
2238 Ga0163162_10000673
2239 Ga0163162_10001215
2240 Ga0163162_10020730
2241 Ga0163162_10066191
2242 Ga0163162_10081725
2243 Ga0163162_10102951
2244 Ga0163162_10109449
2245 Ga0163162_10526200
2246 Ga0157372_10000417
2247 Ga0157372_10072947
2248 Ga0157372_10115555
2249 Ga0157372_10117118
2250 Ga0157372_10139434
2251 Ga0157372_10205175
2252 Ga0157372_10493075
2253 Ga0157372_10528095
2254 Ga0157372_10703453
2255 Ga0157372_10986455
2256 Ga0157375_10109937
2257 Ga0157375_10574579
2258 Ga0163163_10000358
2259 Ga0163163_10001487
2260 Ga0163163_10009750
2261 Ga0163163_10046355
2262 Ga0157380_10009680
2263 Ga0157380_10052493
2264 Ga0157380_10190059
2265 Ga0182008_10040838
2266 Ga0182008_10090525
2267 Ga0182008_10253313
2268 Ga0157377_10002948
2269 Ga0157377_10004717
2270 Ga0157377_10018176
2271 Ga0157377_10176438
2272 Ga0157379_10000219
2273 Ga0157379_10001710
2274 Ga0157379_10028114
2275 Ga0157379_10190898
2276 Ga0157379_10284767
2277 Ga0157379_10392262
2278 Ga0157376_10005857
2279 Ga0157376_10019920
2280 Ga0157376_10027680
2281 Ga0157376_10092402
2282 Ga0157376_10501089
2283 Ga0182006_1002125
2284 Ga0182006_1114020
2285 Ga0182007_10004010
2286 Ga0182007_10009816
2287 Ga0182007_10014265
2288 Ga0182005_1001650
2289 Ga0163161_10013133
2290 Ga0163161_10179432
2291 Ga0163161_10428626
2292 Ga0206356_11636764
2293 Ga0206353_10673777
2294 Ga0154015_1664260
2295 Ga0213872_10002518
2296 Ga0213872_10005752
2297 Ga0228598_1001753
2298 Ga0209435_100015
2299 Ga0209435_100288
2300 Ga0209760_101484
2301 Ga0209784_100004
2302 Ga0209784_100005
2303 Ga0209566_100004
2304 Ga0209566_100005
2305 Ga0209674_100006
2306 Ga0209674_100009
2307 Ga0209674_100249
2308 Ga0209147_100004
2309 Ga0209563_100007
2310 Ga0209563_100009
2311 Ga0209563_100012
2312 Ga0207427_100149
2313 Ga0207427_100485
2314 Ga0209437_100004
2315 Ga0209437_100623
2316 Ga0209437_101358
2317 Ga0209437_102147
2318 Ga0209258_100298
2319 Ga0209258_100391
2320 Ga0209646_1000040
2321 Ga0209646_1000105
2322 Ga0209026_1000034
2323 Ga0209026_1002619
2324 Ga0209677_100005
2325 Ga0209677_100006
2326 Ga0209677_102934
2327 Ga0209759_1000234
2328 Ga0209759_1000569
2329 Ga0209759_1003262
2330 Ga0209759_1009116
2331 Ga0209129_1003748
2332 Ga0209233_1000005
2333 Ga0209233_1000046
2334 Ga0209455_1024715
2335 Ga0209676_1000214
2336 Ga0209676_1001207
2337 Ga0209676_1001472
2338 Ga0209025_1000217
2339 Ga0209564_1000518
2340 Ga0209758_1000007
2341 Ga0209758_1000246
2342 Ga0209758_1025772
2343 Ga0209050_1000412
2344 Ga0209050_1016288
2345 Ga0209050_1021718
2346 Ga0209051_1000150
2347 Ga0209051_1001731
2348 Ga0209257_1000275
2349 Ga0209257_1027391
2350 Ga0207656_10078311
2351 Ga0207656_10137601
2352 Ga0207713_1058962
2353 Ga0207682_10000195
2354 Ga0207692_10155699
2355 Ga0207642_10002118
2356 Ga0207642_10003463
2357 Ga0207710_10013630
2358 Ga0207710_10021487
2359 Ga0207710_10078286
2360 Ga0207688_10000941
2361 Ga0207688_10008007
2362 Ga0207688_10041064
2363 Ga0207688_10067336
2364 Ga0207680_10000139
2365 Ga0207680_10012162
2366 Ga0207680_10030483
2367 Ga0207680_10052954
2368 Ga0207680_10135755
2369 Ga0207680_10325307
2370 Ga0207647_10001601
2371 Ga0207647_10006149
2372 Ga0207647_10018431
2373 Ga0207647_10026218
2374 Ga0207647_10193919
2375 Ga0207685_10016666
2376 Ga0207645_10001126
2377 Ga0207645_10054434
2378 Ga0207645_10104429
2379 Ga0207645_10321824
2380 Ga0207643_10000016
2381 Ga0207643_10161337
2382 Ga0207705_10000103
2383 Ga0207705_10018494
2384 Ga0207705_10073161
2385 Ga0207705_10143497
2386 Ga0207705_10220347
2387 Ga0207705_10223869
2388 Ga0207684_10000047
2389 Ga0207684_10089073
2390 Ga0207684_10099982
2391 Ga0207684_10249305
2392 Ga0207654_10000465
