F495345

General Info

Members Datasets Scaffolds Average Seq Length
1689 691 1514 281

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10022939|Ga0307405_100229392
Length 324
Sequence MPGSLGQSRRDLVGHGGDRVGLKPLSSPPHPGIDTAAGLAELTAMTTGTRPPAACLIGWPAAHSRSPLIHHYWLRTLGIEGGYVIEAVPPDEFQDFVFRLSLRGFVGANVTLPHKERALALSKPDERARAVGAANTLWFEQGELCSTNTDVEGFINNLDACAPGWDRAEDALVLGAGGSSRAVLFGLIERGIKRVHLANRTMERARALADQFGASVLPVEWEAFGELLPRAGLLVNTTSLGMHGQPALELDIGRLPHHAVVADLVYAPLETPLLAAARAHGLRTADGLGMLLHQAVRGFELWFGKRPEVTSELRALIEADLKKV

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
13 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
14 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
17 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
18 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
19 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
20 2643221651 Afipia sp. Root123D2 Isolate Unclassified
21 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
22 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
23 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
24 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
25 2791355199
26 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
27 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
28 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
29 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
30 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
31 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
32 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
33 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
34 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
35 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
36 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
37 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
38 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
39 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
40 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
41 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
42 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
43 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
44 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
45 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
46 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
47 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
48 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
49 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
50 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
51 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
52 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
53 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
54 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
55 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
56 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
57 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
58 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
59 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
60 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
61 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
62 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
63 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
64 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
65 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
66 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
67 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
68 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
69 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
70 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
71 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
72 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
73 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
74 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
75 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
76 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
77 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
78 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
79 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
80 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
81 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
82 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
83 2904699407
84 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
85 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
86 2906610324
87 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
88 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
89 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
90 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
91 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
92 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
93 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
94 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
95 2922368715
96 2922425934
97 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
98 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
99 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
100 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
101 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
102 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
103 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
104 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
105 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
106 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
107 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
108 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
109 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
110 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
111 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
112 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
113 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
114 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
115 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
116 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
117 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
118 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
119 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
120 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
121 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
122 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
123 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
124 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
125 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
126 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
127 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
128 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
129 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
130 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
131 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
132 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
133 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
134 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
135 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
136 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
137 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
138 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
139 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
140 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
141 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
142 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
143 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
144 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
145 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
146 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
147 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
148 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
149 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
150 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
151 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
152 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
153 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
154 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
155 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
156 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
157 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
158 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
159 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
160 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
161 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
162 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
163 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
164 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
165 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
166 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
167 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
168 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
169 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
170 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
171 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
172 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
173 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
174 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
175 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
176 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
177 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
178 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
179 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
180 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
181 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
182 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
183 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
184 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
185 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
186 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
187 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
188 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
189 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
190 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
191 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
192 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
193 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
194 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
195 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
196 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
197 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
198 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
199 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
200 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
201 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
202 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
203 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
204 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
205 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
206 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
207 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
208 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
209 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
210 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
211 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
212 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
213 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
214 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
215 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
216 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
217 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
218 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
219 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
220 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
221 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
222 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
223 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
224 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
225 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
226 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
227 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
228 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
229 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
230 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
231 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
232 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
233 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
234 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
235 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
236 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
237 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
238 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
239 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
240 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
241 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
242 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
243 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
244 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
245 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
246 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
247 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
248 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
249 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
250 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
251 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
252 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
253 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
254 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
255 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
256 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
257 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
258 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
259 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
260 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
261 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
262 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
263 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
264 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
265 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
266 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
267 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
268 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
269 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
270 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
271 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
272 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
273 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
274 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
275 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
276 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
277 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
278 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
279 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
280 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
281 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
282 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
283 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
284 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
285 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
286 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
287 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
288 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
289 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
290 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
291 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
292 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
293 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
294 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
295 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
296 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
297 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
298 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
299 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
300 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
301 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
302 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
303 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
304 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
305 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
306 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
307 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
308 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
309 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
310 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
312 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
315 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
316 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
317 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
318 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
385 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
386 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
387 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
388 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
390 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
391 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
392 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
393 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
397 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
398 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
399 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
400 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
402 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
403 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
404 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
405 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
406 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
407 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
408 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
409 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
410 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
411 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
412 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
413 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
414 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
415 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
416 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
417 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
418 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
419 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
420 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
421 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
422 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
423 3300033546 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 Metagenome Unclassified
424 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
425 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
426 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
427 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
428 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
429 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
430 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
431 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
432 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
433 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
434 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
435 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
436 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
437 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
438 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
439 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
440 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
441 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
442 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
443 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
444 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
445 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
446 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
447 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
448 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
449 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
450 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
451 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
452 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
453 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
454 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
455 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
456 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
457 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
458 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
459 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
460 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
461 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
462 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
463 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
464 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
465 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
466 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
467 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
468 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
469 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
470 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
471 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
472 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
473 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
474 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
475 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
476 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
477 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
478 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
479 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
480 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
481 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
482 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
483 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
484 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
485 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
486 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
487 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
488 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
489 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
490 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
491 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
492 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
493 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
494 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
495 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
496 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
497 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
498 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
499 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
500 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
501 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
502 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
503 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
504 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
505 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
506 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
507 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
508 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
509 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
510 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
511 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
512 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
513 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
514 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
515 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
516 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
517 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
518 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
519 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
520 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
521 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
522 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
523 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
524 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
525 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
526 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
527 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
528 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
529 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
530 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
531 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
532 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
533 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
534 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
535 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
536 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
537 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
538 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
539 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
540 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
541 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
542 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
543 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
544 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
545 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
546 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
547 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
548 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
549 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
550 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
551 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
552 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
553 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
554 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
555 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
556 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
557 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
558 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
559 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
560 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
561 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
562 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
563 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
564 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
565 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
566 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
567 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
568 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
569 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
570 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
571 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
572 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
573 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
574 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
575 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
576 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
577 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
578 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
579 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
580 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
581 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
582 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
583 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
584 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
585 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
586 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
587 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
588 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
589 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
590 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
591 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
592 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
593 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
594 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
595 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
596 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
597 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
598 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
599 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
600 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
601 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
602 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
603 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
604 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
605 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
606 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
607 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
608 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
609 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
610 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
611 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
612 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
613 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
614 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
615 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
616 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
617 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
618 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
619 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
620 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
621 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
622 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
623 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
624 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
625 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
626 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
627 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
628 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
629 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
630 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
631 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
632 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
633 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
634 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
635 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
636 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
637 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
638 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
639 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
640 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
641 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
642 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
643 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
644 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
645 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
646 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
647 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
648 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
649 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
650 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
651 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
652 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
653 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
654 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
655 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
656 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
657 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
658 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
659 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
660 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
661 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
662 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
663 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
664 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
665 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
666 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
667 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
668 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
669 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
670 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
671 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
672 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
673 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
674 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
675 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
676 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
677 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
678 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
679 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
680 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
681 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
682 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
683 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
684 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
685 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
686 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
687 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
688 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
689 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
690 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
691 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.55
Metatranscriptomes 0.36
Isolates 10.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.8
Nodule 8.29
Rhizoplane 5.86
Rhizosphere 73.42
Stem 0
Stem Tuber 0
Unclassified 6.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000871 3300001989 Bacteria 11154
2 JGI24739J22299_10008928 3300001989 Bacteria 3739
3 JGI24739J22299_10025017 3300001989 Bacteria 2101
4 JGI24743J22301_10013185 3300001991 Bacteria 1512
5 JGI24750J21931_1000457 3300002070 Bacteria 6532
6 JGI24035J26624_1000248 3300002126 Bacteria 4965
7 JGI25153J46596_10004620 3300003215 Bacteria 7372
8 JGI25153J46596_10005210 3300003215 Bacteria 6841
9 JGI25153J46596_10010025 3300003215 Bacteria 4327
10 JGI25153J46596_10031215 3300003215 Bacteria 1797
11 rootL2_10335649 3300003322 Bacteria 1925
12 JGI25160J50197_1003286 3300003354 Bacteria 7284
13 JGI25160J50197_1007225 3300003354 Bacteria 4369
14 Ga0055531_10010351 3300003794 Bacteria 4645
15 Ga0055531_10010606 3300003794 Bacteria 4554
16 Ga0055543_1008336 3300004625 Bacteria 2301
17 Ga0065165_1002476 3300005262 Bacteria 15530
18 Ga0065165_1002846 3300005262 Bacteria 13437
19 Ga0065165_1025765 3300005262 Bacteria 1948
20 Ga0065715_10243240 3300005293 Bacteria 1172
21 Ga0070658_10029391 3300005327 Bacteria 4415
22 Ga0070658_10044726 3300005327 Bacteria 3579
23 Ga0070658_10142354 3300005327 Bacteria 2004
24 Ga0070658_10349485 3300005327 Bacteria 1265
25 Ga0070658_10461582 3300005327 Bacteria 1095
26 Ga0070676_10020837 3300005328 Bacteria 3665
27 Ga0070676_10086242 3300005328 Bacteria 1915
28 Ga0070676_10165191 3300005328 Bacteria 1428
29 Ga0070683_100031309 3300005329 Bacteria 4836
30 Ga0070683_100041896 3300005329 Bacteria 4215
31 Ga0070683_100045265 3300005329 Bacteria 4061
32 Ga0070690_100017313 3300005330 Plasmid 4331
33 Ga0070670_100126553 3300005331 Unclassified 2205
34 Ga0070670_100316986 3300005331 Bacteria 1366
35 Ga0070677_10005521 3300005333 Bacteria 4168
36 Ga0068869_100059222 3300005334 Bacteria 2803
37 Ga0070666_10103477 3300005335 Unclassified 1964
38 Ga0070680_100003647 3300005336 Bacteria 11501
39 Ga0070680_100123326 3300005336 Bacteria 2164
40 Ga0070682_100007969 3300005337 Bacteria 5962
41 Ga0070682_100028580 3300005337 Bacteria 3355
42 Ga0070682_100030805 3300005337 Plasmid 3241
43 Ga0068868_100018112 3300005338 Bacteria 5258
44 Ga0068868_100208673 3300005338 Bacteria 1632
45 Ga0070660_100003870 3300005339 Bacteria 10336
46 Ga0070660_100019473 3300005339 Bacteria 4974
47 Ga0070660_100022278 3300005339 Bacteria 4682
48 Ga0070660_100026453 3300005339 Bacteria 4319
49 Ga0070660_100277754 3300005339 Bacteria 1370
50 Ga0070689_100031062 3300005340 Bacteria 4058
51 Ga0070689_100258241 3300005340 Unclassified 1439
52 Ga0070691_10004859 3300005341 Bacteria 6121
53 Ga0070691_10089795 3300005341 Bacteria 1514
54 Ga0070661_100009866 3300005344 Bacteria 6624
55 Ga0070661_100048625 3300005344 Bacteria 3105
56 Ga0070661_100063664 3300005344 Plasmid 2709
57 Ga0070661_100116508 3300005344 Bacteria 1998
58 Ga0070661_100156226 3300005344 Bacteria 1726
59 Ga0070668_100013726 3300005347 Bacteria 6051
60 Ga0070669_100014406 3300005353 Bacteria 5628
61 Ga0070669_100414063 3300005353 Bacteria 1105
62 Ga0070675_100018170 3300005354 Bacteria 5596
63 Ga0070675_100276160 3300005354 Bacteria 1476
64 Ga0070671_100016514 3300005355 Bacteria 5967
65 Ga0070671_100024253 3300005355 Bacteria 4965
66 Ga0070671_100034258 3300005355 Bacteria 4203
67 Ga0070671_100048918 3300005355 Bacteria 3518
68 Ga0070671_100170292 3300005355 Bacteria 1842
69 Ga0070674_100005693 3300005356 Bacteria 7227
70 Ga0070674_100558009 3300005356 Bacteria 962
71 Ga0070673_100040424 3300005364 Bacteria 3578
72 Ga0070673_100045977 3300005364 Plasmid 3389
73 Ga0070673_100055936 3300005364 Bacteria 3110
74 Ga0070659_100058630 3300005366 Bacteria 3039
75 Ga0070659_100144527 3300005366 Unclassified 1937
76 Ga0070659_100281140 3300005366 Bacteria 1384
77 Ga0070667_100014138 3300005367 Bacteria 6595
78 Ga0070667_100024258 3300005367 Bacteria 5037
79 Ga0070703_10003201 3300005406 Bacteria 4676
80 Ga0070709_10002262 3300005434 Bacteria 10432
81 Ga0070709_10010070 3300005434 Bacteria 5225
82 Ga0070709_10013419 3300005434 Bacteria 4606
83 Ga0070709_10018177 3300005434 Plasmid 4044
84 Ga0070714_100022361 3300005435 Bacteria 5185
85 Ga0070714_100054927 3300005435 Plasmid 3403
86 Ga0070714_100152613 3300005435 Bacteria 2083
87 Ga0070714_100181091 3300005435 Bacteria 1917
88 Ga0070714_100269818 3300005435 Bacteria 1578
89 Ga0070714_100452677 3300005435 Bacteria 1220
90 Ga0070713_100003057 3300005436 Bacteria 10992
91 Ga0070713_100043687 3300005436 Plasmid 3665
92 Ga0070713_100055202 3300005436 Bacteria 3300
93 Ga0070713_100055241 3300005436 Bacteria 3299
94 Ga0070713_100055279 3300005436 Bacteria 3297
95 Ga0070713_100194352 3300005436 Bacteria 1830
96 Ga0070710_10002325 3300005437 Bacteria 8998
97 Ga0070710_10072646 3300005437 Bacteria 1987
98 Ga0070710_10119431 3300005437 Bacteria 1594
99 Ga0070701_10004348 3300005438 Bacteria 5724
100 Ga0070711_100002208 3300005439 Bacteria 11048
101 Ga0070711_100011944 3300005439 Bacteria 5407
102 Ga0070711_100013080 3300005439 Bacteria 5204
103 Ga0070711_100130120 3300005439 Bacteria 1873
104 Ga0070711_100187418 3300005439 Bacteria 1587
105 Ga0070711_100237930 3300005439 Unclassified 1422
106 Ga0070705_100023373 3300005440 Bacteria 3318
107 Ga0070700_100199792 3300005441 Unclassified 1404
108 Ga0070694_100019693 3300005444 Bacteria 4294
109 Ga0070708_100120926 3300005445 Bacteria 2416
110 Ga0070708_100130012 3300005445 Bacteria 2330
111 Ga0070663_100011845 3300005455 Bacteria 5495
112 Ga0070663_100027341 3300005455 Bacteria 3873
113 Ga0070678_100022020 3300005456 Bacteria 4213
114 Ga0070678_100066613 3300005456 Bacteria 2677
115 Ga0070678_100189994 3300005456 Bacteria 1688
116 Ga0070678_100408231 3300005456 Bacteria 1181
117 Ga0070662_100033312 3300005457 Bacteria 3626
118 Ga0070662_100164122 3300005457 Unclassified 1739
119 Ga0070681_10023502 3300005458 Bacteria 6200
120 Ga0070681_10032947 3300005458 Bacteria 5201
121 Ga0070681_10059728 3300005458 Bacteria 3792
122 Ga0070681_10076670 3300005458 Bacteria 3301
123 Ga0070681_10112479 3300005458 Bacteria 2662
124 Ga0068867_100021271 3300005459 Bacteria 4629
125 Ga0068867_100128322 3300005459 Unclassified 1968
126 Ga0068867_100185270 3300005459 Bacteria 1657
127 Ga0070685_10074353 3300005466 Unclassified 2022
128 Ga0070707_100055777 3300005468 Bacteria 3788
129 Ga0070698_100028359 3300005471 Bacteria 5815
130 Ga0070699_100143856 3300005518 Bacteria 2107
131 Ga0070679_100009249 3300005530 Bacteria 9313
132 Ga0070679_100009709 3300005530 Bacteria 9103
133 Ga0070679_100051732 3300005530 Bacteria 4091
134 Ga0070679_100098832 3300005530 Bacteria 2906
135 Ga0070679_100173681 3300005530 Bacteria 2128
136 Ga0070679_100342777 3300005530 Bacteria 1442
137 Ga0070684_100008556 3300005535 Bacteria 8010
138 Ga0070684_100022473 3300005535 Bacteria 5261
139 Ga0070684_100063130 3300005535 Bacteria 3246
140 Ga0070684_100092000 3300005535 Bacteria 2699
141 Ga0070684_100271447 3300005535 Bacteria 1553
142 Ga0070697_100079996 3300005536 Bacteria 2692
143 Ga0068853_100003634 3300005539 Bacteria 11828
144 Ga0068853_100045254 3300005539 Bacteria 3769
145 Ga0068853_100097553 3300005539 Bacteria 2595
146 Ga0068853_100175843 3300005539 Bacteria 1939
147 Ga0068853_100177249 3300005539 Bacteria 1932
148 Ga0068853_100179629 3300005539 Bacteria 1919
149 Ga0068853_100529554 3300005539 Bacteria 1115
150 Ga0070672_100006742 3300005543 Bacteria 7744
151 Ga0070672_100105181 3300005543 Bacteria 2294
152 Ga0070686_100116734 3300005544 Unclassified 1827
153 Ga0070695_100027274 3300005545 Bacteria 3537
154 Ga0070696_100027513 3300005546 Bacteria 3875
155 Ga0070693_100031082 3300005547 Bacteria 2924
156 Ga0070665_100063185 3300005548 Bacteria 3712
157 Ga0070665_100065216 3300005548 Plasmid 3653
158 Ga0070665_100071799 3300005548 Bacteria 3468
159 Ga0070665_100080708 3300005548 Bacteria 3258
160 Ga0070665_100105307 3300005548 Bacteria 2823
161 Ga0070665_100172385 3300005548 Bacteria 2164
162 Ga0070665_100203035 3300005548 Bacteria 1982
163 Ga0070665_100265636 3300005548 Bacteria 1717
164 Ga0070665_100380649 3300005548 Bacteria 1418
165 Ga0070665_100428297 3300005548 Bacteria 1332
166 Ga0070704_100025802 3300005549 Bacteria 3873
167 Ga0068855_100018412 3300005563 Bacteria 8391
168 Ga0068855_100019735 3300005563 Bacteria 8094
169 Ga0068855_100112477 3300005563 Bacteria 3124
170 Ga0068855_100125312 3300005563 Bacteria 2937
171 Ga0068855_100259104 3300005563 Bacteria 1938
172 Ga0068855_100261934 3300005563 Bacteria 1926
173 Ga0068855_100262469 3300005563 Bacteria 1923
174 Ga0068855_100410537 3300005563 Bacteria 1482
175 Ga0068855_100432165 3300005563 Unclassified 1439
176 Ga0068855_100454183 3300005563 Bacteria 1398
177 Ga0068855_100495803 3300005563 Bacteria 1328
178 Ga0068855_100739264 3300005563 Bacteria 1050
179 Ga0070664_100047876 3300005564 Bacteria 3613
180 Ga0070664_100069419 3300005564 Bacteria 3015
181 Ga0070664_100238256 3300005564 Bacteria 1633
182 Ga0068857_100003181 3300005577 Bacteria 13618
183 Ga0068857_100096073 3300005577 Bacteria 2655
184 Ga0068857_100681426 3300005577 Bacteria 976
185 Ga0068854_100016856 3300005578 Bacteria 4878
186 Ga0068854_100030721 3300005578 Bacteria 3729
187 Ga0068854_100122052 3300005578 Bacteria 1980
188 Ga0068854_100155813 3300005578 Bacteria 1765
189 Ga0068856_100000781 3300005614 Bacteria 34483
190 Ga0068856_100024188 3300005614 Bacteria 5909
191 Ga0068856_100047838 3300005614 Bacteria 4214
192 Ga0068856_100073843 3300005614 Bacteria 3377
193 Ga0068856_100074006 3300005614 Bacteria 3372
194 Ga0068856_100116233 3300005614 Bacteria 2675
195 Ga0068856_100178360 3300005614 Bacteria 2137
196 Ga0068856_100180758 3300005614 Bacteria 2122
197 Ga0068856_100298360 3300005614 Bacteria 1629
198 Ga0068856_100320920 3300005614 Unclassified 1566
199 Ga0068856_100322290 3300005614 Bacteria 1563
200 Ga0070702_100046391 3300005615 Unclassified 2463
201 Ga0070702_100149746 3300005615 Bacteria 1496
202 Ga0070702_100323136 3300005615 Bacteria 1076
203 Ga0068852_100024735 3300005616 Bacteria 4858
204 Ga0068852_100026321 3300005616 Bacteria 4727
205 Ga0068852_100028959 3300005616 Bacteria 4542
206 Ga0068852_100204250 3300005616 Bacteria 1871
207 Ga0068852_100212283 3300005616 Bacteria 1837
208 Ga0068852_100545435 3300005616 Unclassified 1159
209 Ga0068859_100035913 3300005617 Bacteria 4973
210 Ga0068859_100154399 3300005617 Bacteria 2372
211 Ga0068859_100485774 3300005617 Unclassified 1330
212 Ga0068864_100026533 3300005618 Bacteria 4885
213 Ga0068864_100287017 3300005618 Unclassified 1537
214 Ga0068866_10022841 3300005718 Bacteria 2900
215 Ga0068861_100019676 3300005719 Bacteria 4823
216 Ga0068861_100048184 3300005719 Bacteria 3220
217 Ga0068861_100204537 3300005719 Bacteria 1659
218 Ga0068863_100006825 3300005841 Bacteria 11196
219 Ga0068858_100127566 3300005842 Unclassified 2384
220 Ga0068860_100018432 3300005843 Bacteria 6790
221 Ga0068860_100143296 3300005843 Bacteria 2298
222 Ga0068860_100143725 3300005843 Bacteria 2294
223 Ga0068862_100010222 3300005844 Bacteria 7743
224 Ga0068862_100028055 3300005844 Bacteria 4741
225 Ga0068862_100083389 3300005844 Bacteria 2775
226 Ga0081455_10000200 3300005937 Bacteria 76013
227 Ga0081455_10000768 3300005937 Bacteria 41613
228 Ga0081455_10023827 3300005937 Bacteria 5687
229 Ga0081540_1002136 3300005983 Bacteria 16449
230 Ga0081540_1008268 3300005983 Bacteria 7287
231 Ga0081540_1013689 3300005983 Bacteria 5258
232 Ga0070717_10003779 3300006028 Bacteria 10878
233 Ga0070717_10034264 3300006028 Bacteria 4104
234 Ga0070717_10351343 3300006028 Bacteria 1318
235 Ga0070717_10395519 3300006028 Bacteria 1241
236 Ga0075365_10046636 3300006038 Bacteria 2847
237 Ga0075365_10051949 3300006038 Bacteria 2709
238 Ga0075365_10065320 3300006038 Bacteria 2438
239 Ga0075368_10008811 3300006042 Bacteria 3612
240 Ga0075363_100065887 3300006048 Bacteria 1959
241 Ga0070715_10208276 3300006163 Bacteria 998
242 Ga0070716_100008278 3300006173 Bacteria 5157
243 Ga0070716_100012612 3300006173 Plasmid 4288
244 Ga0070716_100078406 3300006173 Bacteria 1964
245 Ga0070712_100328792 3300006175 Bacteria 1245
246 Ga0075367_10016061 3300006178 Bacteria 4082
247 Ga0075367_10026524 3300006178 Bacteria 3287
248 Ga0075367_10048065 3300006178 Bacteria 2512
249 Ga0075427_10000041 3300006194 Bacteria 9241
250 Ga0097621_100011867 3300006237 Bacteria 6441
251 Ga0097621_100024301 3300006237 Bacteria 4730
252 Ga0075370_10019677 3300006353 Bacteria 3679
253 Ga0068871_100019303 3300006358 Bacteria 5203
254 Ga0068871_100057668 3300006358 Bacteria 3160
255 Ga0068871_100157136 3300006358 Bacteria 1942
256 Ga0068871_100162788 3300006358 Bacteria 1909
257 Ga0068871_100300703 3300006358 Bacteria 1408
258 Ga0075428_100003399 3300006844 Bacteria 17407
259 Ga0075430_100000133 3300006846 Bacteria 47377
260 Ga0075431_100002259 3300006847 Bacteria 18467
261 Ga0075433_10000506 3300006852 Bacteria 25421
262 Ga0075433_10025119 3300006852 Bacteria 5036
263 Ga0075433_10038792 3300006852 Bacteria 4116
264 Ga0075434_100000472 3300006871 Bacteria 30053
265 Ga0075434_100008091 3300006871 Bacteria 9750
266 Ga0075434_100044057 3300006871 Bacteria 4427
267 Ga0075434_100068627 3300006871 Bacteria 3532
268 Ga0075434_100386460 3300006871 Bacteria 1420
269 Ga0075434_100411167 3300006871 Bacteria 1374
270 Ga0075429_100000163 3300006880 Bacteria 42270
271 Ga0068865_100001544 3300006881 Bacteria 13429
272 Ga0068865_100003466 3300006881 Bacteria 9451
273 Ga0068865_100076577 3300006881 Bacteria 2388
274 Ga0068865_100362686 3300006881 Unclassified 1177
275 Ga0097620_100035916 3300006931 Bacteria 4973
276 Ga0097620_100154402 3300006931 Bacteria 2372
277 Ga0097620_100485755 3300006931 Unclassified 1330
278 Ga0099825_1036559 3300006941 Bacteria 1683
279 Ga0099824_1023056 3300006942 Bacteria 3951
280 Ga0099822_1001448 3300006943 Bacteria 27661
281 Ga0099823_1004051 3300006944 Bacteria 14168
282 Ga0075435_100017200 3300007076 Bacteria 5466
283 Ga0075435_100056759 3300007076 Bacteria 3166
284 Ga0099794_10060242 3300007265 Bacteria 1843
285 Ga0099795_10003998 3300007788 Bacteria 3742
286 Ga0099795_10010789 3300007788 Bacteria 2705
287 Ga0099795_10025253 3300007788 Bacteria 1991
288 Ga0099795_10134516 3300007788 Bacteria 1000
289 Ga0105251_10010431 3300009011 Bacteria 5391
290 Ga0105240_10008946 3300009093 Bacteria 14238
291 Ga0105240_10023552 3300009093 Bacteria 8137
292 Ga0105240_10029706 3300009093 Bacteria 7114
293 Ga0105240_10039692 3300009093 Bacteria 6026
294 Ga0105240_10048624 3300009093 Bacteria 5359
295 Ga0105240_10092782 3300009093 Bacteria 3685
296 Ga0105240_10427362 3300009093 Unclassified 1487
297 Ga0111539_10000389 3300009094 Bacteria 54333
298 Ga0111539_10001808 3300009094 Bacteria 28479
299 Ga0105245_10031587 3300009098 Bacteria 4687
300 Ga0105245_10035028 3300009098 Bacteria 4454
301 Ga0105245_10062438 3300009098 Bacteria 3361
302 Ga0105245_10154012 3300009098 Bacteria 2176
303 Ga0105245_10247473 3300009098 Bacteria 1731
304 Ga0105247_10031859 3300009101 Bacteria 3201
305 Ga0105247_10034936 3300009101 Bacteria 3062
306 Ga0105247_10056334 3300009101 Bacteria 2427
307 Ga0114129_10018380 3300009147 Bacteria 9958
308 Ga0114129_10364864 3300009147 Bacteria 1910
309 Ga0114129_10609708 3300009147 Bacteria 1413
310 Ga0105243_10040850 3300009148 Bacteria 3625
311 Ga0105241_10024018 3300009174 Bacteria 4526
312 Ga0105241_10031108 3300009174 Bacteria 3994
313 Ga0105241_10081747 3300009174 Bacteria 2531
314 Ga0105242_10082937 3300009176 Bacteria 2683
315 Ga0105242_10097450 3300009176 Bacteria 2486