2393 Ga0207654_10052584
2394 Ga0207654_10060903
2395 Ga0207654_10266698
2396 Ga0207654_10283850
2397 Ga0207707_10068750
2398 Ga0207707_10095782
2399 Ga0207707_10133932
2400 Ga0207707_10179584
2401 Ga0207695_10000573
2402 Ga0207695_10000692
2403 Ga0207695_10008225
2404 Ga0207695_10011367
2405 Ga0207695_10023120
2406 Ga0207695_10029200
2407 Ga0207695_10049343
2408 Ga0207695_10133319
2409 Ga0207695_10207643
2410 Ga0207695_10323282
2411 Ga0207671_10004004
2412 Ga0207671_10004486
2413 Ga0207671_10008804
2414 Ga0207671_10030356
2415 Ga0207671_10185971
2416 Ga0207671_10264815
2417 Ga0207671_10452994
2418 Ga0207693_10000589
2419 Ga0207693_10072584
2420 Ga0207663_10016219
2421 Ga0207660_10021224
2422 Ga0207660_10522756
2423 Ga0207662_10000003
2424 Ga0207662_10019928
2425 Ga0207657_10000009
2426 Ga0207657_10002371
2427 Ga0207657_10003372
2428 Ga0207657_10053293
2429 Ga0207657_10099027
2430 Ga0207657_10144866
2431 Ga0207649_10000275
2432 Ga0207649_10003334
2433 Ga0207649_10010372
2434 Ga0207649_10059933
2435 Ga0207652_10057060
2436 Ga0207652_10063748
2437 Ga0207646_10035640
2438 Ga0207681_10000362
2439 Ga0207681_10004343
2440 Ga0207681_10042876
2441 Ga0207681_10076669
2442 Ga0207681_10140936
2443 Ga0207681_10178151
2444 Ga0207694_10000128
2445 Ga0207694_10000505
2446 Ga0207694_10006279
2447 Ga0207694_10007293
2448 Ga0207694_10023433
2449 Ga0207694_10024178
2450 Ga0207694_10028217
2451 Ga0207694_10520965
2452 Ga0207650_10000025
2453 Ga0207650_10000692
2454 Ga0207650_10021626
2455 Ga0207650_10022454
2456 Ga0207650_10125334
2457 Ga0207650_10268968
2458 Ga0207659_10002164
2459 Ga0207659_10124115
2460 Ga0207659_10266995
2461 Ga0207687_10000184
2462 Ga0207687_10001005
2463 Ga0207687_10014501
2464 Ga0207687_10030914
2465 Ga0207687_10035875
2466 Ga0207687_10421197
2467 Ga0207687_10629811
2468 Ga0207700_10042359
2469 Ga0207700_10052903
2470 Ga0207644_10000063
2471 Ga0207644_10000394
2472 Ga0207644_10011338
2473 Ga0207644_10020788
2474 Ga0207644_10032906
2475 Ga0207690_10002703
2476 Ga0207690_10019874
2477 Ga0207690_10057867
2478 Ga0207706_10000283
2479 Ga0207706_10006684
2480 Ga0207706_10077774
2481 Ga0207706_10085325
2482 Ga0207706_10615217
2483 Ga0207686_10001013
2484 Ga0207686_10004410
2485 Ga0207686_10046620
2486 Ga0207709_10000708
2487 Ga0207709_10004486
2488 Ga0207709_10071277
2489 Ga0207709_10084664
2490 Ga0207709_10453607
2491 Ga0207670_10000805
2492 Ga0207670_10030039
2493 Ga0207669_10000292
2494 Ga0207669_10000331
2495 Ga0207669_10125716
2496 Ga0207669_10150555
2497 Ga0207704_10000761
2498 Ga0207704_10015537
2499 Ga0207704_10183674
2500 Ga0207704_10204749
2501 Ga0207704_10270914
2502 Ga0207704_10395005
2503 Ga0207665_10019597
2504 Ga0207665_10279987
2505 Ga0207691_10001649
2506 Ga0207691_10024020
2507 Ga0207711_10000157
2508 Ga0207711_10000291
2509 Ga0207711_10001136
2510 Ga0207711_10001959
2511 Ga0207711_10083588
2512 Ga0207711_10115778
2513 Ga0207689_10000009
2514 Ga0207689_10008955
2515 Ga0207689_10040023
2516 Ga0207689_10125276
2517 Ga0207661_10092935
2518 Ga0207661_10102334
2519 Ga0207661_10115324
2520 Ga0207661_10497480
2521 Ga0207679_10000458
2522 Ga0207679_10025262
2523 Ga0207679_10092308
2524 Ga0207679_10109447
2525 Ga0207679_10193017
2526 Ga0207679_10382166
2527 Ga0207679_10435874
2528 Ga0207667_10000001
2529 Ga0207667_10000444
2530 Ga0207667_10016347
2531 Ga0207667_10020050
2532 Ga0207667_10024289
2533 Ga0207667_10043989
2534 Ga0207667_10115403
2535 Ga0207667_10156409
2536 Ga0207667_10205533
2537 Ga0207667_10416538
2538 Ga0207667_10449987
2539 Ga0207667_10533435
2540 Ga0207667_10704729
2541 Ga0207651_10000183
2542 Ga0207651_10040815
2543 Ga0207651_10054872
2544 Ga0207651_10194689
2545 Ga0207651_10413227
2546 Ga0207712_10001593
2547 Ga0207712_10002835
2548 Ga0207712_10011209
2549 Ga0207712_10054026
2550 Ga0207712_10277417
2551 Ga0207712_10437856
2552 Ga0207712_10507913
2553 Ga0207668_10000165
2554 Ga0207668_10009504
2555 Ga0207668_10091926
2556 Ga0207668_10098026
2557 Ga0207668_10099090
2558 Ga0207668_10107899
2559 Ga0207668_10142820
2560 Ga0207640_10001565
2561 Ga0207640_10008836
2562 Ga0207640_10053191
2563 Ga0207640_10106284
2564 Ga0207658_10000008
2565 Ga0207658_10000141
2566 Ga0207658_10004695
2567 Ga0207658_10011172
2568 Ga0207658_10025007
2569 Ga0207658_10025524
2570 Ga0207658_10037857
2571 Ga0207658_10043470
2572 Ga0207658_10071615
2573 Ga0207658_10132789
2574 Ga0207658_10560325
2575 Ga0207677_10000028
2576 Ga0207677_10001996
2577 Ga0207677_10260649
2578 Ga0207677_10267264
2579 Ga0207677_10304942
2580 Ga0207677_10469875
2581 Ga0207703_10000050
2582 Ga0207703_10000730
2583 Ga0207703_10000775
2584 Ga0207703_10002326
2585 Ga0207703_10010882
2586 Ga0207703_10023963
2587 Ga0207703_10025290
2588 Ga0207703_10332347
2589 Ga0207639_10001036
2590 Ga0207639_10003764
2591 Ga0207639_10005208
2592 Ga0207639_10005329
2593 Ga0207639_10009099
2594 Ga0207639_10037840
2595 Ga0207639_10067422
2596 Ga0207639_10082217
2597 Ga0207639_10146153
2598 Ga0207639_10217772
2599 Ga0207639_10301156
2600 Ga0207639_10348395
2601 Ga0207639_10395414
2602 Ga0207639_10397056
2603 Ga0207639_10693795
2604 Ga0207678_10002449
2605 Ga0207678_10006228
2606 Ga0207678_10008968
2607 Ga0207678_10010216
2608 Ga0207678_10011956
2609 Ga0207678_10046182
2610 Ga0207678_10057773
2611 Ga0207678_10089763
2612 Ga0207678_10104114
2613 Ga0207678_10147235
2614 Ga0207678_10366960
2615 Ga0207708_10006313
2616 Ga0207708_10245596
2617 Ga0207702_10001345
2618 Ga0207702_10003495
2619 Ga0207702_10012547
2620 Ga0207702_10025685
2621 Ga0207702_10029127
2622 Ga0207702_10102507
2623 Ga0207702_10404403
2624 Ga0207702_10575685
2625 Ga0207641_10000118
2626 Ga0207641_10000193
2627 Ga0207641_10003787
2628 Ga0207641_10004315
2629 Ga0207641_10031368
2630 Ga0207641_10032091
2631 Ga0207641_10040969
2632 Ga0207641_10052521
2633 Ga0207641_10056001
2634 Ga0207648_10000279
2635 Ga0207648_10044153
2636 Ga0207648_10056971
2637 Ga0207648_10148462
2638 Ga0207648_10156359
2639 Ga0207648_10200762
2640 Ga0207676_10000024
2641 Ga0207676_10000312
2642 Ga0207676_10004121
2643 Ga0207676_10004895
2644 Ga0207676_10005657
2645 Ga0207676_10008079
2646 Ga0207676_10039477
2647 Ga0207676_10080263
2648 Ga0207676_10101118
2649 Ga0207674_10000103
2650 Ga0207674_10000881
2651 Ga0207674_10002555
2652 Ga0207674_10008403
2653 Ga0207674_10011957
2654 Ga0207674_10050271
2655 Ga0207674_10053743
2656 Ga0207674_10095789
2657 Ga0207674_10130942
2658 Ga0207674_10233707
2659 Ga0207675_100000005
2660 Ga0207675_100003128
2661 Ga0207675_100041220
2662 Ga0207675_100241708
2663 Ga0207675_100297415
2664 Ga0207683_10000089
2665 Ga0207683_10001013
2666 Ga0207683_10001682
2667 Ga0207683_10040657
2668 Ga0207683_10328249
2669 Ga0207698_10001282
2670 Ga0207698_10002146
2671 Ga0207698_10010548
2672 Ga0207698_10011002
2673 Ga0207698_10630146
2674 Ga0207698_10664284
2675 Ga0209281_1007736
2676 Ga0209813_10038558
2677 Ga0207428_10010847
2678 Ga0268266_10000001
2679 Ga0268266_10000559
2680 Ga0268266_10001954
2681 Ga0268266_10010714
2682 Ga0268266_10013898
2683 Ga0268266_10084764
2684 Ga0268266_10200327
2685 Ga0268266_10370867
2686 Ga0268266_10616766
2687 Ga0268265_10000054
2688 Ga0268265_10000538
2689 Ga0268265_10000598
2690 Ga0268265_10020292
2691 Ga0268265_10037420
2692 Ga0268265_10367365
2693 Ga0268264_10000173
2694 Ga0268264_10000323
2695 Ga0268264_10001476