316 Ga0105242_10271376 3300009176 Bacteria 1537
317 Ga0105242_10803490 3300009176 Bacteria 931
318 Ga0105248_10011779 3300009177 Bacteria 9647
319 Ga0105248_10046950 3300009177 Bacteria 4842
320 Ga0105248_10237637 3300009177 Bacteria 2051
321 Ga0105248_10261174 3300009177 Bacteria 1949
322 Ga0105237_10004719 3300009545 Bacteria 15684
323 Ga0105237_10007432 3300009545 Bacteria 11993
324 Ga0105237_10019250 3300009545 Bacteria 7053
325 Ga0105237_10045568 3300009545 Bacteria 4412
326 Ga0105237_10381648 3300009545 Bacteria 1414
327 Ga0105237_10410939 3300009545 Unclassified 1358
328 Ga0105237_10470423 3300009545 Bacteria 1263
329 Ga0105238_10031611 3300009551 Bacteria 5389
330 Ga0105238_10040511 3300009551 Bacteria 4720
331 Ga0105238_10045455 3300009551 Plasmid 4435
332 Ga0105238_10064854 3300009551 Bacteria 3652
333 Ga0105238_10110436 3300009551 Bacteria 2730
334 Ga0105238_10292182 3300009551 Bacteria 1612
335 Ga0105238_10374066 3300009551 Bacteria 1415
336 Ga0105249_10019871 3300009553 Bacteria 5999
337 Ga0105249_10067975 3300009553 Bacteria 3285
338 Ga0105249_10094865 3300009553 Bacteria 2797
339 Ga0099796_10043386 3300010159 Bacteria 1532
340 Ga0105239_10043179 3300010375 Bacteria 4940
341 Ga0105239_10053738 3300010375 Bacteria 4418
342 Ga0105239_10064549 3300010375 Bacteria 4019
343 Ga0105239_10079664 3300010375 Bacteria 3604
344 Ga0105239_10168122 3300010375 Bacteria 2452
345 Ga0105239_10282663 3300010375 Bacteria 1868
346 Ga0105239_10316055 3300010375 Bacteria 1761
347 Ga0105239_10322586 3300010375 Bacteria 1742
348 Ga0105239_10323551 3300010375 Bacteria 1739
349 Ga0105239_10330197 3300010375 Bacteria 1720
350 Ga0105239_10826421 3300010375 Bacteria 1062
351 Ga0105246_10012128 3300011119 Bacteria 5371
352 Ga0105246_10054989 3300011119 Bacteria 2745
353 Ga0105246_10332364 3300011119 Bacteria 1239
354 Ga0157326_1008038 3300012513 Unclassified 1146
355 Ga0157373_10010494 3300013100 Bacteria 6814
356 Ga0157373_10024897 3300013100 Bacteria 4334
357 Ga0157373_10204840 3300013100 Bacteria 1391
358 Ga0157371_10007078 3300013102 Bacteria 9121
359 Ga0157371_10036676 3300013102 Bacteria 3511
360 Ga0157371_10128334 3300013102 Bacteria 1804
361 Ga0157371_10158591 3300013102 Bacteria 1615
362 Ga0157370_10041078 3300013104 Bacteria 4464
363 Ga0157370_10181306 3300013104 Bacteria 1957
364 Ga0157370_10238914 3300013104 Bacteria 1681
365 Ga0157369_10008072 3300013105 Bacteria 12072
366 Ga0157369_10033594 3300013105 Bacteria 5636
367 Ga0157369_10236445 3300013105 Unclassified 1909
368 Ga0157369_10386899 3300013105 Bacteria 1451
369 Ga0157369_10522628 3300013105 Bacteria 1228
370 Ga0157369_10777587 3300013105 Bacteria 984
371 Ga0157374_10002692 3300013296 Bacteria 14940
372 Ga0157374_10164515 3300013296 Bacteria 2162
373 Ga0157374_10224597 3300013296 Bacteria 1844
374 Ga0157378_10049119 3300013297 Bacteria 3753
375 Ga0157378_10104776 3300013297 Bacteria 2586
376 Ga0157378_10108129 3300013297 Bacteria 2546
377 Ga0157378_10396452 3300013297 Bacteria 1359
378 Ga0157378_10471250 3300013297 Bacteria 1249
379 Ga0163162_10022106 3300013306 Bacteria 6268
380 Ga0163162_10022234 3300013306 Bacteria 6250
381 Ga0163162_10029020 3300013306 Bacteria 5475
382 Ga0163162_10081453 3300013306 Bacteria 3307
383 Ga0163162_10107677 3300013306 Bacteria 2883
384 Ga0163162_10198425 3300013306 Bacteria 2135
385 Ga0163162_10324040 3300013306 Bacteria 1673
386 Ga0157372_10016582 3300013307 Bacteria 7904
387 Ga0157372_10107362 3300013307 Bacteria 3194
388 Ga0157372_10214288 3300013307 Bacteria 2232
389 Ga0157372_10423344 3300013307 Bacteria 1552
390 Ga0157375_10064892 3300013308 Bacteria 3637
391 Ga0157375_10430055 3300013308 Bacteria 1486
392 Ga0163163_10029384 3300014325 Bacteria 5287
393 Ga0163163_10059092 3300014325 Bacteria 3791
394 Ga0163163_10155656 3300014325 Bacteria 2330
395 Ga0157380_10013506 3300014326 Bacteria 5957
396 Ga0157377_10013798 3300014745 Bacteria 4096
397 Ga0157377_10226916 3300014745 Bacteria 1199
398 Ga0157379_10010153 3300014968 Bacteria 8207
399 Ga0157379_10027560 3300014968 Bacteria 5058
400 Ga0157376_10022095 3300014969 Bacteria 4952
401 Ga0157376_10109705 3300014969 Bacteria 2426
402 Ga0157376_10113532 3300014969 Unclassified 2389
403 Ga0157376_10237036 3300014969 Bacteria 1698
404 Ga0163161_10006229 3300017792 Bacteria 8265
405 Ga0163161_10035277 3300017792 Plasmid 3580
406 Ga0163161_10039404 3300017792 Bacteria 3392
407 Ga0163161_10047578 3300017792 Bacteria 3097
408 Ga0163161_10135289 3300017792 Bacteria 1863
409 Ga0206356_10553992 3300020070 Bacteria 2161
410 Ga0206356_11532789 3300020070 Bacteria 1374
411 Ga0206354_11292144 3300020081 Bacteria 1356
412 Ga0206353_10342907 3300020082 Bacteria 1126
413 Ga0214542_1000156 3300021321 Bacteria 101631
414 Ga0214545_1000078 3300021324 Bacteria 101631
415 Ga0214543_1000136 3300021327 Bacteria 101629
416 Ga0213875_10003786 3300021388 Bacteria 8505
417 Ga0213871_10000896 3300021441 Bacteria 4553
418 Ga0224572_1006509 3300024225 Bacteria 2114
419 Ga0228598_1015888 3300024227 Bacteria 1485
420 Ga0207425_1014237 3300025245 Bacteria 1811
421 Ga0209677_104346 3300025253 Bacteria 4129
422 Ga0209233_1005084 3300025261 Bacteria 4400
423 Ga0207666_1000311 3300025271 Bacteria 6768
424 Ga0209455_1006888 3300025272 Bacteria 3297
425 Ga0209673_1021558 3300025273 Bacteria 2249
426 Ga0209564_1008607 3300025295 Bacteria 5004
427 Ga0209758_1000705 3300025297 Bacteria 49585
428 Ga0209758_1000932 3300025297 Bacteria 39573
429 Ga0209758_1000986 3300025297 Bacteria 38258
430 Ga0209758_1002299 3300025297 Bacteria 19758
431 Ga0209758_1030972 3300025297 Bacteria 2204
432 Ga0207426_1000632 3300025302 Bacteria 44581
433 Ga0207426_1001240 3300025302 Bacteria 22455
434 Ga0207426_1006296 3300025302 Bacteria 5190
435 Ga0207426_1020313 3300025302 Bacteria 2309
436 Ga0209257_1001185 3300025304 Bacteria 32850
437 Ga0209257_1010432 3300025304 Bacteria 4703
438 Ga0207697_10006626 3300025315 Bacteria 5222
439 Ga0207713_1077773 3300025735 Unclassified 1204
440 Ga0207653_10002805 3300025885 Bacteria 5539
441 Ga0207682_10000009 3300025893 Bacteria 86366
442 Ga0207682_10014469 3300025893 Bacteria 3074
443 Ga0207692_10063809 3300025898 Bacteria 1916
444 Ga0207692_10069546 3300025898 Bacteria 1850
445 Ga0207692_10203761 3300025898 Bacteria 1164
446 Ga0207710_10001303 3300025900 Bacteria 12616
447 Ga0207710_10002730 3300025900 Bacteria 8088
448 Ga0207688_10000892 3300025901 Bacteria 15087
449 Ga0207680_10016229 3300025903 Plasmid 3905
450 Ga0207680_10058944 3300025903 Bacteria 2329
451 Ga0207647_10002160 3300025904 Bacteria 15015
452 Ga0207647_10016893 3300025904 Bacteria 4970
453 Ga0207647_10048251 3300025904 Bacteria 2645
454 Ga0207647_10110563 3300025904 Unclassified 1625
455 Ga0207647_10249664 3300025904 Bacteria 1018
456 Ga0207685_10051712 3300025905 Unclassified 1588
457 Ga0207699_10001069 3300025906 Bacteria 12945
458 Ga0207699_10007734 3300025906 Bacteria 5262
459 Ga0207699_10033250 3300025906 Bacteria 2914
460 Ga0207699_10040581 3300025906 Bacteria 2682
461 Ga0207645_10000999 3300025907 Bacteria 23365
462 Ga0207645_10064570 3300025907 Bacteria 2339
463 Ga0207645_10066806 3300025907 Bacteria 2298
464 Ga0207705_10081980 3300025909 Bacteria 2352
465 Ga0207654_10015616 3300025911 Bacteria 3945
466 Ga0207654_10025829 3300025911 Plasmid 3174
467 Ga0207654_10040703 3300025911 Bacteria 2620
468 Ga0207654_10090337 3300025911 Bacteria 1865
469 Ga0207707_10006422 3300025912 Bacteria 10269
470 Ga0207707_10020542 3300025912 Bacteria 5767
471 Ga0207707_10027810 3300025912 Bacteria 4944
472 Ga0207707_10062664 3300025912 Bacteria 3236
473 Ga0207707_10154734 3300025912 Bacteria 2005
474 Ga0207707_10372622 3300025912 Bacteria 1228
475 Ga0207695_10000123 3300025913 Bacteria 232059
476 Ga0207695_10057960 3300025913 Bacteria 4022
477 Ga0207695_10088527 3300025913 Bacteria 3116
478 Ga0207695_10155565 3300025913 Bacteria 2221
479 Ga0207695_10189873 3300025913 Bacteria 1972
480 Ga0207671_10009480 3300025914 Bacteria 8132
481 Ga0207671_10035416 3300025914 Bacteria 3705
482 Ga0207671_10041159 3300025914 Bacteria 3420
483 Ga0207671_10252742 3300025914 Bacteria 1386
484 Ga0207671_10527652 3300025914 Bacteria 941
485 Ga0207693_10000565 3300025915 Bacteria 33481
486 Ga0207693_10006473 3300025915 Bacteria 9705
487 Ga0207693_10007042 3300025915 Bacteria 9281
488 Ga0207693_10076615 3300025915 Bacteria 2619
489 Ga0207693_10091642 3300025915 Unclassified 2383
490 Ga0207693_10327417 3300025915 Bacteria 1199
491 Ga0207663_10000239 3300025916 Bacteria 24165
492 Ga0207663_10212720 3300025916 Unclassified 1402
493 Ga0207660_10001283 3300025917 Bacteria 16867
494 Ga0207660_10030183 3300025917 Bacteria 3725
495 Ga0207660_10042221 3300025917 Bacteria 3200
496 Ga0207660_10178226 3300025917 Bacteria 1649
497 Ga0207662_10000025 3300025918 Bacteria 70078
498 Ga0207662_10010323 3300025918 Bacteria 5155
499 Ga0207657_10006857 3300025919 Bacteria 11750
500 Ga0207657_10012765 3300025919 Bacteria 8273
501 Ga0207657_10018108 3300025919 Bacteria 6739
502 Ga0207657_10148090 3300025919 Bacteria 1914
503 Ga0207657_10161621 3300025919 Unclassified 1819
504 Ga0207657_10166069 3300025919 Bacteria 1790
505 Ga0207657_10231905 3300025919 Bacteria 1476
506 Ga0207649_10002186 3300025920 Bacteria 11047
507 Ga0207649_10025741 3300025920 Bacteria 3434
508 Ga0207649_10303134 3300025920 Unclassified 1169
509 Ga0207649_10318780 3300025920 Unclassified 1141
510 Ga0207652_10073521 3300025921 Bacteria 2974
511 Ga0207652_10075776 3300025921 Bacteria 2932
512 Ga0207652_10144808 3300025921 Bacteria 2126
513 Ga0207652_10179454 3300025921 Bacteria 1902
514 Ga0207652_10322632 3300025921 Bacteria 1394
515 Ga0207652_10345915 3300025921 Bacteria 1342
516 Ga0207646_10112011 3300025922 Bacteria 2449
517 Ga0207646_10118738 3300025922 Bacteria 2375
518 Ga0207681_10007074 3300025923 Bacteria 6881
519 Ga0207681_10156754 3300025923 Bacteria 1712
520 Ga0207694_10039207 3300025924 Bacteria 3645
521 Ga0207694_10045928 3300025924 Bacteria 3375
522 Ga0207694_10104378 3300025924 Bacteria 2249
523 Ga0207694_10434838 3300025924 Bacteria 1094
524 Ga0207694_10461524 3300025924 Bacteria 1061
525 Ga0207650_10357355 3300025925 Bacteria 1203
526 Ga0207659_10169970 3300025926 Bacteria 1719
527 Ga0207659_10177614 3300025926 Unclassified 1684
528 Ga0207659_10216169 3300025926 Bacteria 1539
529 Ga0207687_10003202 3300025927 Bacteria 11093
530 Ga0207687_10030484 3300025927 Bacteria 3637
531 Ga0207687_10208342 3300025927 Bacteria 1532
532 Ga0207687_10221870 3300025927 Bacteria 1489
533 Ga0207687_10509783 3300025927 Bacteria 1005
534 Ga0207700_10004367 3300025928 Bacteria 8326
535 Ga0207700_10005825 3300025928 Bacteria 7404
536 Ga0207700_10076952 3300025928 Bacteria 2590
537 Ga0207664_10022280 3300025929 Bacteria 4728
538 Ga0207664_10032782 3300025929 Bacteria 3985
539 Ga0207664_10130661 3300025929 Bacteria 2113
540 Ga0207644_10032924 3300025931 Bacteria 3620
541 Ga0207644_10036076 3300025931 Bacteria 3469
542 Ga0207644_10055831 3300025931 Bacteria 2848
543 Ga0207644_10061984 3300025931 Bacteria 2710
544 Ga0207644_10127632 3300025931 Bacteria 1943
545 Ga0207690_10011755 3300025932 Bacteria 5236
546 Ga0207690_10064867 3300025932 Bacteria 2495
547 Ga0207690_10088473 3300025932 Unclassified 2182
548 Ga0207690_10253542 3300025932 Bacteria 1360
549 Ga0207706_10005363 3300025933 Bacteria 11952
550 Ga0207706_10040844 3300025933 Bacteria 4112
551 Ga0207706_10085400 3300025933 Bacteria 2775
552 Ga0207706_10129804 3300025933 Bacteria 2217
553 Ga0207686_10014315 3300025934 Bacteria 4412
554 Ga0207686_10187791 3300025934 Bacteria 1471
555 Ga0207709_10006190 3300025935 Bacteria 6736
556 Ga0207709_10012682 3300025935 Bacteria 4646
557 Ga0207709_10024392 3300025935 Bacteria 3453
558 Ga0207670_10013997 3300025936 Bacteria 4749
559 Ga0207670_10078501 3300025936 Unclassified 2302
560 Ga0207670_10375891 3300025936 Unclassified 1131
561 Ga0207669_10001324 3300025937 Bacteria 10540
562 Ga0207669_10084772 3300025937 Bacteria 2043
563 Ga0207704_10003457 3300025938 Bacteria 7181
564 Ga0207665_10000127 3300025939 Bacteria 50413
565 Ga0207665_10002113 3300025939 Bacteria 13436
566 Ga0207665_10108803 3300025939 Bacteria 1945
567 Ga0207665_10196496 3300025939 Bacteria 1468
568 Ga0207665_10267556 3300025939 Bacteria 1268
569 Ga0207691_10002604 3300025940 Bacteria 17616
570 Ga0207691_10113799 3300025940 Bacteria 2404
571 Ga0207691_10116097 3300025940 Bacteria 2376
572 Ga0207691_10365968 3300025940 Unclassified 1232
573 Ga0207711_10001071 3300025941 Bacteria 26139
574 Ga0207711_10072335 3300025941 Bacteria 2995
575 Ga0207711_10106384 3300025941 Bacteria 2489
576 Ga0207711_10252392 3300025941 Bacteria 1620
577 Ga0207689_10001156 3300025942 Bacteria 25400
578 Ga0207689_10031636 3300025942 Bacteria 4403
579 Ga0207689_10081386 3300025942 Bacteria 2662
580 Ga0207661_10002078 3300025944 Bacteria 13776
581 Ga0207661_10007789 3300025944 Bacteria 7627
582 Ga0207661_10062965 3300025944 Bacteria 3003
583 Ga0207679_10003209 3300025945 Bacteria 10084
584 Ga0207679_10267358 3300025945 Bacteria 1461
585 Ga0207679_10417424 3300025945 Unclassified 1183
586 Ga0207667_10013288 3300025949 Bacteria 9430
587 Ga0207667_10028603 3300025949 Bacteria 6052
588 Ga0207667_10064143 3300025949 Bacteria 3836
589 Ga0207667_10077987 3300025949 Bacteria 3434
590 Ga0207667_10095327 3300025949 Bacteria 3072
591 Ga0207667_10103467 3300025949 Bacteria 2937
592 Ga0207667_10115171 3300025949 Bacteria 2771
593 Ga0207667_10122695 3300025949 Bacteria 2677
594 Ga0207667_10123806 3300025949 Bacteria 2663
595 Ga0207667_10128039 3300025949 Bacteria 2615
596 Ga0207667_10188431 3300025949 Bacteria 2117
597 Ga0207667_10219159 3300025949 Bacteria 1950
598 Ga0207667_10607125 3300025949 Bacteria 1103
599 Ga0207651_10008497 3300025960 Bacteria 5550
600 Ga0207651_10151130 3300025960 Bacteria 1807
601 Ga0207651_10327218 3300025960 Bacteria 1283
602 Ga0207712_10000579 3300025961 Bacteria 29666
603 Ga0207668_10001403 3300025972 Bacteria 14194
604 Ga0207668_10085216 3300025972 Bacteria 2305
605 Ga0207640_10003644 3300025981 Bacteria 8306
606 Ga0207640_10066874 3300025981 Bacteria 2403
607 Ga0207640_10075564 3300025981 Bacteria 2284
608 Ga0207640_10558073 3300025981 Bacteria 963
609 Ga0207658_10018420 3300025986 Bacteria 4821
610 Ga0207658_10130939 3300025986 Bacteria 2015
611 Ga0207677_10006044 3300026023 Bacteria 6604
612 Ga0207677_10117181 3300026023 Unclassified 1996
613 Ga0207677_10124489 3300026023 Bacteria 1945
614 Ga0207703_10008872 3300026035 Bacteria 7922
615 Ga0207703_10014416 3300026035 Bacteria 6164
616 Ga0207703_10130992 3300026035 Bacteria 2166
617 Ga0207703_10184537 3300026035 Bacteria 1843
618 Ga0207703_10306384 3300026035 Bacteria 1450
619 Ga0207639_10001866 3300026041 Bacteria 14170
620 Ga0207639_10044315 3300026041 Bacteria 3345
621 Ga0207639_10082222 3300026041 Bacteria 2553
622 Ga0207639_10094435 3300026041 Bacteria 2401
623 Ga0207639_10108911 3300026041 Bacteria 2253
624 Ga0207639_10135429 3300026041 Bacteria 2045
625 Ga0207639_10261036 3300026041 Bacteria 1515
626 Ga0207639_10288492 3300026041 Bacteria 1446
627 Ga0207639_10582894 3300026041 Bacteria 1030
628 Ga0207678_10021488 3300026067 Bacteria 5659
629 Ga0207678_10022823 3300026067 Bacteria 5479
630 Ga0207678_10042596 3300026067 Bacteria 3932
631 Ga0207678_10062786 3300026067 Bacteria 3193
632 Ga0207678_10130307 3300026067 Bacteria 2145
633 Ga0207678_10145100 3300026067 Unclassified 2026
634 Ga0207678_10261116 3300026067 Bacteria 1484
635 Ga0207708_10020931 3300026075 Bacteria 4935
636 Ga0207708_10130549 3300026075 Unclassified 1964
637 Ga0207702_10000758 3300026078 Bacteria 34312
638 Ga0207702_10010946 3300026078 Bacteria 7566
639 Ga0207702_10065779 3300026078 Bacteria 3106
640 Ga0207702_10098432 3300026078 Bacteria 2576
641 Ga0207702_10160482 3300026078 Bacteria 2053
642 Ga0207702_10167929 3300026078 Bacteria 2009
643 Ga0207702_10249986 3300026078 Unclassified 1665
644 Ga0207641_10006404 3300026088 Bacteria 9923
645 Ga0207641_10051015 3300026088 Plasmid 3502
646 Ga0207648_10004627 3300026089 Bacteria 14090
647 Ga0207648_10046915 3300026089 Bacteria 3787
648 Ga0207648_10176768 3300026089 Bacteria 1888
649 Ga0207676_10030863 3300026095 Bacteria 4026
650 Ga0207676_10677293 3300026095 Bacteria 997
651 Ga0207674_10054730 3300026116 Bacteria 4061
652 Ga0207674_10246718 3300026116 Unclassified 1733
653 Ga0207675_100003859 3300026118 Bacteria 14570
654 Ga0207675_100104527 3300026118 Bacteria 2669
655 Ga0207675_100108300 3300026118 Plasmid 2620
656 Ga0207675_100115515 3300026118 Bacteria 2536
657 Ga0207675_100533979 3300026118 Unclassified 1171
658 Ga0207683_10000782 3300026121 Bacteria 29001
659 Ga0207683_10000850 3300026121 Bacteria 28050
660 Ga0207683_10051919 3300026121 Bacteria 3592
661 Ga0207683_10056530 3300026121 Bacteria 3442
662 Ga0207683_10089743 3300026121 Bacteria 2736
663 Ga0207683_10163872 3300026121 Bacteria 2011
664 Ga0207683_10304839 3300026121 Bacteria 1457
665 Ga0207698_10007574 3300026142 Bacteria 6807
666 Ga0207698_10031006 3300026142 Bacteria 3854
667 Ga0207698_10087873 3300026142 Bacteria 2533
668 Ga0207698_10096641 3300026142 Bacteria 2435
669 Ga0207698_10375299 3300026142 Bacteria 1351
670 Ga0209389_1000019 3300027296 Bacteria 172067
671 Ga0209389_1000248 3300027296 Bacteria 34726
672 Ga0209589_1000005 3300027357 Bacteria 530958
673 Ga0209589_1001871 3300027357 Bacteria 35557
674 Ga0209489_100005 3300027361 Bacteria 530958
675 Ga0209489_100033 3300027361 Bacteria 172166
676 Ga0209489_102684 3300027361 Bacteria 35799
677 Ga0209700_100006 3300027363 Bacteria 530958
678 Ga0209700_100012 3300027363 Bacteria 357892
679 Ga0209179_1012095 3300027512 Bacteria 1544
680 Ga0209998_10002588 3300027717 Bacteria 4111
681 Ga0209974_10003747 3300027876 Bacteria 5444
682 Ga0207428_10000164 3300027907 Bacteria 91968
683 Ga0207428_10000391 3300027907 Bacteria 54825
684 Ga0265357_1000580 3300028023 Bacteria 2230
685 Ga0268266_10002016 3300028379 Bacteria 22644
686 Ga0268266_10077802 3300028379 Bacteria 2885
687 Ga0268266_10112988 3300028379 Bacteria 2408
688 Ga0268266_10128151 3300028379 Bacteria 2267
689 Ga0268266_10203354 3300028379 Bacteria 1813
690 Ga0268266_10499031 3300028379 Bacteria 1162
691 Ga0268265_10004025 3300028380 Bacteria 10352
692 Ga0268265_10079812 3300028380 Bacteria 2578
693 Ga0268264_10000174 3300028381 Bacteria 137254
694 Ga0268264_10049152 3300028381 Bacteria 3508
695 Ga0268264_10146243 3300028381 Bacteria 2114
696 Ga0307517_10000859 3300028786 Bacteria 51881
697 Ga0307515_10028873 3300028794 Bacteria 9406
698 Ga0265338_10059137 3300028800 Bacteria 3378
699 Ga0307511_10032093 3300030521 Bacteria 4676
700 Ga0265770_1032542 3300030878 Bacteria 880
701 Ga0265330_10020221 3300031235 Bacteria 3042
702 Ga0265330_10031054 3300031235 Bacteria 2395
703 Ga0265330_10067423 3300031235 Bacteria 1550
704 Ga0265332_10006382 3300031238 Bacteria 5348
705 Ga0265328_10043351 3300031239 Bacteria 1655
706 Ga0265325_10000019 3300031241 Bacteria 125265
707 Ga0265325_10003263 3300031241 Bacteria 10664
708 Ga0265325_10028164 3300031241 Bacteria 3031
709 Ga0265340_10018122 3300031247 Bacteria 3635
710 Ga0265340_10036658 3300031247 Bacteria 2430
711 Ga0265339_10001912 3300031249 Bacteria 15282
712 Ga0265331_10190616 3300031250 Bacteria 925
713 Ga0265316_10067912 3300031344 Bacteria 2756
714 Ga0307509_10006398 3300031507 Bacteria 15864
715 Ga0307509_10274632 3300031507 Bacteria 1451
716 Ga0265313_10019302 3300031595 Bacteria 3797
717 Ga0265313_10022283 3300031595 Bacteria 3440
718 Ga0265313_10024531 3300031595 Bacteria 3219
719 Ga0265313_10112428 3300031595 Bacteria 1196
720 Ga0307508_10000063 3300031616 Bacteria 122536
721 Ga0307508_10056441 3300031616 Bacteria 3477
722 Ga0307508_10175540 3300031616 Bacteria 1746
723 Ga0316579_10019886 3300031691 Bacteria 2971
724 Ga0265314_10003648 3300031711 Bacteria 14810
725 Ga0265314_10039492 3300031711 Bacteria 3398
726 Ga0265314_10176733 3300031711 Bacteria 1283
727 Ga0265342_10001257 3300031712 Bacteria 23945
728 Ga0265342_10005406 3300031712 Bacteria 9751
729 Ga0265342_10122647 3300031712 Bacteria 1462
730 Ga0307516_10043872 3300031730 Bacteria 4428
731 Ga0307405_10022939 3300031731 Bacteria 3538
732 Ga0307413_10038231 3300031824 Bacteria 2780
733 Ga0307410_10143559 3300031852 Bacteria 1769
734 Ga0307406_10132490 3300031901 Bacteria 1752
735 Ga0307507_10125921 3300033179 Bacteria 2027
736 Ga0307507_10150631 3300033179 Bacteria 1751
737 Ga0307510_10126787 3300033180 Bacteria 2239
738 Ga0307510_10152035 3300033180 Bacteria 1931
739 Ga0315911_1000040 3300033442 Bacteria 50766
740 Ga0316213_1002509 3300033546 Bacteria 1235
741 Ga0373930_0008599 3300034816 Bacteria 1788
742 Ga0373959_0012771 3300034820 Bacteria 1505
743 Ga0373959_0023004 3300034820 Unclassified 1209
744 Ga0373938_0006998 3300034957 Bacteria 1971
745 Ga0373926_0000388 3300035083 Bacteria 11245
746 Ga0373926_0011522 3300035083 Bacteria 2976
747 Ga0373929_0004760 3300035085 Unclassified 2433
748 Ga0373934_0047916 3300035086 Bacteria 1691
749 Ga0373934_0053221 3300035086 Bacteria 1605
750 Ga0373934_0084179 3300035086 Unclassified 1279
751 Ga0373940_0027412 3300035088 Bacteria 1497
752 Ga0373944_0002538 3300035089 Bacteria 4637
753 Ga0373949_0006564 3300035090 Plasmid 2559
754 Ga0373949_0022292 3300035090 Bacteria 1459
755 Ga0373951_0031325 3300035091 Bacteria 1254
756 Ga0373952_0000933 3300035092 Bacteria 5313
757 Ga0373923_0003867 3300035111 Bacteria 4879
758 Ga0373923_0043642 3300035111 Bacteria 1856
759 Ga0373923_0049887 3300035111 Bacteria 1751
760 Ga0373932_0003751 3300035112 Bacteria 3626
761 Ga0373932_0020639 3300035112 Unclassified 1730
762 Ga0373936_0006062 3300035113 Bacteria 4555
763 Ga0373936_0053213 3300035113 Bacteria 1641
764 Ga0373936_0054051 3300035113 Bacteria 1629
765 Ga0373936_0104471 3300035113 Bacteria 1198
766 Ga0373939_0002641 3300035114 Bacteria 4207
767 Ga0373939_0003090 3300035114 Bacteria 3908
768 Ga0373939_0062364 3300035114 Bacteria 1191
769 Ga0373939_0069899 3300035114 Bacteria 1140
770 Ga0373941_0014083 3300035115 Unclassified 2130
771 Ga0373945_0007291 3300035116 Bacteria 3581
772 Ga0373945_0011447 3300035116 Plasmid 2934
773 Ga0373953_0012482 3300035117 Bacteria 3010
774 Ga0373953_0018244 3300035117 Plasmid 2594
775 Ga0373953_0051706 3300035117 Bacteria 1662
776 Ga0373954_0001219 3300035118 Bacteria 10343
777 Ga0373954_0008152 3300035118 Bacteria 4590
778 Ga0373954_0031320 3300035118 Bacteria 2455
779 Ga0373956_0004720 3300035119 Bacteria 5448
780 Ga0373956_0025442 3300035119 Plasmid 2558
781 Ga0373957_0003464 3300035120 Bacteria 4665
782 Ga0373957_0010097 3300035120 Bacteria 3109
783 Ga0373957_0053731 3300035120 Bacteria 1546
784 Ga0373957_0103774 3300035120 Bacteria 1140
785 Ga0373943_0001607 3300035170 Bacteria 10243
786 Ga0373943_0028008 3300035170 Bacteria 2652
787 Ga0373943_0033149 3300035170 Bacteria 2458
788 Ga0373943_0101921 3300035170 Bacteria 1503
789 Ga0373943_0165362 3300035170 Bacteria 1207
790 Ga0373943_0214025 3300035170 Bacteria 1071
791 Ga0373946_0020904 3300035171 Bacteria 2533
792 Ga0373946_0027110 3300035171 Bacteria 2264
793 Ga0373946_0075376 3300035171 Bacteria 1466
794 Ga0373946_0101738 3300035171 Bacteria 1289
795 Ga0373955_0002049 3300035172 Bacteria 8671
796 Ga0373955_0005330 3300035172 Bacteria 5775
797 Ga0373955_0012895 3300035172 Plasmid 4029
798 Ga0373955_0323138 3300035172 Bacteria 932
799 Ga0373942_0006671 3300035207 Plasmid 2666
800 Ga0373942_0031660 3300035207 Bacteria 1400
801 Ga0373961_0002775 3300035241 Bacteria 4466
802 Ga0373924_0014698 3300035410 Bacteria 2961
803 Ga0373931_0002611 3300035691 Bacteria 8014
804 Ga0373931_0006487 3300035691 Bacteria 5467
805 Ga0373931_0305503 3300035691 Bacteria 984
806 Ga0373931_0344444 3300035691 Bacteria 931
807 Ga0373935_0000942 3300035692 Bacteria 15748
808 Ga0373935_0027111 3300035692 Bacteria 3541
809 Ga0373935_0042617 3300035692 Plasmid 2855
810 Ga0373935_0051264 3300035692 Bacteria 2621
811 Ga0373935_0057366 3300035692 Bacteria 2484
812 Ga0373935_0057406 3300035692 Unclassified 2483
813 Ga0373935_0121844 3300035692 Bacteria 1743
814 Ga0373935_0196235 3300035692 Bacteria 1393
815 Ga0373935_0439570 3300035692 Bacteria 941
816 Ga0373927_0000528 3300035695 Bacteria 29016
817 Ga0373927_0021674 3300035695 Bacteria 4210
818 Ga0373927_0030902 3300035695 Bacteria 3494
819 Ga0373927_0035067 3300035695 Bacteria 3262
820 Ga0373927_0041261 3300035695 Plasmid 2993
821 Ga0373927_0066975 3300035695 Bacteria 2323
822 Ga0373927_0148674 3300035695 Bacteria 1534
823 Ga0373927_0214174 3300035695 Bacteria 1265
824 Ga0373927_0227121 3300035695 Bacteria 1226
825 Ga0373927_0297623 3300035695 Bacteria 1062
826 Ga0373933_0000204 3300035724 Bacteria 39417
827 Ga0373933_0002658 3300035724 Bacteria 10013
828 Ga0373933_0010853 3300035724 Bacteria 4999
829 Ga0373933_0034817 3300035724 Plasmid 2937
830 Ga0373933_0077067 3300035724 Bacteria 2037
831 Ga0373933_0090111 3300035724 Bacteria 1891
832 Ga0373933_0188029 3300035724 Bacteria 1319
833 Ga0373933_0293051 3300035724 Bacteria 1052
834 Ga0373947_0000455 3300035725 Bacteria 23308
835 Ga0373947_0003382 3300035725 Bacteria 9440
836 Ga0373947_0026670 3300035725 Bacteria 3379
837 Ga0373947_0067145 3300035725 Bacteria 2190
838 Ga0373947_0078436 3300035725 Bacteria 2039
839 Ga0373947_0101412 3300035725 Bacteria 1809
840 Ga0373947_0225609 3300035725 Bacteria 1233
841 Ga0373937_0008188 3300036401 Bacteria 9080
842 Ga0373937_0021334 3300036401 Bacteria 5814
843 Ga0373937_0194847 3300036401 Unclassified 1904
844 Ga0372808_001169 3300036459 Bacteria 2608