2696 Ga0268264_10003353
2697 Ga0268264_10003867
2698 Ga0268264_10009955
2699 Ga0268264_10016107
2700 Ga0268264_10037615
2701 Ga0268264_10073259
2702 Ga0307515_10000154
2703 Ga0307515_10004744
2704 Ga0307515_10073073
2705 Ga0307515_10262275
2706 Ga0307511_10072246
2707 Ga0307512_10024522
2708 Ga0265762_1006198
2709 Ga0265330_10026996
2710 Ga0265328_10000305
2711 Ga0265328_10010362
2712 Ga0265328_10014633
2713 Ga0265328_10145334
2714 Ga0265331_10000005
2715 Ga0265331_10001445
2716 Ga0265331_10001990
2717 Ga0265331_10004390
2718 Ga0265327_10066157
2719 Ga0265316_10001750
2720 Ga0265316_10294962
2721 Ga0307513_10005286
2722 Ga0307509_10001286
2723 Ga0307408_100029787
2724 Ga0265314_10000595
2725 Ga0265314_10004707
2726 Ga0265314_10079146
2727 Ga0307516_10057185
2728 Ga0307516_10491163
2729 Ga0307412_10002057
2730 Ga0307412_10021192
2731 Ga0307409_100622917
2732 Ga0307416_100110706
2733 Ga0307416_100150505
2734 Ga0307411_10030049
2735 Ga0307411_10233142
2736 Ga0307507_10089135
2737 Ga0307510_10002924
2738 Ga0307510_10038410
2739 Ga0307510_10210097
2740 Ga0373958_0002456
2741 Ga0373926_0111039
2742 Ga0373923_0043737
2743 Ga0373932_0018271
2744 Ga0373936_0009456
2745 Ga0373936_0090957
2746 Ga0373941_0006795
2747 Ga0373945_0025975
2748 Ga0373953_0006322
2749 Ga0373954_0008296
2750 Ga0373954_0063653
2751 Ga0373956_0012525
2752 Ga0373943_0003378
2753 Ga0373943_0009425
2754 Ga0373943_0035578
2755 Ga0373946_0057194
2756 Ga0373942_0003016
2757 Ga0373961_0001242
2758 Ga0373924_0043006
2759 Ga0373931_0012753
2760 Ga0373935_0032485
2761 Ga0373935_0128506
2762 Ga0373927_0003672
2763 Ga0373927_0096268
2764 Ga0373927_0170458
2765 Ga0373933_0117769
2766 Ga0373947_0001397
2767 Ga0373947_0106013
2768 Ga0373937_0009697
2769 Ga0373937_0352850
2770 Ga0316584_0205226
2771 Ga0373925_0003939
2772 Ga0373925_0011747
2773 Ga0373925_0183437
2774 Ga0395899_0001400
2775 Ga0395899_0004896
2776 Ga0395899_0099577
2777 Ga0395899_0162548
2778 Ga0395899_0180807
2779 Ga0395900_0003405
2780 Ga0395900_0014128
2781 Ga0395900_0019708
2782 Ga0395900_0053959
2783 Ga0395900_0080388
2784 Ga0395900_0121199
2785 Ga0395900_0125446
2786 Ga0395900_0174570
2787 Ga0395900_0533252
2788 Ga0395898_0003681
2789 Ga0395898_0008334
2790 Ga0395898_0012207
2791 Ga0395898_0015516
2792 Ga0395898_0033102
2793 Ga0395898_0049703
2794 Ga0395898_0069491
2795 Ga0395898_0132814
2796 Ga0395905_0009017
2797 Ga0395905_0012637
2798 Ga0395905_0015530
2799 Ga0395905_0025270
2800 Ga0395905_0025886
2801 Ga0395905_0031850
2802 Ga0395905_0083763
2803 Ga0395905_0244718
2804 Ga0395905_0523020
2805 Ga0436364_0748271
2806 Ga0395901_0000715
2807 Ga0395901_0001760
2808 Ga0395901_0072646
2809 Ga0395901_0198955
2810 Ga0395901_0433200
2811 Ga0395901_0681071
2812 Ga0395901_0766522
2813 Ga0436365_0476052
2814 Ga0436361_0129708
2815 Ga0436361_0663813
2816 Ga0436361_0928183
2817 Ga0436363_0216924
2818 Ga0436363_0283319
2819 Ga0439436_0002769
2820 Ga0439439_0020708
2821 Ga0451787_683669
2822 Ga0451789_0622405
2823 Ga0451793_1344463
2824 Ga0451800_0389109
2825 Ga0451802_0053535
2826 Ga0451837_1160533
2827 Ga0439448_0004510
2828 Ga0450906_004168
2829 Ga0439458_0003180
2830 Ga0439458_0016138
2831 Ga0451577_0010744
2832 Ga0466969_0014983
2833 Ga0466972_0003347
2834 Ga0466972_0010376
2835 Ga0453683_0010101
2836 Ga0466965_0005619
2837 Ga0466966_0006129
2838 Ga0466966_0019399
2839 Ga0466966_0076585
2840 Ga0466966_0133242
2841 Ga0466961_0218336
2842 Ga0466963_0018485
2843 Ga0466963_0079955
2844 Ga0466964_0000235
2845 Ga0453684_0208094
2846 Ga0466971_0216808
2847 Ga0466968_0000415
2848 Ga0466968_0007387
2849 Ga0466970_0333302
2850 Ga0466957_0000271
2851 Ga0466957_0009540
2852 Ga0466957_0072442
2853 Ga0466960_0250857
2854 Ga0466959_0002938
2855 Ga0466959_0006494
2856 Ga0466959_0006800
2857 Ga0466959_0156857
2858 Ga0451576_0001258
2859 Ga0451576_0054023
2860 Ga0451576_0278462
2861 Ga0466958_0106493
2862 Ga0466958_0227851
2863 Ga0466967_0008678
2864 Ga0466967_0082919
2865 Ga0466967_0114991
2866 Ga0466967_0191822
2867 Ga0466967_0219628
2868 Ga0466967_0819173
2869 Ga0466967_1090519
2870 Ga0495627_001489
2871 Ga0495603_0065699
2872 Ga0495603_0229061
2873 Ga0495590_0000245
2874 Ga0495590_0000893
2875 Ga0495629_0011583
2876 Ga0495629_0270571
2877 Ga0495638_0000439
2878 Ga0495638_0008167
2879 Ga0495641_0067069
2880 Ga0495641_0090628
2881 Ga0495651_0001138
2882 Ga0495651_0012632
2883 Ga0495651_0031145
2884 Ga0495651_0076662
2885 Ga0495653_0007087
2886 Ga0495653_0071517
2887 Ga0495650_0000075
2888 Ga0495650_0000215
2889 Ga0495650_0033470
2890 Ga0495650_0072877
2891 Ga0495580_0076149
2892 Ga0495582_0032532
2893 Ga0495605_0000027
2894 Ga0495605_0138811
2895 Ga0495639_0076887
2896 Ga0495662_0153159
2897 Ga0495664_0007128
2898 Ga0495664_0101700
2899 Ga0495584_0001461
2900 Ga0495584_0016429
2901 Ga0495584_0019698
2902 Ga0495584_0055561
2903 Ga0495585_0064413
2904 Ga0495585_0162785
2905 Ga0495596_0032957
2906 Ga0495596_0102211
2907 Ga0495607_0000337
2908 Ga0495607_0000754
2909 Ga0495607_0004634
2910 Ga0495607_0006533
2911 Ga0495583_0000071
2912 Ga0495583_0000122
2913 Ga0495606_0000497
2914 Ga0495606_0001806
2915 Ga0495606_0004505
2916 Ga0495606_0007233
2917 Ga0495606_0110074
2918 Ga0495608_0047614
2919 Ga0495610_0004566
2920 Ga0495610_0005943
2921 Ga0495616_0000088
2922 Ga0495616_0000318
2923 Ga0495616_0001828
2924 Ga0495616_0009569
2925 Ga0495616_0022784
2926 Ga0495616_0054343
2927 Ga0495616_0115293
2928 Ga0495618_0034445
2929 Ga0495628_0001036
2930 Ga0495628_0006847
2931 Ga0495628_0118398
2932 Ga0495628_0173989
2933 Ga0495630_0075746
2934 Ga0495631_0012715
2935 Ga0495631_0047094
2936 Ga0495631_0112480
2937 Ga0495632_0000385
2938 Ga0495632_0002332
2939 Ga0495643_0000154
2940 Ga0495643_0047939
2941 Ga0495648_0034989
2942 Ga0495663_0002266
2943 Ga0495666_0011560
2944 Ga0495666_0162121
2945 Ga0495642_0020879
2946 Ga0495642_0025329
2947 Ga0495652_0007912
2948 Ga0495652_0011509
2949 Ga0495652_0097503
2950 Ga0495665_0001290
2951 Ga0495665_0034208
2952 Ga0495665_0235598
2953 Ga0495587_0011313
2954 Ga0495587_0046603
2955 Ga0495609_0000009
2956 Ga0495609_0000124
2957 Ga0495621_0001362
2958 Ga0495621_0148442
2959 Ga0495597_0142981
2960 Ga0495645_0003363
2961 Ga0495645_0058688
2962 Ga0495645_0066983
2963 Ga0495622_0000007
2964 Ga0495622_0000427
2965 Ga0495622_0001376
2966 Ga0495622_0026543
2967 Ga0495656_0270363
2968 Ga0495668_0023138
2969 Ga0495668_0067119
2970 Ga0495634_0076029
2971 Ga0495625_0020935
2972 Ga0495625_0024501
2973 Ga0495625_0039388
2974 Ga0495635_0019638
2975 Ga0495635_0156531
2976 Ga0495661_0000032
2977 Ga0495661_0000094
2978 Ga0495661_0004034
2979 Ga0495661_0005699
2980 Ga0495661_0032246
2981 Ga0495661_0147829
2982 Ga0495588_0000055
2983 Ga0495657_0076494
2984 Ga0495657_0103445
2985 Ga0495599_0004365
2986 Ga0495623_0008428
2987 Ga0495623_0042669
2988 Ga0495646_0000769
2989 Ga0495646_0101233
2990 Ga0495658_0058970
2991 Ga0495658_0503193
2992 Ga0495669_0184053
2993 Ga0495624_0003522
2994 Ga0495624_0067380
2995 Ga0495670_0006312
2996 Ga0495670_0097903
2997 Ga0495671_0022016
2998 Ga0495649_0000286
2999 Ga0495589_0000019
3000 Ga0495589_0000148
3001 Ga0495589_0046879
3002 Ga0495600_0000302
3003 Ga0495600_0000460
3004 Ga0495660_0004474
3005 Ga0495581_0001785
3006 Ga0495581_0018356
3007 Ga0495604_0083846
3008 Ga0495604_0095241
3009 Ga0495604_0138144
3010 Ga0495674_0077717