845 Ga0316582_0023146 3300036647 Bacteria 3699
846 Ga0373925_0001434 3300037068 Bacteria 20657
847 Ga0373925_0003563 3300037068 Bacteria 12000
848 Ga0373925_0011034 3300037068 Bacteria 6561
849 Ga0373925_0015076 3300037068 Bacteria 5586
850 Ga0373925_0104455 3300037068 Bacteria 2182
851 Ga0373925_0120167 3300037068 Bacteria 2039
852 Ga0373925_0130934 3300037068 Bacteria 1956
853 Ga0373925_0170838 3300037068 Bacteria 1716
854 Ga0373925_0313178 3300037068 Bacteria 1269
855 Ga0395900_0033975 3300037418 Bacteria 5249
856 Ga0395900_0357002 3300037418 Bacteria 1434
857 Ga0395900_0556389 3300037418 Bacteria 1091
858 Ga0395898_0092172 3300037466 Bacteria 2914
859 Ga0395905_0026848 3300037471 Bacteria 5431
860 Ga0436364_0100847 3300037853 Bacteria 1285
861 Ga0436364_1119586 3300037853 Bacteria 13727
862 Ga0395901_0065664 3300038443 Bacteria 3779
863 Ga0395901_0086125 3300038443 Bacteria 3285
864 Ga0395901_0165542 3300038443 Bacteria 2322
865 Ga0395901_0575766 3300038443 Bacteria 1138
866 Ga0436365_1490250 3300039437 Bacteria 1332
867 Ga0436360_0675457 3300039438 Bacteria 2922
868 Ga0436361_0576775 3300039447 Bacteria 2868
869 Ga0436361_0681610 3300039447 Bacteria 2846
870 Ga0436363_1060587 3300039450 Bacteria 6258
871 Ga0436362_0124208 3300039453 Bacteria 3179
872 Ga0466969_0014448 3300044656 Bacteria 4152
873 Ga0466972_0103734 3300044658 Bacteria 1345
874 Ga0466966_0001614 3300044684 Bacteria 14525
875 Ga0466966_0272714 3300044684 Bacteria 1018
876 Ga0466961_0000192 3300044693 Bacteria 40922
877 Ga0466963_0019050 3300044694 Bacteria 4298
878 Ga0466963_0031458 3300044694 Bacteria 3430
879 Ga0466964_0025350 3300044706 Bacteria 2315
880 Ga0466971_0060412 3300044719 Bacteria 1713
881 Ga0466968_0032806 3300044735 Bacteria 2161
882 Ga0466957_0140210 3300044842 Bacteria 1557
883 Ga0466959_0000934 3300045049 Bacteria 17340
884 Ga0466959_0008049 3300045049 Bacteria 7429
885 Ga0466959_0058009 3300045049 Bacteria 2821
886 Ga0466959_0062872 3300045049 Bacteria 2697
887 Ga0466967_0023977 3300045976 Bacteria 5009
888 Ga0466967_0094324 3300045976 Bacteria 2725
889 Ga0466967_0242814 3300045976 Bacteria 1718
890 Ga0466967_0838598 3300045976 Bacteria 913
891 Ga0495592_0021465 3300046454 Bacteria 4910
892 Ga0495592_0032569 3300046454 Bacteria 3932
893 Ga0495592_0038867 3300046454 Bacteria 3577
894 Ga0495592_0087914 3300046454 Bacteria 2234
895 Ga0495603_0000239 3300046455 Bacteria 28578
896 Ga0495603_0015374 3300046455 Bacteria 4631
897 Ga0495603_0017749 3300046455 Bacteria 4307
898 Ga0495603_0072211 3300046455 Bacteria 2028
899 Ga0495590_0116445 3300046457 Bacteria 956
900 Ga0495629_0000139 3300046459 Bacteria 63649
901 Ga0495629_0000457 3300046459 Bacteria 34088
902 Ga0495629_0007972 3300046459 Bacteria 7791
903 Ga0495629_0029920 3300046459 Bacteria 3860
904 Ga0495629_0051611 3300046459 Bacteria 2878
905 Ga0495629_0096371 3300046459 Bacteria 2064
906 Ga0495629_0150450 3300046459 Bacteria 1618
907 Ga0495629_0163427 3300046459 Bacteria 1546
908 Ga0495629_0225033 3300046459 Unclassified 1293
909 Ga0495641_0002157 3300046461 Bacteria 15774
910 Ga0495641_0029301 3300046461 Bacteria 2653
911 Ga0495651_0004984 3300046462 Bacteria 10144
912 Ga0495651_0014000 3300046462 Bacteria 6203
913 Ga0495651_0017171 3300046462 Bacteria 5607
914 Ga0495651_0037984 3300046462 Bacteria 3749
915 Ga0495651_0054995 3300046462 Bacteria 3058
916 Ga0495651_0166592 3300046462 Bacteria 1573
917 Ga0495653_0004257 3300046463 Bacteria 11596
918 Ga0495653_0009797 3300046463 Bacteria 7835
919 Ga0495653_0235853 3300046463 Bacteria 1222
920 Ga0495580_0002960 3300046472 Bacteria 14585
921 Ga0495580_0009072 3300046472 Bacteria 7845
922 Ga0495580_0009091 3300046472 Bacteria 7837
923 Ga0495582_0000077 3300046473 Bacteria 49112
924 Ga0495582_0001850 3300046473 Bacteria 11944
925 Ga0495582_0038297 3300046473 Bacteria 2638
926 Ga0495582_0258275 3300046473 Bacteria 999
927 Ga0495605_0057694 3300046474 Bacteria 1868
928 Ga0495605_0154703 3300046474 Bacteria 1021
929 Ga0495639_0000101 3300046475 Bacteria 42348
930 Ga0495639_0012036 3300046475 Bacteria 3730
931 Ga0495662_0012510 3300046476 Bacteria 4140
932 Ga0495662_0051472 3300046476 Bacteria 1988
933 Ga0495664_0038052 3300046477 Plasmid 2839
934 Ga0495664_0041464 3300046477 Bacteria 2724
935 Ga0495664_0044789 3300046477 Bacteria 2622
936 Ga0495584_0001897 3300046491 Bacteria 12061
937 Ga0495584_0039510 3300046491 Bacteria 2384
938 Ga0495585_0001030 3300046492 Bacteria 23180
939 Ga0495585_0158482 3300046492 Bacteria 1176
940 Ga0495594_0005795 3300046499 Bacteria 6340
941 Ga0495594_0127044 3300046499 Bacteria 1443
942 Ga0495594_0243805 3300046499 Bacteria 1024
943 Ga0495607_0006002 3300046501 Bacteria 8613
944 Ga0495606_0000357 3300046507 Bacteria 78015
945 Ga0495606_0014109 3300046507 Bacteria 6257
946 Ga0495608_0000911 3300046511 Bacteria 20725
947 Ga0495608_0004649 3300046511 Bacteria 9811
948 Ga0495608_0061364 3300046511 Bacteria 2472
949 Ga0495608_0110421 3300046511 Bacteria 1768
950 Ga0495608_0188827 3300046511 Bacteria 1302
951 Ga0495618_0003586 3300046514 Bacteria 9613
952 Ga0495618_0014258 3300046514 Bacteria 4840
953 Ga0495618_0021739 3300046514 Bacteria 3955
954 Ga0495618_0089816 3300046514 Bacteria 1965
955 Ga0495618_0119090 3300046514 Bacteria 1691
956 Ga0495618_0136315 3300046514 Bacteria 1570
957 Ga0495620_0071983 3300046515 Bacteria 1412
958 Ga0495620_0078633 3300046515 Bacteria 1337
959 Ga0495628_0005614 3300046516 Bacteria 10985
960 Ga0495628_0105477 3300046516 Bacteria 2171
961 Ga0495628_0157361 3300046516 Unclassified 1728
962 Ga0495628_0282913 3300046516 Bacteria 1231
963 Ga0495630_0012819 3300046517 Bacteria 6092
964 Ga0495630_0047522 3300046517 Bacteria 3210
965 Ga0495630_0281866 3300046517 Bacteria 1270
966 Ga0495631_0126651 3300046518 Bacteria 1098
967 Ga0495643_0028502 3300046522 Bacteria 3129
968 Ga0495644_0000513 3300046523 Bacteria 16576
969 Ga0495644_0050156 3300046523 Bacteria 1567
970 Ga0495648_0000897 3300046524 Bacteria 31152
971 Ga0495648_0007226 3300046524 Bacteria 8920
972 Ga0495648_0012169 3300046524 Bacteria 6436
973 Ga0495648_0092889 3300046524 Bacteria 1684
974 Ga0495648_0109736 3300046524 Bacteria 1504
975 Ga0495663_0002372 3300046525 Bacteria 5672
976 Ga0495666_0168340 3300046526 Unclassified 1014
977 Ga0495652_0021917 3300046529 Bacteria 5680
978 Ga0495652_0028137 3300046529 Bacteria 4950
979 Ga0495652_0046433 3300046529 Bacteria 3729
980 Ga0495652_0070477 3300046529 Bacteria 2921
981 Ga0495652_0076180 3300046529 Bacteria 2783
982 Ga0495652_0270423 3300046529 Bacteria 1249
983 Ga0495665_0000055 3300046531 Bacteria 45208
984 Ga0495665_0026195 3300046531 Bacteria 3132
985 Ga0495640_0011661 3300046533 Bacteria 6748
986 Ga0495640_0024673 3300046533 Bacteria 4371
987 Ga0495640_0043321 3300046533 Bacteria 3135
988 Ga0495640_0046767 3300046533 Bacteria 2996
989 Ga0495640_0053786 3300046533 Plasmid 2759
990 Ga0495640_0092694 3300046533 Bacteria 1992
991 Ga0495586_0046428 3300046535 Bacteria 2342
992 Ga0495587_0005897 3300046536 Bacteria 7984
993 Ga0495587_0015897 3300046536 Bacteria 4687
994 Ga0495587_0094947 3300046536 Unclassified 1721
995 Ga0495587_0134777 3300046536 Bacteria 1411
996 Ga0495587_0301376 3300046536 Bacteria 896
997 Ga0495598_0045979 3300046537 Bacteria 1296
998 Ga0495609_0017406 3300046538 Bacteria 3337
999 Ga0495609_0085365 3300046538 Bacteria 1377
1000 Ga0495609_0137657 3300046538 Bacteria 1043
1001 Ga0495597_0028153 3300046542 Bacteria 2573
1002 Ga0495645_0011340 3300046543 Bacteria 6268
1003 Ga0495645_0061920 3300046543 Bacteria 2711
1004 Ga0495645_0115470 3300046543 Bacteria 1896
1005 Ga0495645_0120887 3300046543 Bacteria 1844
1006 Ga0495622_0002233 3300046557 Bacteria 9422
1007 Ga0495622_0033493 3300046557 Bacteria 2397
1008 Ga0495622_0055262 3300046557 Bacteria 1841
1009 Ga0495622_0057388 3300046557 Bacteria 1805
1010 Ga0495622_0078894 3300046557 Bacteria 1516
1011 Ga0495622_0101465 3300046557 Bacteria 1319
1012 Ga0495633_0024926 3300046558 Bacteria 2950
1013 Ga0495667_0010518 3300046559 Bacteria 6261
1014 Ga0495667_0021423 3300046559 Bacteria 4361
1015 Ga0495667_0023279 3300046559 Bacteria 4173
1016 Ga0495667_0038378 3300046559 Bacteria 3189
1017 Ga0495667_0048600 3300046559 Bacteria 2801
1018 Ga0495667_0096798 3300046559 Unclassified 1910
1019 Ga0495656_0000091 3300046615 Bacteria 38995
1020 Ga0495656_0006841 3300046615 Bacteria 4008
1021 Ga0495668_0083718 3300046616 Bacteria 1749
1022 Ga0495634_0001036 3300046642 Bacteria 26033
1023 Ga0495634_0063846 3300046642 Bacteria 2443
1024 Ga0495634_0069546 3300046642 Bacteria 2322
1025 Ga0495634_0084757 3300046642 Bacteria 2066
1026 Ga0495634_0110477 3300046642 Bacteria 1768
1027 Ga0495611_0007030 3300046648 Bacteria 4781
1028 Ga0495611_0087470 3300046648 Bacteria 1438
1029 Ga0495625_0030051 3300046660 Bacteria 4057
1030 Ga0495625_0066315 3300046660 Bacteria 2543
1031 Ga0495635_0000815 3300046663 Bacteria 20434
1032 Ga0495635_0004810 3300046663 Bacteria 9387
1033 Ga0495635_0011194 3300046663 Bacteria 6289
1034 Ga0495635_0029736 3300046663 Bacteria 3799
1035 Ga0495635_0093114 3300046663 Bacteria 2060
1036 Ga0495659_0000632 3300046664 Bacteria 12804
1037 Ga0495659_0122405 3300046664 Bacteria 1025
1038 Ga0495661_0010120 3300046665 Bacteria 6448
1039 Ga0495661_0048855 3300046665 Bacteria 2569
1040 Ga0495588_0005058 3300046674 Bacteria 5855
1041 Ga0495588_0005077 3300046674 Bacteria 5848
1042 Ga0495588_0015996 3300046674 Bacteria 3620
1043 Ga0495657_0003079 3300046675 Bacteria 13781
1044 Ga0495657_0004591 3300046675 Bacteria 11023
1045 Ga0495657_0019481 3300046675 Bacteria 4894
1046 Ga0495657_0034720 3300046675 Bacteria 3500
1047 Ga0495657_0194463 3300046675 Bacteria 1238
1048 Ga0495599_0001945 3300046678 Bacteria 11972
1049 Ga0495599_0028704 3300046678 Bacteria 3486
1050 Ga0495599_0053717 3300046678 Bacteria 2524
1051 Ga0495623_0002783 3300046679 Bacteria 11540
1052 Ga0495623_0020870 3300046679 Bacteria 4233
1053 Ga0495623_0233769 3300046679 Bacteria 1041
1054 Ga0495646_0001642 3300046680 Bacteria 13342
1055 Ga0495646_0014188 3300046680 Bacteria 5065
1056 Ga0495646_0022610 3300046680 Bacteria 3965
1057 Ga0495646_0060647 3300046680 Bacteria 2255
1058 Ga0495646_0119405 3300046680 Bacteria 1493
1059 Ga0495647_0002436 3300046681 Bacteria 5863
1060 Ga0495647_0010626 3300046681 Bacteria 3138
1061 Ga0495647_0019267 3300046681 Bacteria 2438
1062 Ga0495647_0074495 3300046681 Bacteria 1365
1063 Ga0495647_0081217 3300046681 Bacteria 1315
1064 Ga0495658_0000065 3300046683 Bacteria 52835
1065 Ga0495658_0008416 3300046683 Bacteria 5112
1066 Ga0495658_0066140 3300046683 Bacteria 2087
1067 Ga0495658_0365868 3300046683 Bacteria 917
1068 Ga0495613_0003480 3300046689 Bacteria 11777
1069 Ga0495613_0010328 3300046689 Bacteria 6934
1070 Ga0495613_0078788 3300046689 Unclassified 2396
1071 Ga0495613_0092005 3300046689 Bacteria 2196
1072 Ga0495613_0284765 3300046689 Bacteria 1147
1073 Ga0495624_0000235 3300046690 Bacteria 43165
1074 Ga0495624_0050807 3300046690 Plasmid 2625
1075 Ga0495624_0136811 3300046690 Bacteria 1501
1076 Ga0495670_0000199 3300046691 Bacteria 26898
1077 Ga0495670_0090418 3300046691 Bacteria 1566
1078 Ga0495671_0092637 3300046692 Bacteria 1479
1079 Ga0495671_0202048 3300046692 Bacteria 964
1080 Ga0495649_0015557 3300046694 Bacteria 4328
1081 Ga0495649_0152989 3300046694 Bacteria 1211
1082 Ga0495589_0021779 3300046794 Bacteria 3275
1083 Ga0495600_0012719 3300046809 Bacteria 5268
1084 Ga0495600_0015147 3300046809 Bacteria 4871
1085 Ga0495600_0030346 3300046809 Bacteria 3502
1086 Ga0495581_0000041 3300047315 Bacteria 46518
1087 Ga0495581_0022819 3300047315 Bacteria 3625
1088 Ga0495581_0024475 3300047315 Plasmid 3499
1089 Ga0495604_0007221 3300047317 Bacteria 8800
1090 Ga0495604_0056249 3300047317 Bacteria 3029
1091 Ga0495604_0070109 3300047317 Bacteria 2655
1092 Ga0495604_0086405 3300047317 Bacteria 2338
1093 Ga0495604_0106288 3300047317 Bacteria 2053
1094 Ga0495604_0203136 3300047317 Bacteria 1373
1095 Ga0495636_0046361 3300047318 Unclassified 1813
1096 Ga0495674_0001192 3300047319 Bacteria 25126
1097 Ga0495674_0028002 3300047319 Bacteria 5145
1098 Ga0495674_0047281 3300047319 Bacteria 3816
1099 Ga0495674_0051263 3300047319 Bacteria 3638
1100 Ga0495674_0320433 3300047319 Bacteria 1263
1101 Ga0495674_0326857 3300047319 Bacteria 1248
1102 Ga0495672_0037589 3300047320 Bacteria 2960
1103 Ga0495676_0018550 3300047321 Bacteria 6135
1104 Ga0495676_0100156 3300047321 Bacteria 2146
1105 Ga0495676_0403146 3300047321 Bacteria 907
1106 Ga0495680_0012071 3300047322 Bacteria 7622
1107 Ga0495680_0017326 3300047322 Bacteria 6156
1108 Ga0495680_0017765 3300047322 Bacteria 6056
1109 Ga0495680_0043618 3300047322 Bacteria 3549
1110 Ga0495687_050067 3300047443 Bacteria 1782
1111 Ga0495675_0040948 3300047444 Bacteria 2952
1112 Ga0495675_0152222 3300047444 Unclassified 1428
1113 Ga0495679_028585 3300047446 Unclassified 1828
1114 Ga0495673_0010425 3300047469 Bacteria 5053
1115 Ga0495673_0025589 3300047469 Bacteria 2830
1116 Ga0495684_0001073 3300047471 Bacteria 22129
1117 Ga0495684_0001399 3300047471 Bacteria 19329
1118 Ga0495684_0039273 3300047471 Bacteria 3628
1119 Ga0495684_0052644 3300047471 Bacteria 3106
1120 Ga0495684_0075698 3300047471 Bacteria 2557
1121 Ga0495684_0116868 3300047471 Unclassified 2011
1122 Ga0495686_0060885 3300047472 Bacteria 2346
1123 Ga0495686_0062790 3300047472 Bacteria 2303
1124 Ga0495686_0085485 3300047472 Bacteria 1921
1125 Ga0495686_0136095 3300047472 Bacteria 1453
1126 Ga0495686_0237214 3300047472 Bacteria 1030
1127 Ga0495593_0000024 3300047673 Bacteria 65718
1128 Ga0495593_0002018 3300047673 Bacteria 12102
1129 Ga0495593_0003557 3300047673 Bacteria 9320
1130 Ga0495593_0004938 3300047673 Bacteria 7905
1131 Ga0495593_0052823 3300047673 Bacteria 2146
1132 Ga0495593_0055700 3300047673 Bacteria 2080
1133 Ga0495602_0019419 3300048088 Bacteria 6748
1134 Ga0495602_0027637 3300048088 Bacteria 5449
1135 Ga0495602_0035012 3300048088 Bacteria 4687
1136 Ga0495602_0085186 3300048088 Bacteria 2642
1137 Ga0495614_0059008 3300048089 Bacteria 1648
1138 Ga0495615_0051171 3300048090 Bacteria 1064
1139 Ga0496100_0071720 3300048903 Bacteria 2313
1140 Ga0496101_0005706 3300048904 Bacteria 7948
1141 Ga0496101_0017665 3300048904 Bacteria 4839
1142 Ga0496101_0046113 3300048904 Plasmid 3125
1143 Ga0496101_0106497 3300048904 Bacteria 2105
1144 Ga0496101_0173978 3300048904 Bacteria 1655
1145 Ga0496101_0417516 3300048904 Bacteria 1057
1146 Ga0496102_0014041 3300048905 Bacteria 6955
1147 Ga0496102_0017084 3300048905 Bacteria 6351
1148 Ga0496102_0022366 3300048905 Bacteria 5601
1149 Ga0496102_0067126 3300048905 Bacteria 3289
1150 Ga0496102_0244050 3300048905 Bacteria 1694
1151 Ga0496103_0013626 3300048906 Bacteria 4823
1152 Ga0496103_0037032 3300048906 Bacteria 2989
1153 Ga0496103_0155467 3300048906 Bacteria 1466
1154 Ga0496103_0176854 3300048906 Bacteria 1371
1155 Ga0496103_0199908 3300048906 Bacteria 1285
1156 Ga0496104_0007787 3300048907 Bacteria 9493
1157 Ga0496104_0037009 3300048907 Bacteria 4563
1158 Ga0496104_0065417 3300048907 Bacteria 3450
1159 Ga0496104_0088068 3300048907 Bacteria 2965
1160 Ga0496104_0182742 3300048907 Bacteria 2007
1161 Ga0496104_0186109 3300048907 Bacteria 1987
1162 Ga0496104_0187277 3300048907 Bacteria 1980
1163 Ga0496104_0303283 3300048907 Bacteria 1509
1164 Ga0496104_0322350 3300048907 Bacteria 1458
1165 Ga0496104_0362524 3300048907 Bacteria 1362
1166 Ga0496105_0011205 3300048908 Bacteria 7074
1167 Ga0496105_0013422 3300048908 Bacteria 6502
1168 Ga0496105_0015800 3300048908 Bacteria 6022
1169 Ga0496105_0019532 3300048908 Bacteria 5467
1170 Ga0496105_0034013 3300048908 Bacteria 4190
1171 Ga0496105_0062282 3300048908 Bacteria 3078
1172 Ga0496105_0175327 3300048908 Bacteria 1756
1173 Ga0496105_0291129 3300048908 Unclassified 1314
1174 Ga0496106_0003446 3300048909 Bacteria 11782
1175 Ga0496106_0006865 3300048909 Bacteria 8425
1176 Ga0496106_0007383 3300048909 Bacteria 8123
1177 Ga0496106_0017314 3300048909 Bacteria 5335
1178 Ga0496106_0031297 3300048909 Bacteria 3964
1179 Ga0496106_0058706 3300048909 Bacteria 2913
1180 Ga0496106_0094631 3300048909 Bacteria 2310
1181 Ga0496106_0130932 3300048909 Bacteria 1967
1182 Ga0496106_0158517 3300048909 Bacteria 1789
1183 Ga0496107_0000509 3300048910 Bacteria 21565
1184 Ga0496107_0034178 3300048910 Bacteria 3640
1185 Ga0496107_0037811 3300048910 Bacteria 3464
1186 Ga0496107_0037820 3300048910 Bacteria 3464
1187 Ga0496108_0039234 3300048911 Bacteria 3948
1188 Ga0496108_0070491 3300048911 Bacteria 2950
1189 Ga0496108_0101833 3300048911 Bacteria 2450
1190 Ga0496108_0141329 3300048911 Bacteria 2074
1191 Ga0496108_0159941 3300048911 Bacteria 1946
1192 Ga0496109_0020639 3300048912 Bacteria 5820
1193 Ga0496109_0051292 3300048912 Bacteria 3758
1194 Ga0496109_0074608 3300048912 Bacteria 3118
1195 Ga0496109_0082674 3300048912 Bacteria 2960
1196 Ga0496109_0086401 3300048912 Plasmid 2896
1197 Ga0496109_0327342 3300048912 Bacteria 1446
1198 Ga0496110_0003123 3300048913 Bacteria 12580
1199 Ga0496110_0005741 3300048913 Bacteria 9749
1200 Ga0496110_0091790 3300048913 Bacteria 2717
1201 Ga0496110_0159652 3300048913 Bacteria 2043
1202 Ga0496110_0321195 3300048913 Bacteria 1410
1203 Ga0496110_0337214 3300048913 Bacteria 1373
1204 Ga0496111_0034236 3300048914 Bacteria 3626
1205 Ga0496111_0039373 3300048914 Plasmid 3388
1206 Ga0496111_0042463 3300048914 Bacteria 3265
1207 Ga0496111_0173154 3300048914 Bacteria 1604
1208 Ga0496111_0256530 3300048914 Bacteria 1297
1209 Ga0496112_0012582 3300048915 Bacteria 7776
1210 Ga0496112_0024108 3300048915 Bacteria 5823
1211 Ga0496112_0064719 3300048915 Bacteria 3608
1212 Ga0496112_0126632 3300048915 Bacteria 2525
1213 Ga0496112_0178060 3300048915 Bacteria 2090
1214 Ga0496112_0186684 3300048915 Bacteria 2036
1215 Ga0496112_0188030 3300048915 Bacteria 2028
1216 Ga0496112_0287838 3300048915 Bacteria 1589
1217 Ga0496112_0417522 3300048915 Bacteria 1281
1218 Ga0496113_0041662 3300048916 Bacteria 3389
1219 Ga0496113_0055757 3300048916 Bacteria 2964
1220 Ga0496113_0066166 3300048916 Bacteria 2736
1221 Ga0496113_0102680 3300048916 Bacteria 2217
1222 Ga0496113_0156050 3300048916 Bacteria 1802
1223 Ga0496113_0222184 3300048916 Bacteria 1505
1224 Ga0496113_0316048 3300048916 Unclassified 1251
1225 Ga0496114_0001306 3300048917 Bacteria 18867
1226 Ga0496114_0022402 3300048917 Bacteria 5149
1227 Ga0496114_0084963 3300048917 Bacteria 2680
1228 Ga0496114_0198573 3300048917 Bacteria 1756
1229 Ga0496114_0371093 3300048917 Bacteria 1266
1230 Ga0496115_0001250 3300048918 Bacteria 18240
1231 Ga0496115_0023466 3300048918 Bacteria 4788
1232 Ga0496115_0056055 3300048918 Bacteria 3167
1233 Ga0496115_0098174 3300048918 Unclassified 2398
1234 Ga0496115_0116508 3300048918 Bacteria 2197
1235 Ga0496115_0146012 3300048918 Bacteria 1952
1236 Ga0496115_0179206 3300048918 Bacteria 1752
1237 Ga0496117_0017488 3300048920 Bacteria 5986
1238 Ga0496117_0062933 3300048920 Bacteria 2539
1239 Ga0496118_0020990 3300048921 Bacteria 5768
1240 Ga0496118_0039136 3300048921 Bacteria 3788
1241 Ga0496118_0077455 3300048921 Bacteria 2358
1242 Ga0496118_0251433 3300048921 Bacteria 1004
1243 Ga0496119_0040669 3300048922 Bacteria 2970
1244 Ga0496119_0042593 3300048922 Bacteria 2877
1245 Ga0496119_0057347 3300048922 Bacteria 2353
1246 Ga0496119_0099423 3300048922 Bacteria 1636
1247 Ga0496119_0138407 3300048922 Unclassified 1318
1248 Ga0496120_0013345 3300048923 Bacteria 5538
1249 Ga0496121_0000927 3300048924 Bacteria 53016
1250 Ga0496121_0007064 3300048924 Bacteria 13633
1251 Ga0496121_0010667 3300048924 Bacteria 10315
1252 Ga0496121_0015737 3300048924 Bacteria 7882
1253 Ga0496121_0061566 3300048924 Bacteria 3079
1254 Ga0496121_0155804 3300048924 Bacteria 1676
1255 Ga0496121_0205975 3300048924 Bacteria 1397
1256 Ga0496121_0209073 3300048924 Bacteria 1384
1257 Ga0496121_0256326 3300048924 Bacteria 1210
1258 Ga0496124_0049273 3300048927 Bacteria 3594
1259 Ga0496124_0058635 3300048927 Bacteria 3237
1260 Ga0496124_0061641 3300048927 Bacteria 3143
1261 Ga0496124_0240865 3300048927 Bacteria 1345
1262 Ga0496125_0042169 3300048928 Bacteria 3891
1263 Ga0496125_0063623 3300048928 Bacteria 2940
1264 Ga0496125_0121414 3300048928 Bacteria 1863
1265 Ga0496125_0304141 3300048928 Bacteria 975
1266 Ga0496126_0022004 3300048929 Bacteria 6214
1267 Ga0496126_0027336 3300048929 Bacteria 5451
1268 Ga0496126_0035592 3300048929 Bacteria 4665
1269 Ga0496126_0103819 3300048929 Bacteria 2483
1270 Ga0496126_0135129 3300048929 Bacteria 2128
1271 Ga0496126_0135967 3300048929 Bacteria 2120
1272 Ga0496126_0202331 3300048929 Bacteria 1676
1273 Ga0496126_0232203 3300048929 Bacteria 1545
1274 Ga0496126_0234965 3300048929 Bacteria 1534
1275 Ga0496126_0350508 3300048929 Bacteria 1207
1276 Ga0496126_0398398 3300048929 Bacteria 1117
1277 Ga0495682_0019019 3300049460 Bacteria 2585
1278 Ga0495682_0052153 3300049460 Bacteria 1487
1279 Ga0501031_0000398 3300049568 Bacteria 25392
1280 Ga0501031_0006934 3300049568 Bacteria 7396
1281 Ga0501031_0031248 3300049568 Bacteria 3473
1282 Ga0501032_0066313 3300049569 Bacteria 2412
1283 Ga0501032_0073505 3300049569 Bacteria 2277
1284 Ga0501032_0098657 3300049569 Bacteria 1935
1285 Ga0501033_0001316 3300049570 Bacteria 22076
1286 Ga0501033_0001463 3300049570 Bacteria 20932
1287 Ga0501033_0016180 3300049570 Bacteria 5648
1288 Ga0501033_0026599 3300049570 Bacteria 4352
1289 Ga0501033_0027952 3300049570 Bacteria 4239
1290 Ga0501033_0178464 3300049570 Bacteria 1523
1291 Ga0501033_0209494 3300049570 Bacteria 1390
1292 Ga0501034_0000072 3300049571 Bacteria 179824
1293 Ga0501034_0186662 3300049571 Bacteria 2036
1294 Ga0501034_0199578 3300049571 Bacteria 1959
1295 Ga0501034_0214716 3300049571 Bacteria 1878
1296 Ga0501034_0254182 3300049571 Bacteria 1701
1297 Ga0501034_0631845 3300049571 Bacteria 974
1298 Ga0501036_0000050 3300049572 Bacteria 75340
1299 Ga0501036_0023850 3300049572 Bacteria 5155
1300 Ga0501036_0027119 3300049572 Bacteria 4839
1301 Ga0501036_0109654 3300049572 Bacteria 2332
1302 Ga0501036_0220338 3300049572 Bacteria 1593
1303 Ga0501036_0253779 3300049572 Bacteria 1473
1304 Ga0501037_0000030 3300049573 Bacteria 136148
1305 Ga0501037_0019157 3300049573 Bacteria 5043
1306 Ga0501037_0040958 3300049573 Bacteria 3408
1307 Ga0501037_0067050 3300049573 Bacteria 2613
1308 Ga0501037_0158463 3300049573 Bacteria 1615
1309 Ga0501037_0196762 3300049573 Bacteria 1425
1310 Ga0501038_0000039 3300049574 Bacteria 122904
1311 Ga0501038_0003573 3300049574 Bacteria 14467
1312 Ga0501038_0003903 3300049574 Bacteria 13865
1313 Ga0501038_0019522 3300049574 Bacteria 6108
1314 Ga0501038_0064610 3300049574 Bacteria 3120
1315 Ga0501038_0087612 3300049574 Bacteria 2614
1316 Ga0501038_0120846 3300049574 Bacteria 2160
1317 Ga0501038_0179009 3300049574 Bacteria 1712
1318 Ga0501039_0000060 3300049575 Bacteria 85528
1319 Ga0501039_0003437 3300049575 Bacteria 11824
1320 Ga0501039_0006389 3300049575 Bacteria 8954
1321 Ga0501039_0049810 3300049575 Bacteria 3239
1322 Ga0501039_0069222 3300049575 Bacteria 2740
1323 Ga0501039_0120324 3300049575 Bacteria 2057
1324 Ga0501039_0170764 3300049575 Bacteria 1709
1325 Ga0501042_0008343 3300049578 Bacteria 6831
1326 Ga0501042_0040413 3300049578 Bacteria 3316
1327 Ga0501043_0000980 3300049579 Bacteria 25248
1328 Ga0501043_0003512 3300049579 Bacteria 12893
1329 Ga0501043_0015596 3300049579 Bacteria 5955
1330 Ga0501043_0112845 3300049579 Bacteria 2134
1331 Ga0501046_0000419 3300049580 Bacteria 42326
1332 Ga0501046_0002900 3300049580 Bacteria 15897
1333 Ga0501046_0022009 3300049580 Bacteria 5254
1334 Ga0501047_0000174 3300049581 Bacteria 79021
1335 Ga0501047_0012410 3300049581 Bacteria 8065
1336 Ga0501047_0019117 3300049581 Bacteria 6573
1337 Ga0501047_0031187 3300049581 Bacteria 5141
1338 Ga0501047_0172472 3300049581 Bacteria 2031
1339 Ga0501047_0181618 3300049581 Bacteria 1970
1340 Ga0501047_0316665 3300049581 Bacteria 1400
1341 Ga0501048_0000068 3300049582 Bacteria 53016
1342 Ga0501048_0017640 3300049582 Bacteria 5254
1343 Ga0501048_0323580 3300049582 Bacteria 1098
1344 Ga0501067_0000068 3300049583 Bacteria 59338
1345 Ga0501067_0003637 3300049583 Bacteria 8493
1346 Ga0501067_0007709 3300049583 Bacteria 5987
1347 Ga0501067_0111382 3300049583 Bacteria 1522
1348 Ga0501067_0131537 3300049583 Bacteria 1393
1349 Ga0501068_0000949 3300049584 Bacteria 15209
1350 Ga0501068_0002589 3300049584 Bacteria 9588
1351 Ga0501068_0003549 3300049584 Bacteria 8427
1352 Ga0501069_0035352 3300049585 Bacteria 2752
1353 Ga0501070_0025353 3300049586 Bacteria 4973
1354 Ga0501070_0039676 3300049586 Bacteria 3925
1355 Ga0501070_0256961 3300049586 Bacteria 1428
1356 Ga0501071_0131428 3300049587 Bacteria 1860
1357 Ga0501072_0035557 3300049588 Bacteria 3902
1358 Ga0501072_0221508 3300049588 Bacteria 1508
1359 Ga0501073_0000009 3300049589 Bacteria 195649
1360 Ga0501073_0010592 3300049589 Bacteria 6745
1361 Ga0501073_0162995 3300049589 Bacteria 1544
1362 Ga0501073_0450101 3300049589 Bacteria 890
1363 Ga0501074_0001057 3300049590 Bacteria 17986
1364 Ga0501074_0003293 3300049590 Bacteria 11426
1365 Ga0501074_0055835 3300049590 Bacteria 2845
1366 Ga0501077_0028394 3300049593 Bacteria 3556
1367 Ga0501079_0012968 3300049741 Bacteria 6357
1368 Ga0501079_0017176 3300049741 Bacteria 5525
1369 Ga0501079_0040305 3300049741 Bacteria 3602
1370 Ga0501080_0006205 3300049742 Bacteria 10727
1371 Ga0501080_0032682 3300049742 Bacteria 4854
1372 Ga0501080_0037424 3300049742 Bacteria 4532
1373 Ga0501080_0245242 3300049742 Bacteria 1634
1374 Ga0501080_0245636 3300049742 Bacteria 1633