3011 Ga0495676_0246741
3012 Ga0495680_0167858
3013 Ga0495683_0205411
3014 Ga0495687_000024
3015 Ga0495687_000046
3016 Ga0495687_000132
3017 Ga0495687_000947
3018 Ga0495675_0255198
3019 Ga0495677_0000018
3020 Ga0495677_0000059
3021 Ga0495677_0000476
3022 Ga0495677_0018821
3023 Ga0495677_0044344
3024 Ga0495673_0000163
3025 Ga0495673_0000199
3026 Ga0495681_0170031
3027 Ga0495684_0006624
3028 Ga0495686_0001232
3029 Ga0495686_0008573
3030 Ga0495593_0007919
3031 Ga0495593_0024798
3032 Ga0495593_0126683
3033 Ga0495602_0011414
3034 Ga0495602_0049139
3035 Ga0495602_0056928
3036 Ga0495602_0187276
3037 Ga0495626_0000054
3038 Ga0495626_0000683
3039 Ga0495626_0001301
3040 Ga0495626_0028157
3041 Ga0496100_0497442
3042 Ga0496101_0030143
3043 Ga0496101_0722822
3044 Ga0496102_0003046
3045 Ga0496102_0669119
3046 Ga0496103_0051171
3047 Ga0496103_0208136
3048 Ga0496103_0239513
3049 Ga0496105_0288617
3050 Ga0496106_0064665
3051 Ga0496106_0275132
3052 Ga0496106_0361909
3053 Ga0496107_0000027
3054 Ga0496107_0100304
3055 Ga0496107_0199673
3056 Ga0496108_0724010
3057 Ga0496109_0003908
3058 Ga0496109_0009801
3059 Ga0496109_0023139
3060 Ga0496109_0149227
3061 Ga0496109_0251673
3062 Ga0496109_0394737
3063 Ga0496109_0454945
3064 Ga0496110_0009845
3065 Ga0496110_0052917
3066 Ga0496110_0088567
3067 Ga0496110_0681512
3068 Ga0496110_0742893
3069 Ga0496111_0007923
3070 Ga0496112_0001433
3071 Ga0496112_0002904
3072 Ga0496112_0051152
3073 Ga0496112_0190148
3074 Ga0496113_0011411
3075 Ga0496113_0101328
3076 Ga0496114_0038708
3077 Ga0496114_0106590
3078 Ga0496114_0151381
3079 Ga0496114_0201638
3080 Ga0496115_0000002
3081 Ga0496115_0014651
3082 Ga0496115_0208790
3083 Ga0496116_0014477
3084 Ga0496116_0034118
3085 Ga0496116_0130384
3086 Ga0496118_0000559
3087 Ga0496118_0000565
3088 Ga0496118_0003882
3089 Ga0496118_0009060
3090 Ga0496118_0150034
3091 Ga0496120_0096251
3092 Ga0496121_0000059
3093 Ga0496121_0000763
3094 Ga0496121_0063308
3095 Ga0496121_0243345
3096 Ga0496122_0000501
3097 Ga0496122_0002154
3098 Ga0496122_0002573
3099 Ga0496123_0000029
3100 Ga0496123_0002577
3101 Ga0496123_0074939
3102 Ga0496124_0000226
3103 Ga0496124_0000306
3104 Ga0496124_0004880
3105 Ga0496124_0031755
3106 Ga0496125_0005346
3107 Ga0496125_0024695
3108 Ga0496125_0171540
3109 Ga0496125_0267672
3110 Ga0496126_0000052
3111 Ga0496126_0019169
3112 Ga0496126_0067028
3113 Ga0496126_0168660
3114 Ga0496126_0548948
3115 Ga0501309_002235
3116 Ga0495678_001117
3117 Ga0495678_002508
3118 Ga0495678_005616
3119 Ga0495682_0008940
3120 Ga0495682_0028829
3121 Ga0501292_006670
3122 Ga0501031_0002712
3123 Ga0501031_0078143
3124 Ga0501031_0109746
3125 Ga0501032_0006069
3126 Ga0501032_0011007
3127 Ga0501032_0012880
3128 Ga0501032_0084696
3129 Ga0501032_0732474
3130 Ga0501033_0003340
3131 Ga0501033_0042973
3132 Ga0501033_0117854
3133 Ga0501033_0135239
3134 Ga0501034_0000242
3135 Ga0501034_0000245
3136 Ga0501034_0005369
3137 Ga0501034_0006882
3138 Ga0501034_0014233
3139 Ga0501036_0011156
3140 Ga0501036_0101038
3141 Ga0501036_0115335
3142 Ga0501036_0175700
3143 Ga0501036_0387272
3144 Ga0501036_0586298
3145 Ga0501037_0004205
3146 Ga0501037_0017736
3147 Ga0501037_0024296
3148 Ga0501037_0101560
3149 Ga0501037_0153391
3150 Ga0501037_0201653
3151 Ga0501037_0253082
3152 Ga0501038_0002716
3153 Ga0501038_0004923
3154 Ga0501038_0011201
3155 Ga0501038_0030294
3156 Ga0501038_0084083
3157 Ga0501038_0175774
3158 Ga0501038_0352330
3159 Ga0501039_0010025
3160 Ga0501039_0010465
3161 Ga0501039_0020230
3162 Ga0501039_0069685
3163 Ga0501039_0142408
3164 Ga0501039_0271286
3165 Ga0501040_0077616
3166 Ga0501040_0078028
3167 Ga0501040_0229025
3168 Ga0501040_0268897
3169 Ga0501040_0323391
3170 Ga0501040_0325569
3171 Ga0501041_0017939
3172 Ga0501041_0018502
3173 Ga0501041_0243055
3174 Ga0501042_0008235
3175 Ga0501042_0041030
3176 Ga0501042_0113169
3177 Ga0501042_0120129
3178 Ga0501043_0002911
3179 Ga0501043_0041516
3180 Ga0501043_0048633
3181 Ga0501043_0098165
3182 Ga0501043_0137542
3183 Ga0501043_0472679
3184 Ga0501043_0482858
3185 Ga0501043_0494370
3186 Ga0501046_0006273
3187 Ga0501046_0028467
3188 Ga0501046_0036929
3189 Ga0501046_0131771
3190 Ga0501046_0132074
3191 Ga0501046_0174670
3192 Ga0501046_0180154
3193 Ga0501046_0393622
3194 Ga0501047_0000054
3195 Ga0501047_0000530
3196 Ga0501047_0001045
3197 Ga0501047_0001922
3198 Ga0501047_0010962
3199 Ga0501047_0019383
3200 Ga0501047_0037961
3201 Ga0501047_0107100
3202 Ga0501047_0136566
3203 Ga0501047_0151061
3204 Ga0501047_0244419
3205 Ga0501047_0396114
3206 Ga0501048_0033223
3207 Ga0501067_0000246
3208 Ga0501067_0001614
3209 Ga0501067_0262370
3210 Ga0501068_0001112
3211 Ga0501068_0042130
3212 Ga0501068_0045491
3213 Ga0501068_0092243
3214 Ga0501069_0001146
3215 Ga0501069_0042165
3216 Ga0501070_0001709
3217 Ga0501070_0022433
3218 Ga0501070_0040094
3219 Ga0501070_0588875
3220 Ga0501071_0016873
3221 Ga0501071_0059742
3222 Ga0501071_0096852
3223 Ga0501072_0000311
3224 Ga0501072_0042779
3225 Ga0501072_0050205
3226 Ga0501072_0089288
3227 Ga0501072_0107511
3228 Ga0501073_0005005
3229 Ga0501073_0009083
3230 Ga0501073_0013151
3231 Ga0501073_0052608
3232 Ga0501073_0083452
3233 Ga0501073_0188684
3234 Ga0501073_0280077
3235 Ga0501074_0052622
3236 Ga0501075_0001489
3237 Ga0501075_0069062
3238 Ga0501076_0015138
3239 Ga0501076_0291253
3240 Ga0501077_0002291
3241 Ga0501077_0057276
3242 Ga0501077_0075324
3243 Ga0501077_0153892
3244 Ga0501079_0002396
3245 Ga0501079_0109044
3246 Ga0501079_0170978
3247 Ga0501079_0314632
3248 Ga0501080_0000041
3249 Ga0501080_0000948
3250 Ga0501080_0019336
3251 Ga0501080_0034009
3252 Ga0501080_0044991
3253 Ga0501080_0147707
3254 Ga0501080_0181785
3255 Ga0501080_0280712
3256 Ga0501081_0026718
3257 Ga0501081_0029564
3258 Ga0501081_0097941
3259 Ga0501081_0105657
3260 Ga0501081_0119993
3261 Ga0501081_0312421
3262 Ga0501083_0000540
3263 Ga0501083_0010398
3264 Ga0501083_0153110
3265 Ga0501035_0000020
3266 Ga0501035_0008087
3267 Ga0501035_0032641
3268 Ga0501035_0039185
3269 Ga0501044_0000007
3270 Ga0501044_0001497
3271 Ga0501044_0004637
3272 Ga0501044_0005669
3273 Ga0501044_0005977
3274 Ga0501044_0055955
3275 Ga0501044_0472832
3276 Ga0501045_0044337
3277 Ga0501045_0108382
3278 Ga0501045_0195520
3279 Ga0501045_0310082
3280 Ga0501045_0435684
3281 nmdc:mga0yw44_112785_c1
3282 nmdc:mga0yw44_27614_c1
3283 nmdc:mga07m45_2441_c1
3284 nmdc:mga05p37_87743_c1
3285 nmdc:mga06r32_98492_c1
3286 nmdc:mga08y16_336973_c1
3287 nmdc:mga08y16_4539_c1
3288 nmdc:mga0n895_111129_c1
3289 nmdc:mga0n895_1836_c1
3290 nmdc:mga0n895_209183_c1
3291 nmdc:mga0n895_481473_c1
3292 nmdc:mga0rr50_162534_c1
3293 nmdc:mga08x19_302481_c1
3294 nmdc:mga0a205_256861_c1
3295 nmdc:mga0a205_2579_c1
3296 nmdc:mga0a205_688321_c1
3297 Ga0495601_0000619
3298 Ga0495601_0027002
3299 Ga0495601_0080021
3300 Ga0495601_0105027
3301 Ga0495601_0370724
3302 Ga0495612_0049443
3303 Ga0495612_0059876
3304 Ga0500610_0000267
3305 Ga0500635_0000599
3306 Ga0500635_0006359
3307 Ga0495595_0094456
3308 Ga0495619_0010992
3309 Ga0495619_0063579
3310 Ga0495619_0113389
3311 Ga0495619_0276924
3312 Ga0500578_0000159
3313 Ga0500578_0226560
3314 Ga0500643_022601
3315 Ga0500646_0057531
3316 Ga0500583_0033904
3317 Ga0500651_0000152
3318 Ga0500651_0026080
3319 Ga0500555_048049
3320 Ga0500556_0003675
3321 Ga0500562_015873
3322 Ga0500572_035346
3323 Ga0500594_0008119