1375 Ga0501083_0005994 3300049744 Bacteria 8609
1376 Ga0501083_0021673 3300049744 Bacteria 4462
1377 Ga0501083_0058662 3300049744 Bacteria 2575
1378 Ga0501035_0000067 3300049822 Bacteria 129204
1379 Ga0501035_0006796 3300049822 Bacteria 10687
1380 Ga0501035_0031489 3300049822 Bacteria 4830
1381 Ga0501035_0054807 3300049822 Bacteria 3561
1382 Ga0501035_0072940 3300049822 Bacteria 3037
1383 Ga0501035_0074309 3300049822 Bacteria 3007
1384 Ga0501035_0106024 3300049822 Bacteria 2464
1385 Ga0501035_0212386 3300049822 Bacteria 1655
1386 Ga0501035_0452169 3300049822 Bacteria 1062
1387 Ga0501044_0000258 3300049823 Bacteria 67161
1388 Ga0501044_0003604 3300049823 Bacteria 17424
1389 Ga0501044_0007503 3300049823 Bacteria 11997
1390 Ga0501044_0009609 3300049823 Bacteria 10525
1391 Ga0501044_0032713 3300049823 Bacteria 5466
1392 Ga0501044_0066602 3300049823 Bacteria 3671
1393 Ga0501044_0119538 3300049823 Bacteria 2637
1394 Ga0501044_0141974 3300049823 Bacteria 2390
1395 Ga0501044_0274006 3300049823 Bacteria 1622
1396 Ga0501044_0293875 3300049823 Bacteria 1555
1397 Ga0501044_0620766 3300049823 Bacteria 972
1398 Ga0501045_0012008 3300049824 Bacteria 6088
1399 Ga0501045_0043356 3300049824 Bacteria 3276
1400 nmdc:mga03n38_71327_c1 3300050490 Bacteria 1608
1401 nmdc:mga00v17_50262_c1 3300050491 Bacteria 2532
1402 nmdc:mga00v17_59291_c1 3300050491 Bacteria 2348
1403 nmdc:mga0yw44_100540_c1 3300050492 Bacteria 1842
1404 nmdc:mga0yw44_31880_c1 3300050492 Bacteria 3068
1405 nmdc:mga0yw44_47176_c1 3300050492 Bacteria 2591
1406 nmdc:mga0yw44_87286_c1 3300050492 Bacteria 1966
1407 nmdc:mga0k408_41185_c1 3300050493 Bacteria 2659
1408 nmdc:mga06z11_33296_c1 3300050494 Bacteria 2520
1409 nmdc:mga04h51_105902_c1 3300050495 Bacteria 1031
1410 nmdc:mga07m45_16224_c2 3300050496 Bacteria 3562
1411 nmdc:mga05p37_151_c1 3300050507 Bacteria 65585
1412 nmdc:mga05p37_296846_c1 3300050507 Bacteria 1921
1413 nmdc:mga05p37_563132_c1 3300050507 Bacteria 1294
1414 nmdc:mga05p37_7272_c1 3300050507 Bacteria 13063
1415 nmdc:mga0qj67_9689_c1 3300050509 Bacteria 7175
1416 nmdc:mga06r32_755_c1 3300050510 Bacteria 28474
1417 nmdc:mga08y16_108_c1 3300050511 Bacteria 69804
1418 nmdc:mga08y16_2951_c1 3300050511 Bacteria 17524
1419 nmdc:mga0n895_24865_c1 3300050512 Bacteria 5650
1420 nmdc:mga0n895_25991_c1 3300050512 Bacteria 5538
1421 nmdc:mga0n895_265_c1 3300050512 Bacteria 34107
1422 nmdc:mga0n895_37633_c1 3300050512 Bacteria 4682
1423 nmdc:mga0rr50_12610_c1 3300050513 Bacteria 5471
1424 nmdc:mga0rr50_19659_c1 3300050513 Bacteria 4565
1425 nmdc:mga0rr50_642_c1 3300050513 Bacteria 18790
1426 nmdc:mga0a205_1049_c1 3300050515 Bacteria 23004
1427 nmdc:mga0a205_146_c1 3300050515 Bacteria 45616
1428 nmdc:mga0a205_21581_c1 3300050515 Bacteria 6090
1429 nmdc:mga0sz30_34108_c1 3300050516 Bacteria 2118
1430 nmdc:mga0sz30_40712_c2 3300050516 Bacteria 1239
1431 Ga0495601_0000355 3300053077 Bacteria 24059
1432 Ga0495601_0009169 3300053077 Bacteria 5846
1433 Ga0495601_0017539 3300053077 Bacteria 4347
1434 Ga0495601_0033848 3300053077 Bacteria 3184
1435 Ga0495601_0050959 3300053077 Bacteria 2612
1436 Ga0495601_0083171 3300053077 Bacteria 2055
1437 Ga0495601_0107560 3300053077 Bacteria 1804
1438 Ga0495601_0163327 3300053077 Bacteria 1455
1439 Ga0495601_0188965 3300053077 Bacteria 1346
1440 Ga0495601_0199885 3300053077 Bacteria 1306
1441 Ga0495612_0001097 3300053078 Bacteria 11083
1442 Ga0495612_0007774 3300053078 Bacteria 4376
1443 Ga0495612_0040958 3300053078 Unclassified 1888
1444 Ga0495612_0078568 3300053078 Bacteria 1384
1445 Ga0500635_0001974 3300053080 Bacteria 5009
1446 Ga0500635_0002613 3300053080 Bacteria 4479
1447 Ga0495655_0009734 3300053083 Bacteria 1874
1448 Ga0495595_0000554 3300053084 Bacteria 14279
1449 Ga0495595_0000637 3300053084 Bacteria 13319
1450 Ga0495595_0001043 3300053084 Bacteria 10675
1451 Ga0495595_0002582 3300053084 Bacteria 7104
1452 Ga0495595_0064823 3300053084 Bacteria 1717
1453 Ga0495619_0000048 3300053085 Bacteria 102117
1454 Ga0495619_0000256 3300053085 Bacteria 38697
1455 Ga0495619_0001080 3300053085 Bacteria 17897
1456 Ga0495619_0001353 3300053085 Bacteria 16080
1457 Ga0495619_0005007 3300053085 Bacteria 8415
1458 Ga0495619_0014512 3300053085 Bacteria 4976
1459 Ga0495619_0197915 3300053085 Bacteria 1391
1460 Ga0495619_0219931 3300053085 Bacteria 1315
1461 Ga0500578_0065579 3300053086 Bacteria 2316
1462 Ga0500643_000013 3300053087 Bacteria 324296
1463 Ga0500583_0056480 3300053092 Bacteria 1839
1464 Ga0500651_0038749 3300053093 Bacteria 3002
1465 Ga0500566_0001419 3300053094 Bacteria 14035
1466 Ga0500566_0012672 3300053094 Bacteria 4960
1467 Ga0500640_000253 3300053095 Bacteria 11745
1468 Ga0500641_0031622 3300053096 Bacteria 2088
1469 Ga0500554_003440 3300053102 Bacteria 3242
1470 Ga0500555_006750 3300053103 Bacteria 3260
1471 Ga0500572_000199 3300053111 Bacteria 21285
1472 Ga0500595_000842 3300053119 Bacteria 17493
1473 Ga0500595_007617 3300053119 Bacteria 4482
1474 Ga0500595_033593 3300053119 Bacteria 1701
1475 Ga0500607_076874 3300053121 Bacteria 1710
1476 Ga0500608_103967 3300053122 Bacteria 1312
1477 Ga0500614_000715 3300053123 Bacteria 8481
1478 Ga0500642_0020937 3300053130 Bacteria 2580
1479 Ga0500658_0011386 3300053134 Bacteria 3278
1480 Ga0500559_0001308 3300053136 Bacteria 14372
1481 Ga0500568_0014785 3300053139 Bacteria 3512
1482 Ga0500573_0008543 3300053140 Bacteria 5644
1483 Ga0500577_0109173 3300053142 Unclassified 1140
1484 Ga0500603_000226 3300053150 Bacteria 14827
1485 Ga0500604_0018512 3300053151 Bacteria 1941
1486 Ga0500616_0000028 3300053153 Bacteria 435722
1487 Ga0500619_072092 3300053154 Bacteria 1151
1488 Ga0500620_032573 3300053155 Bacteria 1660
1489 Ga0500627_0162643 3300053158 Bacteria 1007
1490 Ga0500630_000573 3300053159 Bacteria 16713
1491 Ga0500638_001609 3300053162 Bacteria 7251
1492 Ga0500639_000006 3300053163 Bacteria 165068
1493 Ga0500636_0000762 3300053177 Bacteria 17368
1494 Ga0500636_0013138 3300053177 Bacteria 4858
1495 Ga0500636_0030340 3300053177 Bacteria 3197
1496 Ga0500637_0000251 3300053178 Bacteria 19903
1497 Ga0500637_0003349 3300053178 Bacteria 7387
1498 Ga0500637_0187265 3300053178 Bacteria 1183
1499 Ga0500576_083610 3300053725 Bacteria 1342
1500 Ga0500657_054402 3300053728 Unclassified 1813
1501 Ga0500596_000603 3300053735 Bacteria 6894
1502 Ga0500596_011896 3300053735 Bacteria 1326
1503 Ga0500599_003944 3300053736 Bacteria 1823
1504 Ga0500601_000371 3300053737 Bacteria 8090
1505 Ga0501084_0006839 3300054114 Bacteria 9387
1506 Ga0501084_0007774 3300054114 Bacteria 8822
1507 Ga0501084_0034119 3300054114 Bacteria 4255
1508 Ga0501084_0354426 3300054114 Bacteria 1239
1509 Ga0500661_001477 3300055283 Bacteria 4413
1510 Ga0501082_0001593 3300060353 Bacteria 20008
1511 Ga0501082_0018224 3300060353 Bacteria 6044
1512 Ga0501082_0050188 3300060353 Bacteria 3598
1513 Ga0501082_0107881 3300060353 Bacteria 2409
1514 Ga0501082_0344249 3300060353 Bacteria 1299

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300020082 Ga0206353_10342907 Ga0206353_103429072 238
2 3300035086 Ga0373934_0084179 Ga0373934_0084179_552_1268 238
3 3300049571 Ga0501034_0631845 Ga0501034_0631845_48_809 252
4 3300049822 Ga0501035_0452169 Ga0501035_0452169_40_801 252
5 3300045049 Ga0466959_0058009 Ga0466959_0058009_227_1105 253
6 3300005614 Ga0068856_100000781 Ga0068856_1000007816 258
7 3300025939 Ga0207665_10267556 Ga0207665_102675561 258
8 3300026078 Ga0207702_10000758 Ga0207702_1000075822 258
9 3300046523 Ga0495644_0050156 Ga0495644_0050156_101_943 259
10 3300046664 Ga0495659_0122405 Ga0495659_0122405_29_871 259
11 3300006358 Ga0068871_100057668 Ga0068871_1000576681 265
12 3300009101 Ga0105247_10034936 Ga0105247_100349361 265
13 3300025900 Ga0207710_10002730 Ga0207710_100027307 265
14 3300048924 Ga0496121_0205975 Ga0496121_0205975_266_1156 265
15 3300048929 Ga0496126_0035592 Ga0496126_0035592_3450_4340 265
16 3300006028 Ga0070717_10395519 Ga0070717_103955192 267
17 3300025907 Ga0207645_10064570 Ga0207645_100645701 267
18 3300025926 Ga0207659_10216169 Ga0207659_102161692 267
19 3300035172 Ga0373955_0323138 Ga0373955_0323138_109_918 267
20 3300044684 Ga0466966_0001614 Ga0466966_0001614_11449_12258 268
21 3300044693 Ga0466961_0000192 Ga0466961_0000192_11952_12761 268
22 3300044706 Ga0466964_0025350 Ga0466964_0025350_365_1174 268
23 3300045049 Ga0466959_0000934 Ga0466959_0000934_12023_12832 268
24 3300046462 Ga0495651_0017171 Ga0495651_0017171_413_1222 268
25 3300047472 Ga0495686_0062790 Ga0495686_0062790_1007_1816 268
26 3300047472 Ga0495686_0237214 Ga0495686_0237214_132_941 268
27 3300050492 nmdc:mga0yw44_31880_c1 nmdc:mga0yw44_31880_c1_1667_2476 268
28 3300053086 Ga0500578_0065579 Ga0500578_0065579_1308_2117 268
29 3300053087 Ga0500643_000013 Ga0500643_000013_194937_195746 268
30 3300053154 Ga0500619_072092 Ga0500619_072092_29_838 268
31 3300031616 Ga0307508_10175540 Ga0307508_101755402 269
32 3300048924 Ga0496121_0000927 Ga0496121_0000927_48442_49284 269
33 3300053119 Ga0500595_007617 Ga0500595_007617_1948_2790 269
34 3300009098 Ga0105245_10062438 Ga0105245_100624383 270
35 3300021388 Ga0213875_10003786 Ga0213875_100037867 271
36 3300037853 Ga0436364_1119586 Ga0436364_1119586_12557_13378 271
37 iso_pu_bacteria 2643221651 2644289771 271
38 3300031241 Ga0265325_10003263 Ga0265325_100032636 272
39 3300031249 Ga0265339_10001912 Ga0265339_100019125 272
40 3300031344 Ga0265316_10067912 Ga0265316_100679123 272
41 3300031595 Ga0265313_10019302 Ga0265313_100193022 272
42 3300035725 Ga0373947_0225609 Ga0373947_0225609_126_959 272
43 iso_pu_bacteria 2507262055 2507511877 272
44 iso_pu_bacteria 2508501042 2508694359 272
45 iso_pu_bacteria 2513237095 2513651094 272
46 iso_pu_bacteria 2513237104 2513717791 272
47 iso_pu_bacteria 2515154112 2515624710 272
48 iso_pu_bacteria 2816332527 2818242190 272
49 iso_pu_bacteria 2824704595 2824712400 272
50 iso_pu_bacteria 2824753945 2824762426 272
51 iso_pu_bacteria 2824763712 2824772739 272
52 iso_pu_bacteria 2841957949 2841960960 272
53 iso_pu_bacteria 2847930680 2847932305 272
54 iso_pu_bacteria 2874590934 2874592257 272
55 iso_pu_bacteria 2874645413 2874647373 272
56 iso_pu_bacteria 2876761206 2876767415 272
57 iso_pu_bacteria 2876771140 2876774784 272
58 iso_pu_bacteria 2876818435 2876819737 272
59 iso_pu_bacteria 2879074833 2879079352 272
60 iso_pu_bacteria 2879083081 2879091530 272
61 iso_pu_bacteria 2879127579 2879129086 272
62 iso_pu_bacteria 2879142872 2879144759 272
63 iso_pu_bacteria 2888378607 2888387387 272
64 iso_pu_bacteria 2904711408 2904713672 272
65 iso_pu_bacteria 2906643746 2906645374 272
66 iso_pu_bacteria 2922361189 2922367287 272
67 iso_pu_bacteria 2935608549 2935613480 272
68 iso_pu_bacteria 2935648319 2935650476 272
69 iso_pu_bacteria 2935656913 2935662918 272
70 iso_pu_bacteria 2935819856 2935824667 272
71 iso_pu_bacteria 2935847175 2935851887 272
72 iso_pu_bacteria 2935908558 2935911237 272
73 iso_pu_bacteria 2935916978 2935920769 272
74 iso_pu_bacteria 2935926038 2935928266 272
75 iso_pu_bacteria 2935934488 2935937911 272
76 iso_pu_bacteria 2935942939 2935945193 272
77 iso_pu_bacteria 2935951376 2935954301 272
78 iso_pu_bacteria 2935967501 2935971431 272
79 iso_pu_bacteria 2935975950 2935982051 272
80 iso_pu_bacteria 2935984226 2935990610 272
81 iso_pu_bacteria 2936011229 2936017168 272
82 iso_pu_bacteria 2936019824 2936026697 272
83 iso_pu_bacteria 2936028420 2936035440 272
84 iso_pu_bacteria 2936046547 2936053589 272
85 iso_pu_bacteria 2936055302 2936062667 272
86 iso_pu_bacteria 2941531003 2941537270 272
87 iso_pu_bacteria 8016630954 8016637185 272
88 iso_pu_bacteria 8019619141 8019624150 272
89 iso_pu_bacteria 8019659431 8019665806 272
90 iso_pu_bacteria 8019668869 8019675332 272
91 iso_pu_bacteria 8019678201 8019680772 272
92 iso_pu_bacteria 8019687851 8019694995 272
93 3300005338 Ga0068868_100208673 Ga0068868_1002086732 273
94 3300013307 Ga0157372_10214288 Ga0157372_102142882 273
95 3300025939 Ga0207665_10196496 Ga0207665_101964961 273
96 3300033180 Ga0307510_10152035 Ga0307510_101520351 273
97 3300035170 Ga0373943_0214025 Ga0373943_0214025_51_992 273
98 3300035692 Ga0373935_0051264 Ga0373935_0051264_868_1809 273
99 3300035695 Ga0373927_0297623 Ga0373927_0297623_109_1050 273
100 3300035725 Ga0373947_0067145 Ga0373947_0067145_325_1266 273
101 3300048928 Ga0496125_0304141 Ga0496125_0304141_51_884 273
102 iso_pu_bacteria 2508501009 2508545541 273
103 iso_pu_bacteria 2508501128 2509146623 273
104 iso_pu_bacteria 2513237092 2513627760 273
105 iso_pu_bacteria 2513237094 2513643305 273
106 iso_pu_bacteria 2513237096 2513659238 273
107 iso_pu_bacteria 2513237137 2513859041 273
108 iso_pu_bacteria 2513237139 2513875299 273
109 iso_pu_bacteria 2513237145 2513921882 273
110 iso_pu_bacteria 2513237161 2514014405 273
111 iso_pu_bacteria 2517572143 2517895963 273
112 iso_pu_bacteria 2528768022 2528854956 273
113 iso_pu_bacteria 2617270741 2617376815 273
114 iso_pu_bacteria 2791355196 2793059632 273
115 iso_pu_bacteria 2802429603 2805921874 273
116 iso_pu_bacteria 2824600985 2824608016 273
117 iso_pu_bacteria 2824609381 2824615056 273
118 iso_pu_bacteria 2824617872 2824624849 273
119 iso_pu_bacteria 2824626560 2824633745 273
120 iso_pu_bacteria 2824635225 2824642308 273
121 iso_pu_bacteria 2824644064 2824649646 273
122 iso_pu_bacteria 2824653114 2824659530 273
123 iso_pu_bacteria 2824661429 2824670058 273
124 iso_pu_bacteria 2824671348 2824676704 273
125 iso_pu_bacteria 2824687955 2824692995 273
126 iso_pu_bacteria 2824696289 2824702578 273
127 iso_pu_bacteria 2824723954 2824730051 273
128 iso_pu_bacteria 2824732956 2824738292 273
129 iso_pu_bacteria 2824746037 2824751731 273
130 iso_pu_bacteria 2824773399 2824776990 273
131 iso_pu_bacteria 2838122688 2838128391 273
132 iso_pu_bacteria 2841941048 2841942251 273
133 iso_pu_bacteria 2841949485 2841955619 273
134 iso_pu_bacteria 2841966195 2841971228 273
135 iso_pu_bacteria 2841974524 2841982348 273
136 iso_pu_bacteria 2841983080 2841984265 273
137 iso_pu_bacteria 2842038055 2842042003 273
138 iso_pu_bacteria 2842045827 2842050046 273
139 iso_pu_bacteria 2844315083 2844321094 273
140 iso_pu_bacteria 2847939898 2847943540 273
141 iso_pu_bacteria 2849076700 2849077263 273
142 iso_pu_bacteria 2874612657 2874618720 273
143 iso_pu_bacteria 2874620515 2874624010 273
144 iso_pu_bacteria 2874628541 2874630982 273
145 iso_pu_bacteria 2879099564 2879101398 273
146 iso_pu_bacteria 2881364244 2881371130 273
147 iso_pu_bacteria 2881665667 2881673238 273
148 iso_pu_bacteria 2885366525 2885374060 273
149 iso_pu_bacteria 2885374607 2885382990 273
150 iso_pu_bacteria 2888388044 2888391816 273
151 iso_pu_bacteria 2888419890 2888426608 273
152 iso_pu_bacteria 2903727486 2903728517 273
153 iso_pu_bacteria 2903748898 2903756067 273
154 iso_pu_bacteria 2904666416 2904670721 273
155 iso_pu_bacteria 2904690495 2904699115 273
156 iso_pu_bacteria 2904699407 2904707118 273
157 iso_pu_bacteria 2906602504 2906607709 273
158 iso_pu_bacteria 2906626472 2906627114 273
159 iso_pu_bacteria 2906635258 2906642015 273
160 iso_pu_bacteria 2906660503 2906665001 273
161 iso_pu_bacteria 2908739725 2908745612 273
162 iso_pu_bacteria 2908775508 2908782713 273
163 iso_pu_bacteria 2922368715 2922370558 273
164 iso_pu_bacteria 2929615660 2929620134 273
165 iso_pu_bacteria 2929624759 2929629447 273
166 iso_pu_bacteria 2932784394 2932791489 273
167 iso_pu_bacteria 2932794094 2932796892 273
168 iso_pu_bacteria 2932801729 2932802330 273
169 iso_pu_bacteria 2932809354 2932816745 273
170 iso_pu_bacteria 2932818245 2932824073 273
171 iso_pu_bacteria 2932828146 2932835391 273
172 iso_pu_bacteria 2933577622 2933582051 273
173 iso_pu_bacteria 2935616580 2935621134 273
174 iso_pu_bacteria 2935638405 2935643559 273
175 iso_pu_bacteria 2935665750 2935671131 273
176 iso_pu_bacteria 2935675223 2935681263 273
177 iso_pu_bacteria 2935684952 2935689394 273
178 iso_pu_bacteria 2935694250 2935699969 273
179 iso_pu_bacteria 2935703347 2935712100 273
180 iso_pu_bacteria 2935713505 2935720340 273
181 iso_pu_bacteria 2935722832 2935728043 273
182 iso_pu_bacteria 2935732158 2935737360 273
183 iso_pu_bacteria 2935741537 2935746579 273
184 iso_pu_bacteria 2935750917 2935757546 273
185 iso_pu_bacteria 2935760218 2935763923 273
186 iso_pu_bacteria 2935801545 2935807900 273
187 iso_pu_bacteria 2935810662 2935818766 273
188 iso_pu_bacteria 2935827899 2935833076 273
189 iso_pu_bacteria 2935837841 2935844268 273
190 iso_pu_bacteria 2935855204 2935859673 273
191 iso_pu_bacteria 2935864058 2935872071 273
192 iso_pu_bacteria 2935873716 2935879005 273
193 iso_pu_bacteria 2935883170 2935887230 273
194 iso_pu_bacteria 2935959822 2935965620 273
195 iso_pu_bacteria 2935992306 2936000352 273
196 iso_pu_bacteria 2936002035 2936008510 273
197 iso_pu_bacteria 2936037263 2936045576 273
198 iso_pu_bacteria 2940556831 2940563632 273
199 iso_pu_bacteria 2941538514 2941542600 273
200 iso_pu_bacteria 3005474847 3005476600 273
201 iso_pu_bacteria 3005506211 3005506906 273
202 iso_pu_bacteria 3005587118 3005591713 273
203 iso_pu_bacteria 3005594810 3005601434 273
204 iso_pu_bacteria 3005718088 3005724125 273
205 iso_pu_bacteria 8006933436 8006934886 273
206 iso_pu_bacteria 8006973647 8006974854 273
207 iso_pu_bacteria 8016583857 8016588685 273
208 iso_pu_bacteria 8017057580 8017066034 273
209 iso_pu_bacteria 8019648815 8019653671 273
210 iso_pu_bacteria 8055742211 8055750113 273
211 iso_pu_bacteria 8056967851 8056975892 273
212 3300001989 JGI24739J22299_10025017 JGI24739J22299_100250172 274
213 3300003215 JGI25153J46596_10010025 JGI25153J46596_100100253 274
214 3300003354 JGI25160J50197_1003286 JGI25160J50197_10032865 274
215 3300003354 JGI25160J50197_1007225 JGI25160J50197_10072252 274
216 3300005262 Ga0065165_1002476 Ga0065165_100247615 274
217 3300005327 Ga0070658_10349485 Ga0070658_103494851 274
218 3300005328 Ga0070676_10086242 Ga0070676_100862423 274
219 3300005339 Ga0070660_100022278 Ga0070660_1000222785 274
220 3300005344 Ga0070661_100116508 Ga0070661_1001165083 274
221 3300005354 Ga0070675_100276160 Ga0070675_1002761602 274
222 3300005355 Ga0070671_100024253 Ga0070671_1000242536 274
223 3300005366 Ga0070659_100281140 Ga0070659_1002811402 274
224 3300005456 Ga0070678_100408231 Ga0070678_1004082312 274
225 3300005468 Ga0070707_100055777 Ga0070707_1000557772 274
226 3300005471 Ga0070698_100028359 Ga0070698_1000283593 274
227 3300005518 Ga0070699_100143856 Ga0070699_1001438562 274
228 3300005536 Ga0070697_100079996 Ga0070697_1000799963 274
229 3300005539 Ga0068853_100177249 Ga0068853_1001772493 274
230 3300005543 Ga0070672_100105181 Ga0070672_1001051812 274
231 3300005548 Ga0070665_100063185 Ga0070665_1000631852 274
232 3300005548 Ga0070665_100071799 Ga0070665_1000717995 274
233 3300005548 Ga0070665_100203035 Ga0070665_1002030352 274
234 3300005548 Ga0070665_100380649 Ga0070665_1003806492 274
235 3300005564 Ga0070664_100238256 Ga0070664_1002382562 274
236 3300005577 Ga0068857_100096073 Ga0068857_1000960733 274
237 3300005578 Ga0068854_100122052 Ga0068854_1001220522 274
238 3300005614 Ga0068856_100047838 Ga0068856_1000478384 274
239 3300005843 Ga0068860_100143296 Ga0068860_1001432963 274
240 3300006038 Ga0075365_10051949 Ga0075365_100519493 274
241 3300006038 Ga0075365_10065320 Ga0075365_100653201 274
242 3300006178 Ga0075367_10016061 Ga0075367_100160613 274
243 3300006178 Ga0075367_10026524 Ga0075367_100265242 274
244 3300006353 Ga0075370_10019677 Ga0075370_100196772 274
245 3300006941 Ga0099825_1036559 Ga0099825_10365591 274
246 3300006944 Ga0099823_1004051 Ga0099823_10040514 274
247 3300009147 Ga0114129_10364864 Ga0114129_103648642 274
248 3300010375 Ga0105239_10323551 Ga0105239_103235511 274
249 3300025261 Ga0209233_1005084 Ga0209233_10050841 274
250 3300025273 Ga0209673_1021558 Ga0209673_10215583 274
251 3300025295 Ga0209564_1008607 Ga0209564_10086072 274
252 3300025297 Ga0209758_1000986 Ga0209758_100098617 274
253 3300025302 Ga0207426_1000632 Ga0207426_10006327 274
254 3300025904 Ga0207647_10016893 Ga0207647_100168934 274
255 3300025914 Ga0207671_10041159 Ga0207671_100411592 274
256 3300025919 Ga0207657_10006857 Ga0207657_100068578 274
257 3300025922 Ga0207646_10112011 Ga0207646_101120113 274
258 3300025924 Ga0207694_10104378 Ga0207694_101043782 274
259 3300025926 Ga0207659_10169970 Ga0207659_101699702 274
260 3300025931 Ga0207644_10061984 Ga0207644_100619843 274
261 3300025932 Ga0207690_10253542 Ga0207690_102535422 274
262 3300025941 Ga0207711_10072335 Ga0207711_100723353 274
263 3300025945 Ga0207679_10267358 Ga0207679_102673582 274
264 3300025949 Ga0207667_10188431 Ga0207667_101884312 274
265 3300025981 Ga0207640_10066874 Ga0207640_100668742 274
266 3300025986 Ga0207658_10130939 Ga0207658_101309392 274
267 3300026023 Ga0207677_10124489 Ga0207677_101244892 274
268 3300026041 Ga0207639_10094435 Ga0207639_100944353 274
269 3300026041 Ga0207639_10261036 Ga0207639_102610362 274
270 3300026067 Ga0207678_10130307 Ga0207678_101303072 274
271 3300026067 Ga0207678_10261116 Ga0207678_102611162 274
272 3300026075 Ga0207708_10020931 Ga0207708_100209311 274
273 3300026078 Ga0207702_10065779 Ga0207702_100657793 274
274 3300026142 Ga0207698_10375299 Ga0207698_103752991 274
275 3300027296 Ga0209389_1000019 Ga0209389_100001966 274
276 3300027361 Ga0209489_100033 Ga0209489_10003365 274
277 3300027363 Ga0209700_100012 Ga0209700_100012303 274
278 3300028379 Ga0268266_10203354 Ga0268266_102033542 274
279 3300028381 Ga0268264_10146243 Ga0268264_101462432 274
280 3300031239 Ga0265328_10043351 Ga0265328_100433512 274
281 3300031824 Ga0307413_10038231 Ga0307413_100382311 274
282 3300031852 Ga0307410_10143559 Ga0307410_101435592 274
283 3300035725 Ga0373947_0078436 Ga0373947_0078436_783_1616 274
284 3300045976 Ga0466967_0094324 Ga0466967_0094324_83_916 274
285 3300046459 Ga0495629_0150450 Ga0495629_0150450_313_1146 274
286 3300046463 Ga0495653_0235853 Ga0495653_0235853_137_970 274
287 3300046524 Ga0495648_0000897 Ga0495648_0000897_15840_16673 274
288 3300046536 Ga0495587_0301376 Ga0495587_0301376_40_873 274
289 3300046660 Ga0495625_0066315 Ga0495625_0066315_1478_2320 274
290 3300046681 Ga0495647_0081217 Ga0495647_0081217_376_1209 274
291 3300047319 Ga0495674_0320433 Ga0495674_0320433_154_987 274
292 3300047319 Ga0495674_0326857 Ga0495674_0326857_62_895 274
293 3300048911 Ga0496108_0159941 Ga0496108_0159941_485_1318 274
294 3300048912 Ga0496109_0074608 Ga0496109_0074608_1824_2657 274
295 3300048929 Ga0496126_0103819 Ga0496126_0103819_653_1486 274
296 3300048929 Ga0496126_0350508 Ga0496126_0350508_309_1142 274
297 3300049742 Ga0501080_0245636 Ga0501080_0245636_413_1243 274
298 3300050491 nmdc:mga00v17_59291_c1 nmdc:mga00v17_59291_c1_608_1441 274
299 3300050492 nmdc:mga0yw44_47176_c1 nmdc:mga0yw44_47176_c1_243_1076 274
300 3300050492 nmdc:mga0yw44_87286_c1 nmdc:mga0yw44_87286_c1_146_979 274
301 3300050507 nmdc:mga05p37_296846_c1 nmdc:mga05p37_296846_c1_973_1806 274
302 3300050507 nmdc:mga05p37_563132_c1 nmdc:mga05p37_563132_c1_71_913 274
303 3300053158 Ga0500627_0162643 Ga0500627_0162643_135_968 274
304 3300060353 Ga0501082_0344249 Ga0501082_0344249_271_1101 274
305 iso_pu_bacteria 2513237141 2513887729 274
306 iso_pu_bacteria 2922425934 2922432439 274
307 iso_pu_bacteria 8016511872 8016519488 274
308 3300005327 Ga0070658_10142354 Ga0070658_101423541 275
309 3300005339 Ga0070660_100026453 Ga0070660_1000264535 275
310 3300005353 Ga0070669_100414063 Ga0070669_1004140632 275
311 3300005356 Ga0070674_100558009 Ga0070674_1005580091 275
312 3300005458 Ga0070681_10059728 Ga0070681_100597281 275
313 3300005530 Ga0070679_100009709 Ga0070679_1000097095 275
314 3300006048 Ga0075363_100065887 Ga0075363_1000658872 275
315 3300011119 Ga0105246_10332364 Ga0105246_103323641 275
316 3300013297 Ga0157378_10471250 Ga0157378_104712501 275
317 3300017792 Ga0163161_10135289 Ga0163161_101352893 275
318 3300025272 Ga0209455_1006888 Ga0209455_10068883 275
319 3300025912 Ga0207707_10372622 Ga0207707_103726221 275
320 3300025919 Ga0207657_10148090 Ga0207657_101480902 275
321 3300025923 Ga0207681_10156754 Ga0207681_101567542 275
322 3300025933 Ga0207706_10129804 Ga0207706_101298043 275
323 3300025972 Ga0207668_10085216 Ga0207668_100852163 275
324 3300026089 Ga0207648_10176768 Ga0207648_101767683 275
325 3300031247 Ga0265340_10018122 Ga0265340_100181222 275
326 3300035113 Ga0373936_0104471 Ga0373936_0104471_51_887 275
327 3300035114 Ga0373939_0069899 Ga0373939_0069899_13_849 275
328 3300035120 Ga0373957_0103774 Ga0373957_0103774_120_947 275
329 3300035695 Ga0373927_0148674 Ga0373927_0148674_419_1255 275
330 3300037068 Ga0373925_0120167 Ga0373925_0120167_1106_1942 275
331 3300046511 Ga0495608_0188827 Ga0495608_0188827_132_968 275
332 3300049570 Ga0501033_0026599 Ga0501033_0026599_1644_2489 275
333 3300049571 Ga0501034_0254182 Ga0501034_0254182_388_1233 275
334 3300049572 Ga0501036_0253779 Ga0501036_0253779_155_1000 275
335 3300049573 Ga0501037_0019157 Ga0501037_0019157_1103_1939 275
336 3300049574 Ga0501038_0064610 Ga0501038_0064610_146_991 275
337 3300049574 Ga0501038_0179009 Ga0501038_0179009_595_1425 275
338 3300049575 Ga0501039_0120324 Ga0501039_0120324_1024_1869 275
339 3300049579 Ga0501043_0112845 Ga0501043_0112845_482_1327 275
340 3300049581 Ga0501047_0019117 Ga0501047_0019117_1224_2054 275
341 3300049581 Ga0501047_0316665 Ga0501047_0316665_320_1165 275
342 3300049582 Ga0501048_0323580 Ga0501048_0323580_115_951 275
343 3300049583 Ga0501067_0003637 Ga0501067_0003637_1572_2408 275
344 3300049585 Ga0501069_0035352 Ga0501069_0035352_223_1059 275
345 3300049588 Ga0501072_0221508 Ga0501072_0221508_474_1319 275
346 3300049589 Ga0501073_0450101 Ga0501073_0450101_23_859 275
347 3300049590 Ga0501074_0003293 Ga0501074_0003293_135_971 275
348 3300049741 Ga0501079_0040305 Ga0501079_0040305_1295_2131 275
349 3300049742 Ga0501080_0245242 Ga0501080_0245242_285_1130 275
350 3300049822 Ga0501035_0106024 Ga0501035_0106024_442_1287 275
351 3300049822 Ga0501035_0212386 Ga0501035_0212386_680_1510 275
352 3300049823 Ga0501044_0119538 Ga0501044_0119538_588_1448 275
353 3300049823 Ga0501044_0274006 Ga0501044_0274006_113_943 275
354 3300049823 Ga0501044_0293875 Ga0501044_0293875_443_1288 275
355 3300049823 Ga0501044_0620766 Ga0501044_0620766_54_899 275
356 3300053077 Ga0495601_0050959 Ga0495601_0050959_1641_2477 275
357 3300054114 Ga0501084_0006839 Ga0501084_0006839_6443_7279 275
358 3300001989 JGI24739J22299_10008928 JGI24739J22299_100089281 276
359 3300003215 JGI25153J46596_10004620 JGI25153J46596_100046204 276
360 3300003215 JGI25153J46596_10005210 JGI25153J46596_100052104 276
361 3300003215 JGI25153J46596_10031215 JGI25153J46596_100312152 276
362 3300003794 Ga0055531_10010351 Ga0055531_100103515 276
363 3300003794 Ga0055531_10010606 Ga0055531_100106062 276
364 3300004625 Ga0055543_1008336 Ga0055543_10083362 276
365 3300005262 Ga0065165_1002846 Ga0065165_10028467 276
366 3300005262 Ga0065165_1025765 Ga0065165_10257652 276
367 3300005344 Ga0070661_100156226 Ga0070661_1001562262 276
368 3300005455 Ga0070663_100011845 Ga0070663_1000118455 276
369 3300005458 Ga0070681_10076670 Ga0070681_100766703 276
370 3300005530 Ga0070679_100173681 Ga0070679_1001736811 276
371 3300005535 Ga0070684_100092000 Ga0070684_1000920001 276
372 3300005539 Ga0068853_100045254 Ga0068853_1000452542 276
373 3300005539 Ga0068853_100097553 Ga0068853_1000975531 276
374 3300005548 Ga0070665_100080708 Ga0070665_1000807083 276
375 3300005548 Ga0070665_100428297 Ga0070665_1004282971 276
376 3300005563 Ga0068855_100019735 Ga0068855_1000197352 276
377 3300005563 Ga0068855_100125312 Ga0068855_1001253122 276
378 3300005563 Ga0068855_100259104 Ga0068855_1002591042 276
379 3300005563 Ga0068855_100454183 Ga0068855_1004541832 276
380 3300005563 Ga0068855_100739264 Ga0068855_1007392641 276
381 3300005577 Ga0068857_100003181 Ga0068857_1000031816 276
382 3300005578 Ga0068854_100030721 Ga0068854_1000307214 276
383 3300005614 Ga0068856_100322290 Ga0068856_1003222901 276
384 3300005616 Ga0068852_100028959 Ga0068852_1000289593 276
385 3300006038 Ga0075365_10046636 Ga0075365_100466363 276
386 3300009093 Ga0105240_10008946 Ga0105240_100089464 276
387 3300009093 Ga0105240_10029706 Ga0105240_100297062 276
388 3300009093 Ga0105240_10048624 Ga0105240_100486242 276
389 3300009098 Ga0105245_10154012 Ga0105245_101540121 276
390 3300009098 Ga0105245_10247473 Ga0105245_102474731 276
391 3300009101 Ga0105247_10056334 Ga0105247_100563343 276
392 3300009174 Ga0105241_10081747 Ga0105241_100817472 276
393 3300009176 Ga0105242_10803490 Ga0105242_108034901 276
394 3300009177 Ga0105248_10261174 Ga0105248_102611742 276
395 3300009545 Ga0105237_10019250 Ga0105237_100192504 276
396 3300009545 Ga0105237_10045568 Ga0105237_100455683 276
397 3300009545 Ga0105237_10470423 Ga0105237_104704231 276
398 3300009551 Ga0105238_10031611 Ga0105238_100316112 276
399 3300009551 Ga0105238_10040511 Ga0105238_100405112 276
400 3300009551 Ga0105238_10292182 Ga0105238_102921821 276
401 3300010375 Ga0105239_10053738 Ga0105239_100537383 276
402 3300010375 Ga0105239_10064549 Ga0105239_100645492 276
403 3300010375 Ga0105239_10168122 Ga0105239_101681222 276
404 3300010375 Ga0105239_10316055 Ga0105239_103160552 276
405 3300010375 Ga0105239_10826421 Ga0105239_108264212 276
406 3300011119 Ga0105246_10054989 Ga0105246_100549893 276
407 3300013105 Ga0157369_10008072 Ga0157369_100080722 276
408 3300013105 Ga0157369_10033594 Ga0157369_100335943 276
409 3300013105 Ga0157369_10777587 Ga0157369_107775871 276
410 3300013296 Ga0157374_10164515 Ga0157374_101645152 276
411 3300014325 Ga0163163_10059092 Ga0163163_100590922 276
412 3300014325 Ga0163163_10155656 Ga0163163_101556562 276
413 3300021321 Ga0214542_1000156 Ga0214542_100015631 276
414 3300021324 Ga0214545_1000078 Ga0214545_100007879 276
415 3300021327 Ga0214543_1000136 Ga0214543_100013679 276
416 3300024225 Ga0224572_1006509 Ga0224572_10065092 276
417 3300024227 Ga0228598_1015888 Ga0228598_10158882 276
418 3300025245 Ga0207425_1014237 Ga0207425_10142372 276
419 3300025253 Ga0209677_104346 Ga0209677_1043465 276
420 3300025297 Ga0209758_1000705 Ga0209758_100070528 276
421 3300025297 Ga0209758_1002299 Ga0209758_100229915 276
422 3300025297 Ga0209758_1030972 Ga0209758_10309722 276
423 3300025302 Ga0207426_1001240 Ga0207426_10012405 276
424 3300025302 Ga0207426_1006296 Ga0207426_10062964 276
425 3300025302 Ga0207426_1020313 Ga0207426_10203132 276
426 3300025304 Ga0209257_1001185 Ga0209257_100118532 276
427 3300025304 Ga0209257_1010432 Ga0209257_10104325 276
428 3300025898 Ga0207692_10063809 Ga0207692_100638092 276
429 3300025904 Ga0207647_10048251 Ga0207647_100482513 276
430 3300025904 Ga0207647_10249664 Ga0207647_102496642 276
431 3300025911 Ga0207654_10090337 Ga0207654_100903372 276
432 3300025912 Ga0207707_10027810 Ga0207707_100278105 276
433 3300025912 Ga0207707_10154734 Ga0207707_101547342 276
434 3300025913 Ga0207695_10000123 Ga0207695_1000012317 276
435 3300025913 Ga0207695_10088527 Ga0207695_100885273 276
436 3300025913 Ga0207695_10189873 Ga0207695_101898732 276
437 3300025914 Ga0207671_10009480 Ga0207671_100094806 276
438 3300025914 Ga0207671_10252742 Ga0207671_102527421 276
439 3300025922 Ga0207646_10118738 Ga0207646_101187382 276
440 3300025924 Ga0207694_10434838 Ga0207694_104348381 276
441 3300025924 Ga0207694_10461524 Ga0207694_104615242 276
442 3300025927 Ga0207687_10208342 Ga0207687_102083422 276
443 3300025927 Ga0207687_10509783 Ga0207687_105097831 276
444 3300025933 Ga0207706_10085400 Ga0207706_100854002 276
445 3300025949 Ga0207667_10064143 Ga0207667_100641433 276
446 3300025949 Ga0207667_10103467 Ga0207667_101034673 276
447 3300025949 Ga0207667_10122695 Ga0207667_101226952 276
448 3300025949 Ga0207667_10607125 Ga0207667_106071251 276
449 3300025981 Ga0207640_10075564 Ga0207640_100755642 276
450 3300026035 Ga0207703_10306384 Ga0207703_103063842 276
451 3300026041 Ga0207639_10044315 Ga0207639_100443153 276
452 3300026067 Ga0207678_10022823 Ga0207678_100228233 276
453 3300026078 Ga0207702_10167929 Ga0207702_101679291 276
454 3300026116 Ga0207674_10054730 Ga0207674_100547304 276
455 3300026142 Ga0207698_10096641 Ga0207698_100966413 276
456 3300027296 Ga0209389_1000248 Ga0209389_100024815 276
457 3300027357 Ga0209589_1001871 Ga0209589_100187115 276
458 3300027361 Ga0209489_102684 Ga0209489_10268419 276
459 3300028023 Ga0265357_1000580 Ga0265357_10005802 276
460 3300028379 Ga0268266_10128151 Ga0268266_101281513 276
461 3300031711 Ga0265314_10003648 Ga0265314_100036482 276
462 3300031712 Ga0265342_10122647 Ga0265342_101226472 276
463 3300035724 Ga0373933_0000204 Ga0373933_0000204_15991_16830 276
464 3300037418 Ga0395900_0033975 Ga0395900_0033975_2318_3157 276
465 3300037418 Ga0395900_0556389 Ga0395900_0556389_217_1056 276
466 3300037466 Ga0395898_0092172 Ga0395898_0092172_639_1478 276
467 3300037471 Ga0395905_0026848 Ga0395905_0026848_195_1034 276
468 3300038443 Ga0395901_0065664 Ga0395901_0065664_460_1299 276
469 3300038443 Ga0395901_0086125 Ga0395901_0086125_2146_2985 276
470 3300038443 Ga0395901_0165542 Ga0395901_0165542_37_876 276
471 3300038443 Ga0395901_0575766 Ga0395901_0575766_142_981 276
472 3300039450 Ga0436363_1060587 Ga0436363_1060587_5364_6206 276
473 3300044658 Ga0466972_0103734 Ga0466972_0103734_158_997 276
474 3300044684 Ga0466966_0272714 Ga0466966_0272714_131_970 276
475 3300044694 Ga0466963_0031458 Ga0466963_0031458_1986_2888 276
476 3300044735 Ga0466968_0032806 Ga0466968_0032806_949_1806 276
477 3300044842 Ga0466957_0140210 Ga0466957_0140210_308_1147 276
478 3300045976 Ga0466967_0023977 Ga0466967_0023977_3233_4135 276
479 3300045976 Ga0466967_0242814 Ga0466967_0242814_188_1027 276
480 3300046455 Ga0495603_0072211 Ga0495603_0072211_946_1785 276
481 3300046474 Ga0495605_0057694 Ga0495605_0057694_243_1115 276
482 3300046492 Ga0495585_0158482 Ga0495585_0158482_149_988 276
483 3300046499 Ga0495594_0243805 Ga0495594_0243805_127_966 276
484 3300046507 Ga0495606_0014109 Ga0495606_0014109_2434_3306 276
485 3300046511 Ga0495608_0110421 Ga0495608_0110421_563_1402 276
486 3300046514 Ga0495618_0089816 Ga0495618_0089816_854_1693 276
487 3300046515 Ga0495620_0071983 Ga0495620_0071983_407_1279 276
488 3300046516 Ga0495628_0282913 Ga0495628_0282913_144_983 276
489 3300046522 Ga0495643_0028502 Ga0495643_0028502_861_1700 276
490 3300046524 Ga0495648_0007226 Ga0495648_0007226_5117_5989 276
491 3300046524 Ga0495648_0012169 Ga0495648_0012169_4876_5718 276
492 3300046524 Ga0495648_0092889 Ga0495648_0092889_369_1217 276
493 3300046524 Ga0495648_0109736 Ga0495648_0109736_265_1104 276
494 3300046533 Ga0495640_0046767 Ga0495640_0046767_727_1566 276
495 3300046538 Ga0495609_0085365 Ga0495609_0085365_296_1135 276
496 3300046538 Ga0495609_0137657 Ga0495609_0137657_97_936 276
497 3300046542 Ga0495597_0028153 Ga0495597_0028153_606_1445 276
498 3300046557 Ga0495622_0033493 Ga0495622_0033493_636_1475 276
499 3300046557 Ga0495622_0078894 Ga0495622_0078894_429_1268 276
500 3300046616 Ga0495668_0083718 Ga0495668_0083718_426_1265 276
501 3300046642 Ga0495634_0063846 Ga0495634_0063846_1280_2119 276
502 3300046648 Ga0495611_0087470 Ga0495611_0087470_82_921 276
503 3300046660 Ga0495625_0030051 Ga0495625_0030051_1975_2847 276
504 3300046663 Ga0495635_0093114 Ga0495635_0093114_284_1123 276
505 3300046665 Ga0495661_0048855 Ga0495661_0048855_1423_2262 276
506 3300046674 Ga0495588_0015996 Ga0495588_0015996_1210_2049 276
507 3300046675 Ga0495657_0004591 Ga0495657_0004591_9299_10138 276
508 3300046690 Ga0495624_0136811 Ga0495624_0136811_269_1108 276
509 3300046692 Ga0495671_0092637 Ga0495671_0092637_629_1468 276
510 3300046694 Ga0495649_0015557 Ga0495649_0015557_79_951 276
511 3300046694 Ga0495649_0152989 Ga0495649_0152989_155_994 276
512 3300046809 Ga0495600_0015147 Ga0495600_0015147_3260_4099 276
513 3300047315 Ga0495581_0022819 Ga0495581_0022819_2601_3440 276
514 3300047317 Ga0495604_0106288 Ga0495604_0106288_171_1010 276
515 3300047317 Ga0495604_0203136 Ga0495604_0203136_328_1167 276
516 3300047320 Ga0495672_0037589 Ga0495672_0037589_1176_2009 276
517 3300047443 Ga0495687_050067 Ga0495687_050067_189_1028 276
518 3300047469 Ga0495673_0010425 Ga0495673_0010425_132_971 276
519 3300047472 Ga0495686_0136095 Ga0495686_0136095_153_992 276
520 3300047673 Ga0495593_0055700 Ga0495593_0055700_167_1006 276
521 3300048088 Ga0495602_0085186 Ga0495602_0085186_852_1691 276
522 3300048089 Ga0495614_0059008 Ga0495614_0059008_161_1000 276
523 3300048904 Ga0496101_0173978 Ga0496101_0173978_446_1285 276
524 3300048905 Ga0496102_0017084 Ga0496102_0017084_3755_4594 276
525 3300048905 Ga0496102_0244050 Ga0496102_0244050_388_1227 276
526 3300048906 Ga0496103_0013626 Ga0496103_0013626_606_1445 276
527 3300048906 Ga0496103_0176854 Ga0496103_0176854_377_1216 276
528 3300048907 Ga0496104_0007787 Ga0496104_0007787_5086_5925 276
529 3300048907 Ga0496104_0037009 Ga0496104_0037009_2330_3169 276
530 3300048907 Ga0496104_0303283 Ga0496104_0303283_40_879 276
531 3300048907 Ga0496104_0362524 Ga0496104_0362524_239_1078 276
532 3300048908 Ga0496105_0015800 Ga0496105_0015800_3541_4380 276
533 3300048908 Ga0496105_0062282 Ga0496105_0062282_211_1050 276
534 3300048909 Ga0496106_0006865 Ga0496106_0006865_6393_7232 276
535 3300048909 Ga0496106_0158517 Ga0496106_0158517_720_1559 276
536 3300048910 Ga0496107_0034178 Ga0496107_0034178_2482_3315 276
537 3300048911 Ga0496108_0039234 Ga0496108_0039234_819_1658 276
538 3300048913 Ga0496110_0091790 Ga0496110_0091790_106_945 276
539 3300048913 Ga0496110_0337214 Ga0496110_0337214_58_897 276
540 3300048914 Ga0496111_0173154 Ga0496111_0173154_34_873 276
541 3300048915 Ga0496112_0024108 Ga0496112_0024108_3030_3869 276
542 3300048915 Ga0496112_0126632 Ga0496112_0126632_850_1689 276
543 3300048915 Ga0496112_0188030 Ga0496112_0188030_618_1457 276
544 3300048915 Ga0496112_0287838 Ga0496112_0287838_408_1247 276
545 3300048915 Ga0496112_0417522 Ga0496112_0417522_174_1013 276
546 3300048916 Ga0496113_0055757 Ga0496113_0055757_1440_2279 276
547 3300048916 Ga0496113_0066166 Ga0496113_0066166_600_1439 276
548 3300048918 Ga0496115_0023466 Ga0496115_0023466_1007_1846 276
549 3300048920 Ga0496117_0062933 Ga0496117_0062933_789_1628 276
550 3300048921 Ga0496118_0020990 Ga0496118_0020990_4541_5380 276
551 3300048921 Ga0496118_0077455 Ga0496118_0077455_1449_2288 276
552 3300048921 Ga0496118_0251433 Ga0496118_0251433_152_991 276
553 3300048922 Ga0496119_0040669 Ga0496119_0040669_611_1450 276
554 3300048922 Ga0496119_0057347 Ga0496119_0057347_284_1123 276
555 3300048923 Ga0496120_0013345 Ga0496120_0013345_1819_2658 276
556 3300048924 Ga0496121_0010667 Ga0496121_0010667_7681_8514 276
557 3300048924 Ga0496121_0015737 Ga0496121_0015737_1260_2099 276
558 3300048924 Ga0496121_0209073 Ga0496121_0209073_270_1103 276
559 3300048924 Ga0496121_0256326 Ga0496121_0256326_231_1070 276
560 3300048927 Ga0496124_0049273 Ga0496124_0049273_310_1149 276
561 3300048927 Ga0496124_0058635 Ga0496124_0058635_1968_2807 276
562 3300048927 Ga0496124_0240865 Ga0496124_0240865_483_1322 276
563 3300048928 Ga0496125_0063623 Ga0496125_0063623_1593_2432 276
564 3300048928 Ga0496125_0121414 Ga0496125_0121414_323_1162 276
565 3300048929 Ga0496126_0022004 Ga0496126_0022004_3113_3946 276
566 3300048929 Ga0496126_0234965 Ga0496126_0234965_564_1403 276
567 3300049460 Ga0495682_0019019 Ga0495682_0019019_236_1108 276
568 3300049460 Ga0495682_0052153 Ga0495682_0052153_21_860 276
569 3300049823 Ga0501044_0003604 Ga0501044_0003604_10634_11473 276
570 3300050491 nmdc:mga00v17_50262_c1 nmdc:mga00v17_50262_c1_1371_2210 276
571 3300050492 nmdc:mga0yw44_100540_c1 nmdc:mga0yw44_100540_c1_688_1527 276
572 3300050493 nmdc:mga0k408_41185_c1 nmdc:mga0k408_41185_c1_1063_1902 276
573 3300050495 nmdc:mga04h51_105902_c1 nmdc:mga04h51_105902_c1_110_949 276
574 3300050496 nmdc:mga07m45_16224_c2 nmdc:mga07m45_16224_c2_878_1717 276
575 3300050516 nmdc:mga0sz30_34108_c1 nmdc:mga0sz30_34108_c1_649_1488 276
576 3300050516 nmdc:mga0sz30_40712_c2 nmdc:mga0sz30_40712_c2_158_997 276
577 3300053083 Ga0495655_0009734 Ga0495655_0009734_624_1463 276
578 3300053092 Ga0500583_0056480 Ga0500583_0056480_365_1204 276
579 3300053093 Ga0500651_0038749 Ga0500651_0038749_700_1539 276
580 3300053096 Ga0500641_0031622 Ga0500641_0031622_525_1364 276
581 3300053103 Ga0500555_006750 Ga0500555_006750_2254_3093 276
582 3300053121 Ga0500607_076874 Ga0500607_076874_167_1006 276
583 3300053130 Ga0500642_0020937 Ga0500642_0020937_1511_2350 276
584 3300053134 Ga0500658_0011386 Ga0500658_0011386_923_1762 276
585 3300053139 Ga0500568_0014785 Ga0500568_0014785_1512_2351 276
586 3300053151 Ga0500604_0018512 Ga0500604_0018512_487_1326 276
587 3300053153 Ga0500616_0000028 Ga0500616_0000028_357069_357902 276
588 3300053155 Ga0500620_032573 Ga0500620_032573_407_1246 276
589 3300053177 Ga0500636_0000762 Ga0500636_0000762_10216_11055 276
590 3300053735 Ga0500596_011896 Ga0500596_011896_267_1109 276
591 3300053736 Ga0500599_003944 Ga0500599_003944_322_1161 276
592 3300053737 Ga0500601_000371 Ga0500601_000371_1788_2627 276
593 iso_pu_bacteria 2617270735 2617349629 276
594 3300003322 rootL2_10335649 rootL2_103356492 277
595 3300005329 Ga0070683_100031309 Ga0070683_1000313094 277
596 3300005329 Ga0070683_100045265 Ga0070683_1000452653 277
597 3300005331 Ga0070670_100316986 Ga0070670_1003169861 277
598 3300005336 Ga0070680_100123326 Ga0070680_1001233262 277
599 3300005338 Ga0068868_100018112 Ga0068868_1000181123 277
600 3300005339 Ga0070660_100277754 Ga0070660_1002777542 277
601 3300005355 Ga0070671_100048918 Ga0070671_1000489182 277
602 3300005355 Ga0070671_100170292 Ga0070671_1001702921 277
603 3300005434 Ga0070709_10002262 Ga0070709_100022622 277
604 3300005434 Ga0070709_10010070 Ga0070709_100100701 277
605 3300005435 Ga0070714_100022361 Ga0070714_1000223613 277
606 3300005435 Ga0070714_100152613 Ga0070714_1001526131 277
607 3300005436 Ga0070713_100003057 Ga0070713_1000030572 277
608 3300005436 Ga0070713_100055241 Ga0070713_1000552413 277
609 3300005436 Ga0070713_100194352 Ga0070713_1001943522 277
610 3300005437 Ga0070710_10119431 Ga0070710_101194311 277
611 3300005439 Ga0070711_100002208 Ga0070711_1000022082 277
612 3300005439 Ga0070711_100013080 Ga0070711_1000130803 277
613 3300005439 Ga0070711_100130120 Ga0070711_1001301203 277
614 3300005445 Ga0070708_100120926 Ga0070708_1001209262 277
615 3300005456 Ga0070678_100066613 Ga0070678_1000666132 277
616 3300005456 Ga0070678_100189994 Ga0070678_1001899942 277
617 3300005458 Ga0070681_10112479 Ga0070681_101124792 277
618 3300005459 Ga0068867_100185270 Ga0068867_1001852702 277
619 3300005530 Ga0070679_100009249 Ga0070679_1000092492 277
620 3300005530 Ga0070679_100051732 Ga0070679_1000517323 277
621 3300005535 Ga0070684_100008556 Ga0070684_1000085562 277
622 3300005535 Ga0070684_100063130 Ga0070684_1000631303 277
623 3300005539 Ga0068853_100179629 Ga0068853_1001796292 277
624 3300005539 Ga0068853_100529554 Ga0068853_1005295542 277
625 3300005548 Ga0070665_100105307 Ga0070665_1001053073 277
626 3300005548 Ga0070665_100172385 Ga0070665_1001723852 277
627 3300005548 Ga0070665_100265636 Ga0070665_1002656362 277
628 3300005563 Ga0068855_100261934 Ga0068855_1002619342 277
629 3300005563 Ga0068855_100495803 Ga0068855_1004958031 277
630 3300005577 Ga0068857_100681426 Ga0068857_1006814261 277
631 3300005614 Ga0068856_100073843 Ga0068856_1000738433 277
632 3300005614 Ga0068856_100178360 Ga0068856_1001783602 277
633 3300005615 Ga0070702_100323136 Ga0070702_1003231361 277
634 3300005616 Ga0068852_100024735 Ga0068852_1000247352 277
635 3300005616 Ga0068852_100204250 Ga0068852_1002042502 277
636 3300005617 Ga0068859_100154399 Ga0068859_1001543992 277
637 3300005719 Ga0068861_100048184 Ga0068861_1000481844 277
638 3300005719 Ga0068861_100204537 Ga0068861_1002045372 277
639 3300005843 Ga0068860_100143725 Ga0068860_1001437253 277
640 3300005844 Ga0068862_100028055 Ga0068862_1000280552 277
641 3300005844 Ga0068862_100083389 Ga0068862_1000833892 277
642 3300005937 Ga0081455_10023827 Ga0081455_100238276 277
643 3300005983 Ga0081540_1002136 Ga0081540_100213614 277
644 3300005983 Ga0081540_1008268 Ga0081540_10082683 277
645 3300005983 Ga0081540_1013689 Ga0081540_10136891 277
646 3300006028 Ga0070717_10003779 Ga0070717_100037797 277
647 3300006163 Ga0070715_10208276 Ga0070715_102082761 277
648 3300006173 Ga0070716_100008278 Ga0070716_1000082784 277
649 3300006175 Ga0070712_100328792 Ga0070712_1003287922 277
650 3300006358 Ga0068871_100162788 Ga0068871_1001627882 277
651 3300006881 Ga0068865_100076577 Ga0068865_1000765773 277
652 3300006931 Ga0097620_100154402 Ga0097620_1001544022 277
653 3300006942 Ga0099824_1023056 Ga0099824_10230566 277
654 3300006943 Ga0099822_1001448 Ga0099822_10014483 277
655 3300007265 Ga0099794_10060242 Ga0099794_100602422 277
656 3300007788 Ga0099795_10003998 Ga0099795_100039984 277
657 3300007788 Ga0099795_10010789 Ga0099795_100107894 277
658 3300007788 Ga0099795_10025253 Ga0099795_100252533 277
659 3300007788 Ga0099795_10134516 Ga0099795_101345161 277
660 3300009098 Ga0105245_10035028 Ga0105245_100350285 277
661 3300009176 Ga0105242_10097450 Ga0105242_100974502 277
662 3300009177 Ga0105248_10237637 Ga0105248_102376372 277
663 3300009545 Ga0105237_10004719 Ga0105237_1000471912 277
664 3300009545 Ga0105237_10381648 Ga0105237_103816482 277
665 3300009551 Ga0105238_10374066 Ga0105238_103740662 277
666 3300009553 Ga0105249_10094865 Ga0105249_100948652 277
667 3300010159 Ga0099796_10043386 Ga0099796_100433862 277
668 3300010375 Ga0105239_10079664 Ga0105239_100796642 277
669 3300010375 Ga0105239_10282663 Ga0105239_102826633 277
670 3300010375 Ga0105239_10330197 Ga0105239_103301972 277
671 3300011119 Ga0105246_10012128 Ga0105246_100121283 277
672 3300013100 Ga0157373_10010494 Ga0157373_100104943 277
673 3300013102 Ga0157371_10007078 Ga0157371_100070787 277
674 3300013296 Ga0157374_10224597 Ga0157374_102245972 277
675 3300013297 Ga0157378_10104776 Ga0157378_101047761 277
676 3300013297 Ga0157378_10108129 Ga0157378_101081292 277
677 3300013306 Ga0163162_10022106 Ga0163162_100221063 277
678 3300013306 Ga0163162_10029020 Ga0163162_100290205 277
679 3300013306 Ga0163162_10081453 Ga0163162_100814532 277
680 3300013306 Ga0163162_10324040 Ga0163162_103240402 277
681 3300013307 Ga0157372_10107362 Ga0157372_101073621 277
682 3300013308 Ga0157375_10064892 Ga0157375_100648923 277
683 3300013308 Ga0157375_10430055 Ga0157375_104300552 277
684 3300014325 Ga0163163_10029384 Ga0163163_100293845 277
685 3300014326 Ga0157380_10013506 Ga0157380_100135064 277
686 3300014745 Ga0157377_10226916 Ga0157377_102269161 277
687 3300014968 Ga0157379_10010153 Ga0157379_100101536 277
688 3300014969 Ga0157376_10022095 Ga0157376_100220953 277
689 3300014969 Ga0157376_10109705 Ga0157376_101097053 277
690 3300014969 Ga0157376_10237036 Ga0157376_102370362 277
691 3300017792 Ga0163161_10047578 Ga0163161_100475782 277
692 3300021441 Ga0213871_10000896 Ga0213871_100008962 277
693 3300025297 Ga0209758_1000932 Ga0209758_100093228 277
694 3300025893 Ga0207682_10014469 Ga0207682_100144692 277
695 3300025898 Ga0207692_10203761 Ga0207692_102037611 277
696 3300025906 Ga0207699_10001069 Ga0207699_1000106914 277
697 3300025906 Ga0207699_10040581 Ga0207699_100405813 277
698 3300025909 Ga0207705_10081980 Ga0207705_100819803 277
699 3300025912 Ga0207707_10006422 Ga0207707_100064224 277
700 3300025914 Ga0207671_10527652 Ga0207671_105276521 277
701 3300025915 Ga0207693_10000565 Ga0207693_100005652 277
702 3300025915 Ga0207693_10076615 Ga0207693_100766151 277
703 3300025916 Ga0207663_10000239 Ga0207663_1000023916 277
704 3300025917 Ga0207660_10030183 Ga0207660_100301832 277
705 3300025921 Ga0207652_10073521 Ga0207652_100735213 277
706 3300025924 Ga0207694_10039207 Ga0207694_100392072 277
707 3300025925 Ga0207650_10357355 Ga0207650_103573552 277
708 3300025927 Ga0207687_10030484 Ga0207687_100304842 277
709 3300025927 Ga0207687_10221870 Ga0207687_102218702 277
710 3300025928 Ga0207700_10005825 Ga0207700_100058256 277
711 3300025929 Ga0207664_10032782 Ga0207664_100327824 277
712 3300025931 Ga0207644_10055831 Ga0207644_100558312 277
713 3300025931 Ga0207644_10127632 Ga0207644_101276322 277
714 3300025934 Ga0207686_10187791 Ga0207686_101877912 277
715 3300025935 Ga0207709_10006190 Ga0207709_100061902 277
716 3300025939 Ga0207665_10000127 Ga0207665_1000012751 277
717 3300025940 Ga0207691_10113799 Ga0207691_101137993 277
718 3300025940 Ga0207691_10116097 Ga0207691_101160972 277
719 3300025941 Ga0207711_10252392 Ga0207711_102523922 277
720 3300025942 Ga0207689_10081386 Ga0207689_100813862 277
721 3300025944 Ga0207661_10002078 Ga0207661_100020782 277
722 3300025949 Ga0207667_10095327 Ga0207667_100953272 277
723 3300025949 Ga0207667_10115171 Ga0207667_101151713 277
724 3300025949 Ga0207667_10219159 Ga0207667_102191592 277
725 3300025960 Ga0207651_10327218 Ga0207651_103272181 277
726 3300026023 Ga0207677_10006044 Ga0207677_100060443 277
727 3300026035 Ga0207703_10130992 Ga0207703_101309922 277
728 3300026041 Ga0207639_10082222 Ga0207639_100822223 277
729 3300026041 Ga0207639_10108911 Ga0207639_101089112 277
730 3300026041 Ga0207639_10288492 Ga0207639_102884922 277
731 3300026041 Ga0207639_10582894 Ga0207639_105828941 277
732 3300026067 Ga0207678_10021488 Ga0207678_100214884 277
733 3300026067 Ga0207678_10062786 Ga0207678_100627864 277
734 3300026089 Ga0207648_10046915 Ga0207648_100469152 277
735 3300026095 Ga0207676_10677293 Ga0207676_106772932 277
736 3300026118 Ga0207675_100104527 Ga0207675_1001045273 277
737 3300026118 Ga0207675_100115515 Ga0207675_1001155153 277
738 3300026121 Ga0207683_10051919 Ga0207683_100519192 277
739 3300026121 Ga0207683_10056530 Ga0207683_100565303 277
740 3300026121 Ga0207683_10089743 Ga0207683_100897432 277
741 3300026121 Ga0207683_10163872 Ga0207683_101638722 277
742 3300026142 Ga0207698_10031006 Ga0207698_100310063 277
743 3300026142 Ga0207698_10087873 Ga0207698_100878732 277
744 3300027357 Ga0209589_1000005 Ga0209589_1000005146 277
745 3300027361 Ga0209489_100005 Ga0209489_100005146 277
746 3300027363 Ga0209700_100006 Ga0209700_100006146 277
747 3300027512 Ga0209179_1012095 Ga0209179_10120952 277
748 3300028379 Ga0268266_10077802 Ga0268266_100778023 277
749 3300028379 Ga0268266_10112988 Ga0268266_101129883 277
750 3300028380 Ga0268265_10079812 Ga0268265_100798123 277
751 3300028381 Ga0268264_10000174 Ga0268264_1000017492 277
752 3300028786 Ga0307517_10000859 Ga0307517_100008594 277
753 3300028794 Ga0307515_10028873 Ga0307515_100288735 277
754 3300030521 Ga0307511_10032093 Ga0307511_100320937 277
755 3300030878 Ga0265770_1032542 Ga0265770_10325421 277
756 3300031235 Ga0265330_10031054 Ga0265330_100310542 277
757 3300031238 Ga0265332_10006382 Ga0265332_100063823 277
758 3300031241 Ga0265325_10028164 Ga0265325_100281642 277
759 3300031247 Ga0265340_10036658 Ga0265340_100366583 277
760 3300031250 Ga0265331_10190616 Ga0265331_101906161 277
761 3300031507 Ga0307509_10006398 Ga0307509_100063985 277
762 3300031507 Ga0307509_10274632 Ga0307509_102746321 277
763 3300031595 Ga0265313_10112428 Ga0265313_101124282 277
764 3300031616 Ga0307508_10000063 Ga0307508_1000006351 277
765 3300031616 Ga0307508_10056441 Ga0307508_100564416 277