3324 Ga0500595_001693
3325 Ga0500595_003554
3326 Ga0500595_004549
3327 Ga0500597_000644
3328 Ga0500608_009663
3329 Ga0500614_000810
3330 Ga0500642_0151645
3331 Ga0500559_0000134
3332 Ga0500559_0013982
3333 Ga0500559_0089463
3334 Ga0500568_0006484
3335 Ga0500574_000582
3336 Ga0500590_030679
3337 Ga0500616_0001521
3338 Ga0500616_0006629
3339 Ga0500616_0056629
3340 Ga0500619_000197
3341 Ga0500622_0001649
3342 Ga0500622_0013626
3343 Ga0500636_0002608
3344 Ga0500636_0004757
3345 Ga0500636_0025332
3346 Ga0500637_0193605
3347 Ga0500645_043222
3348 Ga0500596_000833
3349 Ga0501084_0026615
3350 Ga0501084_0077867
3351 Ga0501084_0095591
3352 Ga0501084_0102949
3353 Ga0500661_001796
3354 Ga0587077_021922
3355 Ga0501082_0000055
3356 Ga0501082_0008399
3357 Ga0501082_0010362
3358 Ga0501082_0013384
3359 Ga0501082_0062907
3360 Ga0501082_0124504
3361 Ga0501082_0174214
3362 Ga0501082_0202445
3363 Ga0466962_0057076
3364 Ga0530510_0051863
3365 Ga0530510_0272557
3366 Ga0530510_0504912
3367 2501082551
3368 2501408500
3369 2511086115
3370 2511096234
3371 2511103043
3372 2511123262
3373 2511250699
3374 2511383157
3375 2513556425
3376 2513564445
3377 2513999798
3378 2521557177
3379 2550696552
3380 2553007701
3381 2585148116
3382 2585270420
3383 2585387752
3384 2585397939
3385 2643926618
3386 2644168236
3387 2644302001
3388 2644348928
3389 2676476635
3390 2721025362
3391 2792746261
3392 2808983385
3393 2809128614
3394 2809148235
3395 2810362959
3396 2819543941
3397 2819564385
3398 2819591907
3399 2819617028
3400 2819618666
3401 2827630638
3402 2837683533
3403 2842526370
3404 2842915831
3405 2852620343
3406 2856292673
3407 2857360875
3408 2883087930
3409 2884219490
3410 2884812893
3411 2884840681
3412 2884855938
3413 2894821435
3414 2896157137
3415 2904440114
3416 2904442630
3417 2904465028
3418 2904530950
3419 2904587417
3420 2904592548
3421 2904604660
3422 2919050472
3423 2919082491
3424 2919407140
3425 2923515805
3426 2928118605
3427 2928133403
3428 637075200
3429 8003960874
3430 8045865973
3431 8056064425
3432 8057163447

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

41

236

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

47

292

0.9

PF08659

KR

KR domain

42

222

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dt1-assembly1.cif.gz_C crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with nad 0.99 3 259
4trr-assembly1.cif.gz_D crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 0.9867 3 259
4trr-assembly2.cif.gz_F crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 0.9861 3 259
8dt1-assembly1.cif.gz_D crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with nad 0.9842 3 259
8dt1-assembly1.cif.gz_A crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with nad 0.9842 3 259
ID Description Score Start End Superfamily
4trrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9811 4 259 3.40.50.720
4trrC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9806 1 259 3.40.50.720
4trrC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9768 1 259 3.40.50.720
4trrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9768 4 259 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9684 3 181 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2N0QKI9-F1-model_v4 NAD(P)-binding protein 0.9895 3 126 GO:0005829
GO:0009688
GO:0010301
AF-A0A2J1DVF9-F1-model_v4 Short-chain dehydrogenase 0.9851 3 158 GO:0006633
GO:0016616
GO:0048038
AF-A0A2W6T3P7-F1-model_v4 Short-chain dehydrogenase 0.9817 3 184 GO:0016491
AF-S3JGM5-F1-model_v4 Glucose 1-dehydrogenase 2 (EC 1.1.1.47) 0.9805 3 164 GO:0047936
AF-A0A7C3JPF9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.979 1 126 GO:0016491

Map