766 3300031711 Ga0265314_10176733 Ga0265314_101767332 277
767 3300031712 Ga0265342_10005406 Ga0265342_100054068 277
768 3300031730 Ga0307516_10043872 Ga0307516_100438722 277
769 3300031731 Ga0307405_10022939 Ga0307405_100229392 277
770 3300031901 Ga0307406_10132490 Ga0307406_101324902 277
771 3300033179 Ga0307507_10125921 Ga0307507_101259211 277
772 3300033179 Ga0307507_10150631 Ga0307507_101506312 277
773 3300033180 Ga0307510_10126787 Ga0307510_101267873 277
774 3300033442 Ga0315911_1000040 Ga0315911_10000406 277
775 3300033546 Ga0316213_1002509 Ga0316213_10025092 277
776 3300034816 Ga0373930_0008599 Ga0373930_0008599_229_1080 277
777 3300034820 Ga0373959_0012771 Ga0373959_0012771_449_1300 277
778 3300035083 Ga0373926_0011522 Ga0373926_0011522_1806_2648 277
779 3300035086 Ga0373934_0047916 Ga0373934_0047916_340_1182 277
780 3300035086 Ga0373934_0053221 Ga0373934_0053221_680_1525 277
781 3300035088 Ga0373940_0027412 Ga0373940_0027412_79_930 277
782 3300035091 Ga0373951_0031325 Ga0373951_0031325_131_982 277
783 3300035111 Ga0373923_0003867 Ga0373923_0003867_3268_4113 277
784 3300035111 Ga0373923_0049887 Ga0373923_0049887_247_1089 277
785 3300035113 Ga0373936_0006062 Ga0373936_0006062_2061_2942 277
786 3300035113 Ga0373936_0053213 Ga0373936_0053213_199_1041 277
787 3300035113 Ga0373936_0054051 Ga0373936_0054051_381_1226 277
788 3300035116 Ga0373945_0007291 Ga0373945_0007291_1718_2599 277
789 3300035117 Ga0373953_0012482 Ga0373953_0012482_776_1621 277
790 3300035118 Ga0373954_0008152 Ga0373954_0008152_1793_2638 277
791 3300035118 Ga0373954_0031320 Ga0373954_0031320_478_1320 277
792 3300035119 Ga0373956_0004720 Ga0373956_0004720_3009_3854 277
793 3300035120 Ga0373957_0010097 Ga0373957_0010097_1568_2413 277
794 3300035120 Ga0373957_0053731 Ga0373957_0053731_150_992 277
795 3300035170 Ga0373943_0028008 Ga0373943_0028008_962_1804 277
796 3300035170 Ga0373943_0101921 Ga0373943_0101921_206_1048 277
797 3300035171 Ga0373946_0075376 Ga0373946_0075376_234_1076 277
798 3300035171 Ga0373946_0101738 Ga0373946_0101738_400_1242 277
799 3300035172 Ga0373955_0002049 Ga0373955_0002049_755_1600 277
800 3300035410 Ga0373924_0014698 Ga0373924_0014698_1267_2112 277
801 3300035691 Ga0373931_0006487 Ga0373931_0006487_1421_2272 277
802 3300035691 Ga0373931_0305503 Ga0373931_0305503_29_871 277
803 3300035692 Ga0373935_0000942 Ga0373935_0000942_10171_11052 277
804 3300035692 Ga0373935_0121844 Ga0373935_0121844_95_955 277
805 3300035692 Ga0373935_0196235 Ga0373935_0196235_349_1191 277
806 3300035692 Ga0373935_0439570 Ga0373935_0439570_54_896 277
807 3300035695 Ga0373927_0000528 Ga0373927_0000528_3294_4175 277
808 3300035695 Ga0373927_0030902 Ga0373927_0030902_328_1170 277
809 3300035695 Ga0373927_0035067 Ga0373927_0035067_1834_2676 277
810 3300035695 Ga0373927_0066975 Ga0373927_0066975_17_859 277
811 3300035695 Ga0373927_0214174 Ga0373927_0214174_209_1051 277
812 3300035695 Ga0373927_0227121 Ga0373927_0227121_233_1075 277
813 3300035724 Ga0373933_0010853 Ga0373933_0010853_940_1785 277
814 3300035724 Ga0373933_0077067 Ga0373933_0077067_811_1653 277
815 3300035724 Ga0373933_0090111 Ga0373933_0090111_506_1387 277
816 3300035724 Ga0373933_0293051 Ga0373933_0293051_49_891 277
817 3300035725 Ga0373947_0000455 Ga0373947_0000455_17442_18323 277
818 3300036401 Ga0373937_0008188 Ga0373937_0008188_2610_3455 277
819 3300036459 Ga0372808_001169 Ga0372808_001169_1002_1844 277
820 3300037068 Ga0373925_0003563 Ga0373925_0003563_8305_9186 277
821 3300037068 Ga0373925_0104455 Ga0373925_0104455_838_1680 277
822 3300037068 Ga0373925_0130934 Ga0373925_0130934_513_1355 277
823 3300037068 Ga0373925_0313178 Ga0373925_0313178_32_883 277
824 3300037418 Ga0395900_0357002 Ga0395900_0357002_464_1306 277
825 3300037853 Ga0436364_0100847 Ga0436364_0100847_312_1154 277
826 3300039437 Ga0436365_1490250 Ga0436365_1490250_458_1315 277
827 3300039438 Ga0436360_0675457 Ga0436360_0675457_1667_2512 277
828 3300039447 Ga0436361_0576775 Ga0436361_0576775_1202_2047 277
829 3300039447 Ga0436361_0681610 Ga0436361_0681610_291_1136 277
830 3300039453 Ga0436362_0124208 Ga0436362_0124208_120_965 277
831 3300044656 Ga0466969_0014448 Ga0466969_0014448_1847_2692 277
832 3300044694 Ga0466963_0019050 Ga0466963_0019050_67_909 277
833 3300044719 Ga0466971_0060412 Ga0466971_0060412_506_1396 277
834 3300045049 Ga0466959_0008049 Ga0466959_0008049_5582_6424 277
835 3300045049 Ga0466959_0062872 Ga0466959_0062872_1090_1935 277
836 3300045976 Ga0466967_0838598 Ga0466967_0838598_25_867 277
837 3300046454 Ga0495592_0021465 Ga0495592_0021465_2350_3195 277
838 3300046454 Ga0495592_0032569 Ga0495592_0032569_353_1234 277
839 3300046455 Ga0495603_0000239 Ga0495603_0000239_12865_13746 277
840 3300046455 Ga0495603_0015374 Ga0495603_0015374_2833_3675 277
841 3300046457 Ga0495590_0116445 Ga0495590_0116445_19_879 277
842 3300046459 Ga0495629_0000457 Ga0495629_0000457_13356_14237 277
843 3300046459 Ga0495629_0007972 Ga0495629_0007972_5405_6250 277
844 3300046459 Ga0495629_0096371 Ga0495629_0096371_84_941 277
845 3300046459 Ga0495629_0163427 Ga0495629_0163427_379_1221 277
846 3300046461 Ga0495641_0002157 Ga0495641_0002157_8057_8938 277
847 3300046462 Ga0495651_0037984 Ga0495651_0037984_1782_2624 277
848 3300046462 Ga0495651_0054995 Ga0495651_0054995_1953_2798 277
849 3300046462 Ga0495651_0166592 Ga0495651_0166592_149_991 277
850 3300046463 Ga0495653_0009797 Ga0495653_0009797_774_1619 277
851 3300046472 Ga0495580_0002960 Ga0495580_0002960_1514_2395 277
852 3300046472 Ga0495580_0009091 Ga0495580_0009091_5273_6115 277
853 3300046473 Ga0495582_0000077 Ga0495582_0000077_31793_32674 277
854 3300046473 Ga0495582_0258275 Ga0495582_0258275_57_899 277
855 3300046474 Ga0495605_0154703 Ga0495605_0154703_156_998 277
856 3300046475 Ga0495639_0000101 Ga0495639_0000101_14706_15587 277
857 3300046475 Ga0495639_0012036 Ga0495639_0012036_408_1250 277
858 3300046476 Ga0495662_0012510 Ga0495662_0012510_1845_2726 277
859 3300046476 Ga0495662_0051472 Ga0495662_0051472_543_1385 277
860 3300046477 Ga0495664_0041464 Ga0495664_0041464_1552_2433 277
861 3300046477 Ga0495664_0044789 Ga0495664_0044789_841_1683 277
862 3300046499 Ga0495594_0127044 Ga0495594_0127044_41_883 277
863 3300046507 Ga0495606_0000357 Ga0495606_0000357_19858_20718 277
864 3300046511 Ga0495608_0004649 Ga0495608_0004649_960_1805 277
865 3300046511 Ga0495608_0061364 Ga0495608_0061364_311_1153 277
866 3300046514 Ga0495618_0014258 Ga0495618_0014258_596_1438 277
867 3300046514 Ga0495618_0119090 Ga0495618_0119090_363_1208 277
868 3300046514 Ga0495618_0136315 Ga0495618_0136315_229_1071 277
869 3300046515 Ga0495620_0078633 Ga0495620_0078633_324_1223 277
870 3300046516 Ga0495628_0105477 Ga0495628_0105477_15_857 277
871 3300046517 Ga0495630_0012819 Ga0495630_0012819_1068_1910 277
872 3300046517 Ga0495630_0047522 Ga0495630_0047522_2050_2931 277
873 3300046517 Ga0495630_0281866 Ga0495630_0281866_92_952 277
874 3300046518 Ga0495631_0126651 Ga0495631_0126651_220_1062 277
875 3300046529 Ga0495652_0021917 Ga0495652_0021917_991_1872 277
876 3300046529 Ga0495652_0046433 Ga0495652_0046433_2840_3685 277
877 3300046529 Ga0495652_0070477 Ga0495652_0070477_737_1579 277
878 3300046531 Ga0495665_0000055 Ga0495665_0000055_29353_30234 277
879 3300046533 Ga0495640_0011661 Ga0495640_0011661_866_1711 277
880 3300046533 Ga0495640_0024673 Ga0495640_0024673_1374_2255 277
881 3300046533 Ga0495640_0043321 Ga0495640_0043321_799_1641 277
882 3300046535 Ga0495586_0046428 Ga0495586_0046428_1347_2189 277
883 3300046536 Ga0495587_0005897 Ga0495587_0005897_4307_5149 277
884 3300046536 Ga0495587_0015897 Ga0495587_0015897_3215_4060 277
885 3300046537 Ga0495598_0045979 Ga0495598_0045979_273_1190 277
886 3300046543 Ga0495645_0061920 Ga0495645_0061920_1245_2090 277
887 3300046543 Ga0495645_0115470 Ga0495645_0115470_936_1778 277
888 3300046543 Ga0495645_0120887 Ga0495645_0120887_773_1615 277
889 3300046557 Ga0495622_0002233 Ga0495622_0002233_4979_5860 277
890 3300046557 Ga0495622_0055262 Ga0495622_0055262_698_1540 277
891 3300046557 Ga0495622_0057388 Ga0495622_0057388_28_870 277
892 3300046557 Ga0495622_0101465 Ga0495622_0101465_331_1173 277
893 3300046559 Ga0495667_0021423 Ga0495667_0021423_1436_2281 277
894 3300046559 Ga0495667_0023279 Ga0495667_0023279_224_1066 277
895 3300046559 Ga0495667_0038378 Ga0495667_0038378_1929_2810 277
896 3300046559 Ga0495667_0048600 Ga0495667_0048600_156_1019 277
897 3300046615 Ga0495656_0006841 Ga0495656_0006841_241_1131 277
898 3300046642 Ga0495634_0001036 Ga0495634_0001036_1937_2818 277
899 3300046642 Ga0495634_0069546 Ga0495634_0069546_1240_2085 277
900 3300046642 Ga0495634_0084757 Ga0495634_0084757_1087_1929 277
901 3300046663 Ga0495635_0000815 Ga0495635_0000815_16746_17627 277
902 3300046663 Ga0495635_0004810 Ga0495635_0004810_8134_8979 277
903 3300046663 Ga0495635_0029736 Ga0495635_0029736_1204_2046 277
904 3300046674 Ga0495588_0005058 Ga0495588_0005058_431_1312 277
905 3300046674 Ga0495588_0005077 Ga0495588_0005077_3320_4162 277
906 3300046675 Ga0495657_0003079 Ga0495657_0003079_10089_10934 277
907 3300046678 Ga0495599_0001945 Ga0495599_0001945_1035_1880 277
908 3300046678 Ga0495599_0053717 Ga0495599_0053717_1661_2503 277
909 3300046679 Ga0495623_0020870 Ga0495623_0020870_1436_2281 277
910 3300046679 Ga0495623_0233769 Ga0495623_0233769_52_894 277
911 3300046680 Ga0495646_0001642 Ga0495646_0001642_277_1122 277
912 3300046680 Ga0495646_0022610 Ga0495646_0022610_1228_2070 277
913 3300046680 Ga0495646_0060647 Ga0495646_0060647_759_1640 277
914 3300046681 Ga0495647_0010626 Ga0495647_0010626_782_1663 277
915 3300046689 Ga0495613_0003480 Ga0495613_0003480_2835_3716 277
916 3300046689 Ga0495613_0092005 Ga0495613_0092005_1017_1862 277
917 3300046689 Ga0495613_0284765 Ga0495613_0284765_53_895 277
918 3300046690 Ga0495624_0000235 Ga0495624_0000235_13891_14772 277
919 3300046691 Ga0495670_0090418 Ga0495670_0090418_597_1439 277
920 3300046692 Ga0495671_0202048 Ga0495671_0202048_58_900 277
921 3300046809 Ga0495600_0012719 Ga0495600_0012719_1953_2798 277
922 3300047315 Ga0495581_0000041 Ga0495581_0000041_18740_19621 277
923 3300047317 Ga0495604_0007221 Ga0495604_0007221_6089_6934 277
924 3300047317 Ga0495604_0070109 Ga0495604_0070109_360_1202 277
925 3300047317 Ga0495604_0086405 Ga0495604_0086405_840_1682 277
926 3300047319 Ga0495674_0001192 Ga0495674_0001192_1251_2132 277
927 3300047319 Ga0495674_0028002 Ga0495674_0028002_3376_4221 277
928 3300047321 Ga0495676_0018550 Ga0495676_0018550_3968_4849 277
929 3300047321 Ga0495676_0100156 Ga0495676_0100156_256_1098 277
930 3300047321 Ga0495676_0403146 Ga0495676_0403146_18_860 277
931 3300047322 Ga0495680_0017765 Ga0495680_0017765_3344_4189 277
932 3300047444 Ga0495675_0040948 Ga0495675_0040948_254_1099 277
933 3300047469 Ga0495673_0025589 Ga0495673_0025589_161_1003 277
934 3300047471 Ga0495684_0001399 Ga0495684_0001399_5405_6250 277
935 3300047471 Ga0495684_0039273 Ga0495684_0039273_1841_2683 277
936 3300047471 Ga0495684_0075698 Ga0495684_0075698_504_1385 277
937 3300047472 Ga0495686_0060885 Ga0495686_0060885_970_1845 277
938 3300047472 Ga0495686_0085485 Ga0495686_0085485_301_1143 277
939 3300047673 Ga0495593_0000024 Ga0495593_0000024_24156_25037 277
940 3300047673 Ga0495593_0004938 Ga0495593_0004938_1434_2279 277
941 3300047673 Ga0495593_0052823 Ga0495593_0052823_430_1272 277
942 3300048088 Ga0495602_0035012 Ga0495602_0035012_3215_4060 277
943 3300048090 Ga0495615_0051171 Ga0495615_0051171_11_853 277
944 3300048903 Ga0496100_0071720 Ga0496100_0071720_778_1629 277
945 3300048904 Ga0496101_0005706 Ga0496101_0005706_5999_6850 277
946 3300048904 Ga0496101_0017665 Ga0496101_0017665_2292_3134 277
947 3300048904 Ga0496101_0417516 Ga0496101_0417516_113_955 277
948 3300048905 Ga0496102_0014041 Ga0496102_0014041_2610_3467 277
949 3300048905 Ga0496102_0067126 Ga0496102_0067126_1872_2714 277
950 3300048906 Ga0496103_0037032 Ga0496103_0037032_100_957 277
951 3300048906 Ga0496103_0155467 Ga0496103_0155467_175_1017 277
952 3300048907 Ga0496104_0088068 Ga0496104_0088068_1266_2123 277
953 3300048907 Ga0496104_0182742 Ga0496104_0182742_133_975 277
954 3300048907 Ga0496104_0186109 Ga0496104_0186109_964_1866 277
955 3300048907 Ga0496104_0187277 Ga0496104_0187277_1097_1948 277
956 3300048908 Ga0496105_0013422 Ga0496105_0013422_4804_5661 277
957 3300048908 Ga0496105_0034013 Ga0496105_0034013_2122_2973 277
958 3300048908 Ga0496105_0175327 Ga0496105_0175327_757_1599 277
959 3300048909 Ga0496106_0017314 Ga0496106_0017314_2366_3223 277
960 3300048909 Ga0496106_0031297 Ga0496106_0031297_1738_2589 277
961 3300048909 Ga0496106_0058706 Ga0496106_0058706_202_1092 277
962 3300048909 Ga0496106_0094631 Ga0496106_0094631_625_1467 277
963 3300048909 Ga0496106_0130932 Ga0496106_0130932_629_1471 277
964 3300048910 Ga0496107_0037820 Ga0496107_0037820_1543_2394 277
965 3300048911 Ga0496108_0070491 Ga0496108_0070491_700_1542 277
966 3300048911 Ga0496108_0101833 Ga0496108_0101833_648_1499 277
967 3300048912 Ga0496109_0051292 Ga0496109_0051292_2765_3616 277
968 3300048912 Ga0496109_0327342 Ga0496109_0327342_115_1017 277
969 3300048913 Ga0496110_0003123 Ga0496110_0003123_4565_5407 277
970 3300048913 Ga0496110_0005741 Ga0496110_0005741_5392_6243 277
971 3300048913 Ga0496110_0159652 Ga0496110_0159652_477_1319 277
972 3300048913 Ga0496110_0321195 Ga0496110_0321195_12_854 277
973 3300048914 Ga0496111_0034236 Ga0496111_0034236_1338_2189 277
974 3300048914 Ga0496111_0042463 Ga0496111_0042463_970_1827 277
975 3300048914 Ga0496111_0256530 Ga0496111_0256530_134_976 277
976 3300048915 Ga0496112_0012582 Ga0496112_0012582_6101_6943 277
977 3300048915 Ga0496112_0064719 Ga0496112_0064719_1909_2766 277
978 3300048915 Ga0496112_0178060 Ga0496112_0178060_52_954 277
979 3300048915 Ga0496112_0186684 Ga0496112_0186684_702_1640 277
980 3300048916 Ga0496113_0102680 Ga0496113_0102680_642_1499 277
981 3300048916 Ga0496113_0156050 Ga0496113_0156050_67_909 277
982 3300048916 Ga0496113_0222184 Ga0496113_0222184_552_1394 277
983 3300048917 Ga0496114_0022402 Ga0496114_0022402_3507_4364 277
984 3300048917 Ga0496114_0371093 Ga0496114_0371093_273_1124 277
985 3300048918 Ga0496115_0001250 Ga0496115_0001250_6960_7817 277
986 3300048918 Ga0496115_0056055 Ga0496115_0056055_806_1648 277
987 3300048918 Ga0496115_0116508 Ga0496115_0116508_1248_2099 277
988 3300048918 Ga0496115_0179206 Ga0496115_0179206_517_1362 277
989 3300048920 Ga0496117_0017488 Ga0496117_0017488_4261_5163 277
990 3300048921 Ga0496118_0039136 Ga0496118_0039136_2388_3290 277
991 3300048922 Ga0496119_0042593 Ga0496119_0042593_1958_2860 277
992 3300048922 Ga0496119_0099423 Ga0496119_0099423_238_1140 277
993 3300048924 Ga0496121_0007064 Ga0496121_0007064_6283_7185 277
994 3300048924 Ga0496121_0061566 Ga0496121_0061566_1349_2191 277
995 3300048924 Ga0496121_0155804 Ga0496121_0155804_183_1025 277
996 3300048927 Ga0496124_0061641 Ga0496124_0061641_836_1738 277
997 3300048928 Ga0496125_0042169 Ga0496125_0042169_800_1642 277
998 3300048929 Ga0496126_0027336 Ga0496126_0027336_703_1545 277
999 3300048929 Ga0496126_0135129 Ga0496126_0135129_399_1241 277
1000 3300048929 Ga0496126_0135967 Ga0496126_0135967_1123_1965 277
1001 3300048929 Ga0496126_0202331 Ga0496126_0202331_300_1178 277
1002 3300048929 Ga0496126_0232203 Ga0496126_0232203_260_1102 277
1003 3300048929 Ga0496126_0398398 Ga0496126_0398398_181_1023 277
1004 3300049568 Ga0501031_0000398 Ga0501031_0000398_5788_6630 277
1005 3300049568 Ga0501031_0031248 Ga0501031_0031248_882_1730 277
1006 3300049569 Ga0501032_0066313 Ga0501032_0066313_375_1223 277
1007 3300049569 Ga0501032_0073505 Ga0501032_0073505_329_1180 277
1008 3300049569 Ga0501032_0098657 Ga0501032_0098657_221_1072 277
1009 3300049570 Ga0501033_0001463 Ga0501033_0001463_739_1581 277
1010 3300049570 Ga0501033_0016180 Ga0501033_0016180_2372_3220 277
1011 3300049570 Ga0501033_0027952 Ga0501033_0027952_1779_2630 277
1012 3300049570 Ga0501033_0178464 Ga0501033_0178464_16_858 277
1013 3300049570 Ga0501033_0209494 Ga0501033_0209494_409_1260 277
1014 3300049571 Ga0501034_0000072 Ga0501034_0000072_54870_55712 277
1015 3300049571 Ga0501034_0186662 Ga0501034_0186662_804_1655 277
1016 3300049572 Ga0501036_0000050 Ga0501036_0000050_3748_4590 277
1017 3300049572 Ga0501036_0023850 Ga0501036_0023850_814_1662 277
1018 3300049572 Ga0501036_0027119 Ga0501036_0027119_2476_3327 277
1019 3300049572 Ga0501036_0109654 Ga0501036_0109654_950_1801 277
1020 3300049572 Ga0501036_0220338 Ga0501036_0220338_278_1129 277
1021 3300049573 Ga0501037_0000030 Ga0501037_0000030_60353_61195 277
1022 3300049573 Ga0501037_0158463 Ga0501037_0158463_628_1479 277
1023 3300049573 Ga0501037_0196762 Ga0501037_0196762_58_909 277
1024 3300049574 Ga0501038_0000039 Ga0501038_0000039_111901_112743 277
1025 3300049574 Ga0501038_0003573 Ga0501038_0003573_9825_10673 277
1026 3300049574 Ga0501038_0003903 Ga0501038_0003903_553_1404 277
1027 3300049574 Ga0501038_0120846 Ga0501038_0120846_573_1424 277
1028 3300049575 Ga0501039_0000060 Ga0501039_0000060_13962_14804 277
1029 3300049575 Ga0501039_0006389 Ga0501039_0006389_6411_7259 277
1030 3300049575 Ga0501039_0049810 Ga0501039_0049810_1390_2241 277
1031 3300049575 Ga0501039_0170764 Ga0501039_0170764_592_1443 277
1032 3300049578 Ga0501042_0008343 Ga0501042_0008343_4069_4920 277
1033 3300049578 Ga0501042_0040413 Ga0501042_0040413_145_987 277
1034 3300049579 Ga0501043_0003512 Ga0501043_0003512_11313_12155 277
1035 3300049579 Ga0501043_0015596 Ga0501043_0015596_3058_3909 277
1036 3300049580 Ga0501046_0000419 Ga0501046_0000419_8620_9462 277
1037 3300049580 Ga0501046_0002900 Ga0501046_0002900_450_1298 277
1038 3300049580 Ga0501046_0022009 Ga0501046_0022009_3827_4678 277
1039 3300049581 Ga0501047_0000174 Ga0501047_0000174_47565_48407 277
1040 3300049581 Ga0501047_0012410 Ga0501047_0012410_6142_6984 277
1041 3300049581 Ga0501047_0031187 Ga0501047_0031187_461_1312 277
1042 3300049581 Ga0501047_0172472 Ga0501047_0172472_1095_1943 277
1043 3300049582 Ga0501048_0000068 Ga0501048_0000068_12605_13447 277
1044 3300049582 Ga0501048_0017640 Ga0501048_0017640_577_1428 277
1045 3300049583 Ga0501067_0000068 Ga0501067_0000068_47883_48725 277
1046 3300049583 Ga0501067_0007709 Ga0501067_0007709_119_970 277
1047 3300049583 Ga0501067_0111382 Ga0501067_0111382_136_987 277
1048 3300049583 Ga0501067_0131537 Ga0501067_0131537_153_995 277
1049 3300049584 Ga0501068_0000949 Ga0501068_0000949_371_1213 277
1050 3300049584 Ga0501068_0002589 Ga0501068_0002589_5135_5986 277
1051 3300049584 Ga0501068_0003549 Ga0501068_0003549_1588_2436 277
1052 3300049586 Ga0501070_0025353 Ga0501070_0025353_3728_4579 277
1053 3300049586 Ga0501070_0039676 Ga0501070_0039676_1016_1858 277
1054 3300049586 Ga0501070_0256961 Ga0501070_0256961_362_1204 277
1055 3300049587 Ga0501071_0131428 Ga0501071_0131428_569_1411 277
1056 3300049588 Ga0501072_0035557 Ga0501072_0035557_1472_2323 277
1057 3300049589 Ga0501073_0000009 Ga0501073_0000009_70695_71537 277
1058 3300049589 Ga0501073_0010592 Ga0501073_0010592_2391_3242 277
1059 3300049589 Ga0501073_0162995 Ga0501073_0162995_304_1155 277
1060 3300049590 Ga0501074_0001057 Ga0501074_0001057_16278_17120 277
1061 3300049590 Ga0501074_0055835 Ga0501074_0055835_1937_2788 277
1062 3300049593 Ga0501077_0028394 Ga0501077_0028394_1314_2165 277
1063 3300049741 Ga0501079_0012968 Ga0501079_0012968_1595_2446 277
1064 3300049741 Ga0501079_0017176 Ga0501079_0017176_3502_4344 277
1065 3300049742 Ga0501080_0006205 Ga0501080_0006205_5416_6258 277
1066 3300049742 Ga0501080_0032682 Ga0501080_0032682_2545_3396 277
1067 3300049742 Ga0501080_0037424 Ga0501080_0037424_3415_4266 277
1068 3300049744 Ga0501083_0005994 Ga0501083_0005994_794_1636 277
1069 3300049744 Ga0501083_0021673 Ga0501083_0021673_2987_3838 277
1070 3300049744 Ga0501083_0058662 Ga0501083_0058662_603_1451 277
1071 3300049822 Ga0501035_0000067 Ga0501035_0000067_57611_58453 277
1072 3300049822 Ga0501035_0006796 Ga0501035_0006796_2429_3277 277
1073 3300049822 Ga0501035_0054807 Ga0501035_0054807_221_1063 277
1074 3300049822 Ga0501035_0074309 Ga0501035_0074309_1904_2755 277
1075 3300049823 Ga0501044_0000258 Ga0501044_0000258_61285_62127 277
1076 3300049823 Ga0501044_0007503 Ga0501044_0007503_7340_8191 277
1077 3300049823 Ga0501044_0009609 Ga0501044_0009609_4051_4893 277
1078 3300049823 Ga0501044_0032713 Ga0501044_0032713_1779_2630 277
1079 3300049823 Ga0501044_0066602 Ga0501044_0066602_1601_2449 277
1080 3300049824 Ga0501045_0012008 Ga0501045_0012008_4995_5843 277
1081 3300049824 Ga0501045_0043356 Ga0501045_0043356_2154_3005 277
1082 3300050490 nmdc:mga03n38_71327_c1 nmdc:mga03n38_71327_c1_572_1432 277
1083 3300050512 nmdc:mga0n895_24865_c1 nmdc:mga0n895_24865_c1_2743_3585 277
1084 3300053077 Ga0495601_0009169 Ga0495601_0009169_645_1490 277
1085 3300053077 Ga0495601_0107560 Ga0495601_0107560_757_1599 277
1086 3300053077 Ga0495601_0188965 Ga0495601_0188965_60_902 277
1087 3300053077 Ga0495601_0199885 Ga0495601_0199885_236_1078 277
1088 3300053078 Ga0495612_0078568 Ga0495612_0078568_124_966 277
1089 3300053080 Ga0500635_0001974 Ga0500635_0001974_2087_2929 277
1090 3300053080 Ga0500635_0002613 Ga0500635_0002613_667_1509 277
1091 3300053084 Ga0495595_0000637 Ga0495595_0000637_11324_12169 277
1092 3300053084 Ga0495595_0064823 Ga0495595_0064823_693_1535 277
1093 3300053085 Ga0495619_0001080 Ga0495619_0001080_6217_7062 277
1094 3300053085 Ga0495619_0197915 Ga0495619_0197915_533_1375 277
1095 3300053085 Ga0495619_0219931 Ga0495619_0219931_445_1287 277
1096 3300053094 Ga0500566_0001419 Ga0500566_0001419_185_1039 277
1097 3300053094 Ga0500566_0012672 Ga0500566_0012672_721_1581 277
1098 3300053095 Ga0500640_000253 Ga0500640_000253_170_1024 277
1099 3300053102 Ga0500554_003440 Ga0500554_003440_1175_2017 277
1100 3300053111 Ga0500572_000199 Ga0500572_000199_6813_7667 277
1101 3300053119 Ga0500595_000842 Ga0500595_000842_10363_11223 277
1102 3300053119 Ga0500595_033593 Ga0500595_033593_820_1683 277
1103 3300053122 Ga0500608_103967 Ga0500608_103967_105_965 277
1104 3300053123 Ga0500614_000715 Ga0500614_000715_2906_3760 277
1105 3300053136 Ga0500559_0001308 Ga0500559_0001308_937_1791 277
1106 3300053140 Ga0500573_0008543 Ga0500573_0008543_2038_2898 277
1107 3300053142 Ga0500577_0109173 Ga0500577_0109173_218_1057 277
1108 3300053150 Ga0500603_000226 Ga0500603_000226_11540_12382 277
1109 3300053159 Ga0500630_000573 Ga0500630_000573_4910_5764 277
1110 3300053162 Ga0500638_001609 Ga0500638_001609_6044_6904 277
1111 3300053163 Ga0500639_000006 Ga0500639_000006_151429_152283 277
1112 3300053177 Ga0500636_0013138 Ga0500636_0013138_1545_2405 277
1113 3300053177 Ga0500636_0030340 Ga0500636_0030340_965_1828 277
1114 3300053178 Ga0500637_0000251 Ga0500637_0000251_10387_11247 277
1115 3300053178 Ga0500637_0003349 Ga0500637_0003349_2836_3678 277
1116 3300053178 Ga0500637_0187265 Ga0500637_0187265_218_1060 277
1117 3300053725 Ga0500576_083610 Ga0500576_083610_129_983 277
1118 3300053735 Ga0500596_000603 Ga0500596_000603_2512_3366 277
1119 3300054114 Ga0501084_0007774 Ga0501084_0007774_804_1646 277
1120 3300054114 Ga0501084_0034119 Ga0501084_0034119_14_865 277
1121 3300054114 Ga0501084_0354426 Ga0501084_0354426_69_920 277
1122 3300055283 Ga0500661_001477 Ga0500661_001477_2856_3716 277
1123 3300060353 Ga0501082_0001593 Ga0501082_0001593_9834_10676 277
1124 3300060353 Ga0501082_0018224 Ga0501082_0018224_5030_5881 277
1125 3300060353 Ga0501082_0107881 Ga0501082_0107881_39_887 277
1126 iso_pu_bacteria 2667528175 2671122757 277
1127 iso_pu_bacteria 2744054633 2745078535 277
1128 iso_pu_bacteria 2791355197 2793069607 277
1129 iso_pu_bacteria 2791355199 2793080290 277
1130 iso_pu_bacteria 2906610324 2906615567 277
1131 iso_pu_bacteria 2908756301 2908763684 277
1132 iso_pu_bacteria 8006926726 8006929468 277
1133 iso_pu_bacteria 8019555841 8019563773 277
1134 iso_pu_bacteria 8019565922 8019573838 277
1135 iso_pu_bacteria 8056689827 8056696200 277
1136 3300005530 Ga0070679_100098832 Ga0070679_1000988324 278
1137 3300006042 Ga0075368_10008811 Ga0075368_100088112 278
1138 3300025921 Ga0207652_10144808 Ga0207652_101448082 278
1139 3300031235 Ga0265330_10020221 Ga0265330_100202213 278
1140 3300031711 Ga0265314_10039492 Ga0265314_100394923 278
1141 3300035114 Ga0373939_0002641 Ga0373939_0002641_1260_2192 278
1142 3300037068 Ga0373925_0011034 Ga0373925_0011034_4458_5303 278
1143 3300049568 Ga0501031_0006934 Ga0501031_0006934_1906_2763 278
1144 3300049570 Ga0501033_0001316 Ga0501033_0001316_10711_11568 278
1145 3300049573 Ga0501037_0040958 Ga0501037_0040958_576_1430 278
1146 3300049573 Ga0501037_0067050 Ga0501037_0067050_1239_2096 278
1147 3300049574 Ga0501038_0019522 Ga0501038_0019522_3250_4107 278
1148 3300049574 Ga0501038_0087612 Ga0501038_0087612_618_1475 278
1149 3300049575 Ga0501039_0003437 Ga0501039_0003437_7394_8251 278
1150 3300049575 Ga0501039_0069222 Ga0501039_0069222_1095_1952 278
1151 3300049579 Ga0501043_0000980 Ga0501043_0000980_10501_11358 278
1152 3300049822 Ga0501035_0031489 Ga0501035_0031489_3590_4444 278
1153 3300049822 Ga0501035_0072940 Ga0501035_0072940_84_941 278
1154 3300001989 JGI24739J22299_10000871 JGI24739J22299_1000087110 279
1155 3300001991 JGI24743J22301_10013185 JGI24743J22301_100131852 279
1156 3300002070 JGI24750J21931_1000457 JGI24750J21931_10004572 279
1157 3300002126 JGI24035J26624_1000248 JGI24035J26624_10002481 279
1158 3300005293 Ga0065715_10243240 Ga0065715_102432401 279
1159 3300005327 Ga0070658_10029391 Ga0070658_100293916 279
1160 3300005327 Ga0070658_10044726 Ga0070658_100447261 279
1161 3300005327 Ga0070658_10461582 Ga0070658_104615821 279
1162 3300005328 Ga0070676_10020837 Ga0070676_100208371 279
1163 3300005328 Ga0070676_10165191 Ga0070676_101651912 279
1164 3300005329 Ga0070683_100041896 Ga0070683_1000418964 279
1165 3300005330 Ga0070690_100017313 Ga0070690_1000173133 279
1166 3300005331 Ga0070670_100126553 Ga0070670_1001265532 279
1167 3300005333 Ga0070677_10005521 Ga0070677_100055213 279
1168 3300005334 Ga0068869_100059222 Ga0068869_1000592223 279
1169 3300005335 Ga0070666_10103477 Ga0070666_101034773 279
1170 3300005336 Ga0070680_100003647 Ga0070680_1000036479 279
1171 3300005337 Ga0070682_100007969 Ga0070682_1000079695 279
1172 3300005337 Ga0070682_100028580 Ga0070682_1000285804 279
1173 3300005337 Ga0070682_100030805 Ga0070682_1000308053 279
1174 3300005339 Ga0070660_100003870 Ga0070660_1000038702 279
1175 3300005339 Ga0070660_100019473 Ga0070660_1000194733 279
1176 3300005340 Ga0070689_100031062 Ga0070689_1000310624 279
1177 3300005340 Ga0070689_100258241 Ga0070689_1002582412 279
1178 3300005341 Ga0070691_10004859 Ga0070691_100048592 279
1179 3300005341 Ga0070691_10089795 Ga0070691_100897952 279
1180 3300005344 Ga0070661_100009866 Ga0070661_1000098664 279
1181 3300005344 Ga0070661_100048625 Ga0070661_1000486253 279
1182 3300005344 Ga0070661_100063664 Ga0070661_1000636642 279
1183 3300005347 Ga0070668_100013726 Ga0070668_1000137263 279
1184 3300005353 Ga0070669_100014406 Ga0070669_1000144064 279
1185 3300005354 Ga0070675_100018170 Ga0070675_1000181704 279
1186 3300005355 Ga0070671_100016514 Ga0070671_1000165144 279
1187 3300005355 Ga0070671_100034258 Ga0070671_1000342583 279
1188 3300005356 Ga0070674_100005693 Ga0070674_1000056936 279
1189 3300005364 Ga0070673_100040424 Ga0070673_1000404244 279
1190 3300005364 Ga0070673_100045977 Ga0070673_1000459774 279
1191 3300005364 Ga0070673_100055936 Ga0070673_1000559363 279
1192 3300005366 Ga0070659_100058630 Ga0070659_1000586303 279
1193 3300005366 Ga0070659_100144527 Ga0070659_1001445272 279
1194 3300005367 Ga0070667_100014138 Ga0070667_1000141384 279
1195 3300005367 Ga0070667_100024258 Ga0070667_1000242584 279
1196 3300005406 Ga0070703_10003201 Ga0070703_100032014 279
1197 3300005434 Ga0070709_10013419 Ga0070709_100134194 279
1198 3300005434 Ga0070709_10018177 Ga0070709_100181773 279
1199 3300005435 Ga0070714_100054927 Ga0070714_1000549272 279
1200 3300005435 Ga0070714_100181091 Ga0070714_1001810912 279
1201 3300005435 Ga0070714_100269818 Ga0070714_1002698182 279
1202 3300005435 Ga0070714_100452677 Ga0070714_1004526771 279
1203 3300005436 Ga0070713_100043687 Ga0070713_1000436872 279
1204 3300005436 Ga0070713_100055202 Ga0070713_1000552023 279
1205 3300005436 Ga0070713_100055279 Ga0070713_1000552794 279
1206 3300005437 Ga0070710_10002325 Ga0070710_100023258 279
1207 3300005437 Ga0070710_10072646 Ga0070710_100726462 279
1208 3300005438 Ga0070701_10004348 Ga0070701_100043483 279
1209 3300005439 Ga0070711_100011944 Ga0070711_1000119444 279
1210 3300005439 Ga0070711_100187418 Ga0070711_1001874182 279
1211 3300005439 Ga0070711_100237930 Ga0070711_1002379301 279
1212 3300005440 Ga0070705_100023373 Ga0070705_1000233732 279
1213 3300005441 Ga0070700_100199792 Ga0070700_1001997921 279
1214 3300005444 Ga0070694_100019693 Ga0070694_1000196934 279
1215 3300005445 Ga0070708_100130012 Ga0070708_1001300122 279
1216 3300005455 Ga0070663_100027341 Ga0070663_1000273414 279
1217 3300005456 Ga0070678_100022020 Ga0070678_1000220201 279
1218 3300005457 Ga0070662_100033312 Ga0070662_1000333124 279
1219 3300005457 Ga0070662_100164122 Ga0070662_1001641221 279
1220 3300005458 Ga0070681_10023502 Ga0070681_100235022 279
1221 3300005458 Ga0070681_10032947 Ga0070681_100329474 279
1222 3300005459 Ga0068867_100021271 Ga0068867_1000212713 279
1223 3300005459 Ga0068867_100128322 Ga0068867_1001283222 279
1224 3300005466 Ga0070685_10074353 Ga0070685_100743531 279
1225 3300005530 Ga0070679_100342777 Ga0070679_1003427772 279
1226 3300005535 Ga0070684_100022473 Ga0070684_1000224734 279
1227 3300005535 Ga0070684_100271447 Ga0070684_1002714471 279
1228 3300005539 Ga0068853_100003634 Ga0068853_1000036349 279
1229 3300005539 Ga0068853_100175843 Ga0068853_1001758432 279
1230 3300005543 Ga0070672_100006742 Ga0070672_1000067426 279
1231 3300005544 Ga0070686_100116734 Ga0070686_1001167341 279
1232 3300005545 Ga0070695_100027274 Ga0070695_1000272744 279
1233 3300005546 Ga0070696_100027513 Ga0070696_1000275134 279
1234 3300005547 Ga0070693_100031082 Ga0070693_1000310824 279
1235 3300005548 Ga0070665_100065216 Ga0070665_1000652164 279
1236 3300005549 Ga0070704_100025802 Ga0070704_1000258021 279
1237 3300005563 Ga0068855_100018412 Ga0068855_1000184124 279
1238 3300005563 Ga0068855_100112477 Ga0068855_1001124773 279
1239 3300005563 Ga0068855_100262469 Ga0068855_1002624692 279
1240 3300005563 Ga0068855_100410537 Ga0068855_1004105372 279
1241 3300005563 Ga0068855_100432165 Ga0068855_1004321652 279
1242 3300005564 Ga0070664_100047876 Ga0070664_1000478764 279
1243 3300005564 Ga0070664_100069419 Ga0070664_1000694194 279
1244 3300005578 Ga0068854_100016856 Ga0068854_1000168562 279
1245 3300005578 Ga0068854_100155813 Ga0068854_1001558132 279
1246 3300005614 Ga0068856_100024188 Ga0068856_1000241886 279
1247 3300005614 Ga0068856_100074006 Ga0068856_1000740064 279
1248 3300005614 Ga0068856_100116233 Ga0068856_1001162332 279
1249 3300005614 Ga0068856_100180758 Ga0068856_1001807582 279
1250 3300005614 Ga0068856_100298360 Ga0068856_1002983602 279
1251 3300005614 Ga0068856_100320920 Ga0068856_1003209202 279
1252 3300005615 Ga0070702_100046391 Ga0070702_1000463911 279
1253 3300005615 Ga0070702_100149746 Ga0070702_1001497461 279
1254 3300005616 Ga0068852_100026321 Ga0068852_1000263212 279
1255 3300005616 Ga0068852_100212283 Ga0068852_1002122832 279
1256 3300005616 Ga0068852_100545435 Ga0068852_1005454351 279
1257 3300005617 Ga0068859_100035913 Ga0068859_1000359134 279
1258 3300005617 Ga0068859_100485774 Ga0068859_1004857741 279
1259 3300005618 Ga0068864_100026533 Ga0068864_1000265332 279
1260 3300005618 Ga0068864_100287017 Ga0068864_1002870172 279
1261 3300005718 Ga0068866_10022841 Ga0068866_100228413 279
1262 3300005719 Ga0068861_100019676 Ga0068861_1000196764 279
1263 3300005841 Ga0068863_100006825 Ga0068863_1000068254 279
1264 3300005842 Ga0068858_100127566 Ga0068858_1001275662 279
1265 3300005843 Ga0068860_100018432 Ga0068860_1000184324 279
1266 3300005844 Ga0068862_100010222 Ga0068862_1000102224 279
1267 3300005937 Ga0081455_10000200 Ga0081455_1000020053 279
1268 3300005937 Ga0081455_10000768 Ga0081455_1000076816 279
1269 3300006028 Ga0070717_10034264 Ga0070717_100342645 279
1270 3300006028 Ga0070717_10351343 Ga0070717_103513431 279
1271 3300006173 Ga0070716_100012612 Ga0070716_1000126123 279
1272 3300006173 Ga0070716_100078406 Ga0070716_1000784063 279
1273 3300006178 Ga0075367_10048065 Ga0075367_100480652 279
1274 3300006194 Ga0075427_10000041 Ga0075427_100000414 279
1275 3300006237 Ga0097621_100011867 Ga0097621_1000118674 279
1276 3300006237 Ga0097621_100024301 Ga0097621_1000243011 279
1277 3300006358 Ga0068871_100019303 Ga0068871_1000193035 279
1278 3300006358 Ga0068871_100157136 Ga0068871_1001571361 279
1279 3300006358 Ga0068871_100300703 Ga0068871_1003007032 279
1280 3300006844 Ga0075428_100003399 Ga0075428_1000033992 279
1281 3300006846 Ga0075430_100000133 Ga0075430_10000013320 279
1282 3300006847 Ga0075431_100002259 Ga0075431_10000225915 279
1283 3300006852 Ga0075433_10000506 Ga0075433_100005067 279
1284 3300006852 Ga0075433_10025119 Ga0075433_100251194 279
1285 3300006852 Ga0075433_10038792 Ga0075433_100387925 279
1286 3300006871 Ga0075434_100000472 Ga0075434_1000004726 279
1287 3300006871 Ga0075434_100008091 Ga0075434_1000080914 279
1288 3300006871 Ga0075434_100044057 Ga0075434_1000440574 279
1289 3300006871 Ga0075434_100068627 Ga0075434_1000686272 279
1290 3300006871 Ga0075434_100386460 Ga0075434_1003864603 279
1291 3300006871 Ga0075434_100411167 Ga0075434_1004111672 279
1292 3300006880 Ga0075429_100000163 Ga0075429_10000016320 279
1293 3300006881 Ga0068865_100001544 Ga0068865_10000154411 279
1294 3300006881 Ga0068865_100003466 Ga0068865_1000034663 279
1295 3300006881 Ga0068865_100362686 Ga0068865_1003626862 279
1296 3300006931 Ga0097620_100035916 Ga0097620_1000359164 279
1297 3300006931 Ga0097620_100485755 Ga0097620_1004857551 279
1298 3300007076 Ga0075435_100017200 Ga0075435_1000172004 279
1299 3300007076 Ga0075435_100056759 Ga0075435_1000567592 279
1300 3300009011 Ga0105251_10010431 Ga0105251_100104315 279
1301 3300009093 Ga0105240_10023552 Ga0105240_100235523 279
1302 3300009093 Ga0105240_10039692 Ga0105240_100396925 279
1303 3300009093 Ga0105240_10092782 Ga0105240_100927823 279
1304 3300009093 Ga0105240_10427362 Ga0105240_104273622 279
1305 3300009094 Ga0111539_10000389 Ga0111539_1000038930 279
1306 3300009094 Ga0111539_10001808 Ga0111539_100018084 279
1307 3300009098 Ga0105245_10031587 Ga0105245_100315874 279
1308 3300009101 Ga0105247_10031859 Ga0105247_100318594 279
1309 3300009147 Ga0114129_10018380 Ga0114129_100183806 279
1310 3300009147 Ga0114129_10609708 Ga0114129_106097082 279
1311 3300009148 Ga0105243_10040850 Ga0105243_100408502 279
1312 3300009174 Ga0105241_10024018 Ga0105241_100240184 279
1313 3300009174 Ga0105241_10031108 Ga0105241_100311082 279
1314 3300009176 Ga0105242_10082937 Ga0105242_100829373 279
1315 3300009176 Ga0105242_10271376 Ga0105242_102713762 279
1316 3300009177 Ga0105248_10011779 Ga0105248_100117797 279
1317 3300009177 Ga0105248_10046950 Ga0105248_100469506 279
1318 3300009545 Ga0105237_10007432 Ga0105237_100074324 279
1319 3300009545 Ga0105237_10410939 Ga0105237_104109391 279
1320 3300009551 Ga0105238_10045455 Ga0105238_100454553 279
1321 3300009551 Ga0105238_10064854 Ga0105238_100648542 279
1322 3300009551 Ga0105238_10110436 Ga0105238_101104362 279
1323 3300009553 Ga0105249_10019871 Ga0105249_100198714 279
1324 3300009553 Ga0105249_10067975 Ga0105249_100679754 279
1325 3300010375 Ga0105239_10043179 Ga0105239_100431794 279
1326 3300010375 Ga0105239_10322586 Ga0105239_103225862 279
1327 3300012513 Ga0157326_1008038 Ga0157326_10080381 279
1328 3300013100 Ga0157373_10024897 Ga0157373_100248973 279
1329 3300013100 Ga0157373_10204840 Ga0157373_102048402 279
1330 3300013102 Ga0157371_10036676 Ga0157371_100366762 279
1331 3300013102 Ga0157371_10128334 Ga0157371_101283341 279
1332 3300013102 Ga0157371_10158591 Ga0157371_101585912 279
1333 3300013104 Ga0157370_10041078 Ga0157370_100410784 279
1334 3300013104 Ga0157370_10181306 Ga0157370_101813062 279
1335 3300013104 Ga0157370_10238914 Ga0157370_102389142 279
1336 3300013105 Ga0157369_10236445 Ga0157369_102364452 279
1337 3300013105 Ga0157369_10386899 Ga0157369_103868992 279
1338 3300013105 Ga0157369_10522628 Ga0157369_105226281 279
1339 3300013296 Ga0157374_10002692 Ga0157374_1000269214 279
1340 3300013297 Ga0157378_10049119 Ga0157378_100491194 279
1341 3300013297 Ga0157378_10396452 Ga0157378_103964521 279
1342 3300013306 Ga0163162_10022234 Ga0163162_100222345 279
1343 3300013306 Ga0163162_10107677 Ga0163162_101076771 279
1344 3300013306 Ga0163162_10198425 Ga0163162_101984251 279
1345 3300013307 Ga0157372_10016582 Ga0157372_100165825 279
1346 3300013307 Ga0157372_10423344 Ga0157372_104233442 279
1347 3300014745 Ga0157377_10013798 Ga0157377_100137984 279
1348 3300014968 Ga0157379_10027560 Ga0157379_100275603 279
1349 3300014969 Ga0157376_10113532 Ga0157376_101135322 279
1350 3300017792 Ga0163161_10006229 Ga0163161_100062294 279
1351 3300017792 Ga0163161_10035277 Ga0163161_100352773 279
1352 3300017792 Ga0163161_10039404 Ga0163161_100394042 279
1353 3300020070 Ga0206356_10553992 Ga0206356_105539921 279
1354 3300020070 Ga0206356_11532789 Ga0206356_115327892 279
1355 3300020081 Ga0206354_11292144 Ga0206354_112921442 279
1356 3300025271 Ga0207666_1000311 Ga0207666_10003114 279
1357 3300025315 Ga0207697_10006626 Ga0207697_100066264 279
1358 3300025735 Ga0207713_1077773 Ga0207713_10777732 279
1359 3300025885 Ga0207653_10002805 Ga0207653_100028054 279
1360 3300025893 Ga0207682_10000009 Ga0207682_1000000966 279
1361 3300025898 Ga0207692_10069546 Ga0207692_100695462 279
1362 3300025900 Ga0207710_10001303 Ga0207710_100013032 279
1363 3300025901 Ga0207688_10000892 Ga0207688_1000089213 279
1364 3300025903 Ga0207680_10016229 Ga0207680_100162293 279
1365 3300025903 Ga0207680_10058944 Ga0207680_100589441 279
1366 3300025904 Ga0207647_10002160 Ga0207647_1000216013 279
1367 3300025904 Ga0207647_10110563 Ga0207647_101105631 279
1368 3300025905 Ga0207685_10051712 Ga0207685_100517121 279
1369 3300025906 Ga0207699_10007734 Ga0207699_100077341 279
1370 3300025906 Ga0207699_10033250 Ga0207699_100332502 279
1371 3300025907 Ga0207645_10000999 Ga0207645_1000099919 279
1372 3300025907 Ga0207645_10066806 Ga0207645_100668063 279
1373 3300025911 Ga0207654_10015616 Ga0207654_100156163 279
1374 3300025911 Ga0207654_10025829 Ga0207654_100258292 279
1375 3300025911 Ga0207654_10040703 Ga0207654_100407032 279
1376 3300025912 Ga0207707_10020542 Ga0207707_100205425 279
1377 3300025912 Ga0207707_10062664 Ga0207707_100626643 279
1378 3300025913 Ga0207695_10057960 Ga0207695_100579603 279
1379 3300025913 Ga0207695_10155565 Ga0207695_101555653 279
1380 3300025914 Ga0207671_10035416 Ga0207671_100354162 279
1381 3300025915 Ga0207693_10006473 Ga0207693_100064736 279
1382 3300025915 Ga0207693_10007042 Ga0207693_100070428 279
1383 3300025915 Ga0207693_10091642 Ga0207693_100916422 279
1384 3300025915 Ga0207693_10327417 Ga0207693_103274171 279
1385 3300025916 Ga0207663_10212720 Ga0207663_102127202 279
1386 3300025917 Ga0207660_10001283 Ga0207660_100012834 279
1387 3300025917 Ga0207660_10042221 Ga0207660_100422213 279
1388 3300025917 Ga0207660_10178226 Ga0207660_101782261 279
1389 3300025918 Ga0207662_10000025 Ga0207662_1000002565 279
1390 3300025918 Ga0207662_10010323 Ga0207662_100103232 279
1391 3300025919 Ga0207657_10012765 Ga0207657_100127653 279
1392 3300025919 Ga0207657_10018108 Ga0207657_100181084 279
1393 3300025919 Ga0207657_10161621 Ga0207657_101616212 279
1394 3300025919 Ga0207657_10166069 Ga0207657_101660692 279
1395 3300025919 Ga0207657_10231905 Ga0207657_102319052 279
1396 3300025920 Ga0207649_10002186 Ga0207649_100021867 279
1397 3300025920 Ga0207649_10025741 Ga0207649_100257412 279
1398 3300025920 Ga0207649_10303134 Ga0207649_103031342 279
1399 3300025920 Ga0207649_10318780 Ga0207649_103187801 279
1400 3300025921 Ga0207652_10075776 Ga0207652_100757762 279
1401 3300025921 Ga0207652_10179454 Ga0207652_101794542 279
1402 3300025921 Ga0207652_10322632 Ga0207652_103226322 279
1403 3300025921 Ga0207652_10345915 Ga0207652_103459151 279
1404 3300025923 Ga0207681_10007074 Ga0207681_100070744 279
1405 3300025924 Ga0207694_10045928 Ga0207694_100459282 279
1406 3300025926 Ga0207659_10177614 Ga0207659_101776141 279
1407 3300025927 Ga0207687_10003202 Ga0207687_100032021 279
1408 3300025928 Ga0207700_10004367 Ga0207700_100043673 279
1409 3300025928 Ga0207700_10076952 Ga0207700_100769522 279
1410 3300025929 Ga0207664_10022280 Ga0207664_100222802 279
1411 3300025929 Ga0207664_10130661 Ga0207664_101306612 279
1412 3300025931 Ga0207644_10032924 Ga0207644_100329243 279
1413 3300025931 Ga0207644_10036076 Ga0207644_100360762 279
1414 3300025932 Ga0207690_10011755 Ga0207690_100117554 279
1415 3300025932 Ga0207690_10064867 Ga0207690_100648672 279
1416 3300025932 Ga0207690_10088473 Ga0207690_100884732 279
1417 3300025933 Ga0207706_10005363 Ga0207706_1000536310 279
1418 3300025933 Ga0207706_10040844 Ga0207706_100408444 279
1419 3300025934 Ga0207686_10014315 Ga0207686_100143154 279
1420 3300025935 Ga0207709_10012682 Ga0207709_100126822 279
1421 3300025935 Ga0207709_10024392 Ga0207709_100243921 279
1422 3300025936 Ga0207670_10013997 Ga0207670_100139974 279
1423 3300025936 Ga0207670_10078501 Ga0207670_100785013 279
1424 3300025936 Ga0207670_10375891 Ga0207670_103758911 279
1425 3300025937 Ga0207669_10001324 Ga0207669_100013249 279
1426 3300025937 Ga0207669_10084772 Ga0207669_100847721 279
1427 3300025938 Ga0207704_10003457 Ga0207704_100034574 279
1428 3300025939 Ga0207665_10002113 Ga0207665_100021135 279
1429 3300025939 Ga0207665_10108803 Ga0207665_101088032 279
1430 3300025940 Ga0207691_10002604 Ga0207691_100026044 279
1431 3300025940 Ga0207691_10365968 Ga0207691_103659681 279
1432 3300025941 Ga0207711_10001071 Ga0207711_1000107121 279
1433 3300025941 Ga0207711_10106384 Ga0207711_101063841 279
1434 3300025942 Ga0207689_10001156 Ga0207689_1000115622 279
1435 3300025942 Ga0207689_10031636 Ga0207689_100316364 279
1436 3300025944 Ga0207661_10007789 Ga0207661_100077895 279
1437 3300025944 Ga0207661_10062965 Ga0207661_100629654 279
1438 3300025945 Ga0207679_10003209 Ga0207679_100032092 279
1439 3300025945 Ga0207679_10417424 Ga0207679_104174242 279
1440 3300025949 Ga0207667_10013288 Ga0207667_100132884 279
1441 3300025949 Ga0207667_10028603 Ga0207667_100286038 279
1442 3300025949 Ga0207667_10077987 Ga0207667_100779872 279
1443 3300025949 Ga0207667_10123806 Ga0207667_101238064 279
1444 3300025949 Ga0207667_10128039 Ga0207667_101280393 279
1445 3300025960 Ga0207651_10008497 Ga0207651_100084973 279
1446 3300025960 Ga0207651_10151130 Ga0207651_101511302 279
1447 3300025961 Ga0207712_10000579 Ga0207712_100005794 279
1448 3300025972 Ga0207668_10001403 Ga0207668_100014037 279
1449 3300025981 Ga0207640_10003644 Ga0207640_100036444 279
1450 3300025981 Ga0207640_10558073 Ga0207640_105580731 279
1451 3300025986 Ga0207658_10018420 Ga0207658_100184203 279
1452 3300026023 Ga0207677_10117181 Ga0207677_101171812 279
1453 3300026035 Ga0207703_10008872 Ga0207703_100088724 279
1454 3300026035 Ga0207703_10014416 Ga0207703_100144164 279
1455 3300026035 Ga0207703_10184537 Ga0207703_101845372 279
1456 3300026041 Ga0207639_10001866 Ga0207639_1000186611 279
1457 3300026041 Ga0207639_10135429 Ga0207639_101354292 279
1458 3300026067 Ga0207678_10042596 Ga0207678_100425964 279
1459 3300026067 Ga0207678_10145100 Ga0207678_101451001 279
1460 3300026075 Ga0207708_10130549 Ga0207708_101305492 279
1461 3300026078 Ga0207702_10010946 Ga0207702_100109463 279
1462 3300026078 Ga0207702_10098432 Ga0207702_100984322 279
1463 3300026078 Ga0207702_10160482 Ga0207702_101604822 279
1464 3300026078 Ga0207702_10249986 Ga0207702_102499862 279
1465 3300026088 Ga0207641_10006404 Ga0207641_100064044 279
1466 3300026088 Ga0207641_10051015 Ga0207641_100510152 279
1467 3300026089 Ga0207648_10004627 Ga0207648_1000462712 279
1468 3300026095 Ga0207676_10030863 Ga0207676_100308634 279
1469 3300026116 Ga0207674_10246718 Ga0207674_102467182 279
1470 3300026118 Ga0207675_100003859 Ga0207675_10000385913 279
1471 3300026118 Ga0207675_100108300 Ga0207675_1001083002 279
1472 3300026118 Ga0207675_100533979 Ga0207675_1005339791 279
1473 3300026121 Ga0207683_10000782 Ga0207683_1000078220 279
1474 3300026121 Ga0207683_10000850 Ga0207683_100008504 279
1475 3300026121 Ga0207683_10304839 Ga0207683_103048392 279
1476 3300026142 Ga0207698_10007574 Ga0207698_100075745 279
1477 3300027717 Ga0209998_10002588 Ga0209998_100025883 279
1478 3300027876 Ga0209974_10003747 Ga0209974_100037475 279
1479 3300027907 Ga0207428_10000164 Ga0207428_1000016445 279
1480 3300027907 Ga0207428_10000391 Ga0207428_1000039130 279
1481 3300028379 Ga0268266_10002016 Ga0268266_100020166 279
1482 3300028379 Ga0268266_10499031 Ga0268266_104990311 279
1483 3300028380 Ga0268265_10004025 Ga0268265_100040259 279
1484 3300028381 Ga0268264_10049152 Ga0268264_100491521 279
1485 3300028800 Ga0265338_10059137 Ga0265338_100591372 279
1486 3300031235 Ga0265330_10067423 Ga0265330_100674232 279
1487 3300031241 Ga0265325_10000019 Ga0265325_1000001956 279
1488 3300031595 Ga0265313_10022283 Ga0265313_100222834 279
1489 3300031595 Ga0265313_10024531 Ga0265313_100245313 279
1490 3300031691 Ga0316579_10019886 Ga0316579_100198862 279
1491 3300031712 Ga0265342_10001257 Ga0265342_100012575 279
1492 3300034820 Ga0373959_0023004 Ga0373959_0023004_283_1122 279
1493 3300034957 Ga0373938_0006998 Ga0373938_0006998_904_1743 279
1494 3300035083 Ga0373926_0000388 Ga0373926_0000388_7448_8287 279
1495 3300035085 Ga0373929_0004760 Ga0373929_0004760_1006_1845 279
1496 3300035089 Ga0373944_0002538 Ga0373944_0002538_723_1562 279
1497 3300035090 Ga0373949_0006564 Ga0373949_0006564_646_1485 279
1498 3300035090 Ga0373949_0022292 Ga0373949_0022292_541_1380 279
1499 3300035092 Ga0373952_0000933 Ga0373952_0000933_2470_3309 279
1500 3300035111 Ga0373923_0043642 Ga0373923_0043642_942_1781 279
1501 3300035112 Ga0373932_0003751 Ga0373932_0003751_901_1740 279
1502 3300035112 Ga0373932_0020639 Ga0373932_0020639_813_1652 279
1503 3300035114 Ga0373939_0003090 Ga0373939_0003090_901_1740 279
1504 3300035114 Ga0373939_0062364 Ga0373939_0062364_116_955 279
1505 3300035115 Ga0373941_0014083 Ga0373941_0014083_738_1577 279
1506 3300035116 Ga0373945_0011447 Ga0373945_0011447_1565_2404 279
1507 3300035117 Ga0373953_0018244 Ga0373953_0018244_1514_2353 279
1508 3300035117 Ga0373953_0051706 Ga0373953_0051706_717_1556 279
1509 3300035118 Ga0373954_0001219 Ga0373954_0001219_2927_3766 279
1510 3300035119 Ga0373956_0025442 Ga0373956_0025442_1000_1839 279
1511 3300035120 Ga0373957_0003464 Ga0373957_0003464_665_1504 279
1512 3300035170 Ga0373943_0001607 Ga0373943_0001607_2944_3783 279
1513 3300035170 Ga0373943_0033149 Ga0373943_0033149_1205_2044 279
1514 3300035170 Ga0373943_0165362 Ga0373943_0165362_305_1144 279
1515 3300035171 Ga0373946_0020904 Ga0373946_0020904_1544_2383 279
1516 3300035171 Ga0373946_0027110 Ga0373946_0027110_214_1053 279
1517 3300035172 Ga0373955_0005330 Ga0373955_0005330_209_1048 279
1518 3300035172 Ga0373955_0012895 Ga0373955_0012895_1739_2578 279
1519 3300035207 Ga0373942_0006671 Ga0373942_0006671_402_1241 279
1520 3300035207 Ga0373942_0031660 Ga0373942_0031660_545_1384 279
1521 3300035241 Ga0373961_0002775 Ga0373961_0002775_3396_4235 279
1522 3300035691 Ga0373931_0002611 Ga0373931_0002611_1611_2450 279
1523 3300035691 Ga0373931_0344444 Ga0373931_0344444_19_858 279
1524 3300035692 Ga0373935_0027111 Ga0373935_0027111_2625_3464 279
1525 3300035692 Ga0373935_0042617 Ga0373935_0042617_1652_2491 279
1526 3300035692 Ga0373935_0057366 Ga0373935_0057366_156_995 279
1527 3300035692 Ga0373935_0057406 Ga0373935_0057406_61_900 279
1528 3300035695 Ga0373927_0021674 Ga0373927_0021674_2244_3083 279
1529 3300035695 Ga0373927_0041261 Ga0373927_0041261_2034_2873 279
1530 3300035724 Ga0373933_0002658 Ga0373933_0002658_3835_4674 279
1531 3300035724 Ga0373933_0034817 Ga0373933_0034817_1999_2838 279
1532 3300035724 Ga0373933_0188029 Ga0373933_0188029_459_1298 279
1533 3300035725 Ga0373947_0003382 Ga0373947_0003382_5549_6388 279
1534 3300035725 Ga0373947_0026670 Ga0373947_0026670_1280_2119 279
1535 3300035725 Ga0373947_0101412 Ga0373947_0101412_286_1125 279
1536 3300036401 Ga0373937_0021334 Ga0373937_0021334_1111_1950 279
1537 3300036401 Ga0373937_0194847 Ga0373937_0194847_229_1068 279
1538 3300036647 Ga0316582_0023146 Ga0316582_0023146_2203_3174 279
1539 3300037068 Ga0373925_0001434 Ga0373925_0001434_16717_17556 279
1540 3300037068 Ga0373925_0015076 Ga0373925_0015076_2749_3588 279
1541 3300037068 Ga0373925_0170838 Ga0373925_0170838_855_1694 279
1542 3300046454 Ga0495592_0038867 Ga0495592_0038867_1896_2735 279
1543 3300046454 Ga0495592_0087914 Ga0495592_0087914_794_1633 279
1544 3300046455 Ga0495603_0017749 Ga0495603_0017749_3119_3958 279
1545 3300046459 Ga0495629_0000139 Ga0495629_0000139_33231_34070 279
1546 3300046459 Ga0495629_0029920 Ga0495629_0029920_170_1009 279
1547 3300046459 Ga0495629_0051611 Ga0495629_0051611_1942_2781 279
1548 3300046459 Ga0495629_0225033 Ga0495629_0225033_22_861 279
1549 3300046461 Ga0495641_0029301 Ga0495641_0029301_209_1048 279
1550 3300046462 Ga0495651_0004984 Ga0495651_0004984_3477_4316 279
1551 3300046462 Ga0495651_0014000 Ga0495651_0014000_908_1747 279
1552 3300046463 Ga0495653_0004257 Ga0495653_0004257_7226_8065 279
1553 3300046472 Ga0495580_0009072 Ga0495580_0009072_2040_2879 279
1554 3300046473 Ga0495582_0001850 Ga0495582_0001850_3331_4170 279
1555 3300046473 Ga0495582_0038297 Ga0495582_0038297_169_1008 279
1556 3300046477 Ga0495664_0038052 Ga0495664_0038052_1666_2505 279
1557 3300046491 Ga0495584_0001897 Ga0495584_0001897_9374_10213 279
1558 3300046491 Ga0495584_0039510 Ga0495584_0039510_484_1323 279
1559 3300046492 Ga0495585_0001030 Ga0495585_0001030_7945_8784 279
1560 3300046499 Ga0495594_0005795 Ga0495594_0005795_5279_6118 279
1561 3300046501 Ga0495607_0006002 Ga0495607_0006002_894_1733 279
1562 3300046511 Ga0495608_0000911 Ga0495608_0000911_12393_13232 279
1563 3300046514 Ga0495618_0003586 Ga0495618_0003586_3463_4302 279
1564 3300046514 Ga0495618_0021739 Ga0495618_0021739_1128_1967 279
1565 3300046516 Ga0495628_0005614 Ga0495628_0005614_3836_4675 279
1566 3300046516 Ga0495628_0157361 Ga0495628_0157361_278_1117 279
1567 3300046523 Ga0495644_0000513 Ga0495644_0000513_6667_7506 279
1568 3300046525 Ga0495663_0002372 Ga0495663_0002372_432_1271 279
1569 3300046526 Ga0495666_0168340 Ga0495666_0168340_141_980 279
1570 3300046529 Ga0495652_0028137 Ga0495652_0028137_2949_3788 279
1571 3300046529 Ga0495652_0076180 Ga0495652_0076180_1710_2549 279
1572 3300046529 Ga0495652_0270423 Ga0495652_0270423_152_991 279
1573 3300046531 Ga0495665_0026195 Ga0495665_0026195_767_1606 279
1574 3300046533 Ga0495640_0053786 Ga0495640_0053786_180_1019 279
1575 3300046533 Ga0495640_0092694 Ga0495640_0092694_865_1704 279
1576 3300046536 Ga0495587_0094947 Ga0495587_0094947_660_1499 279
1577 3300046536 Ga0495587_0134777 Ga0495587_0134777_384_1223 279
1578 3300046538 Ga0495609_0017406 Ga0495609_0017406_425_1264 279
1579 3300046543 Ga0495645_0011340 Ga0495645_0011340_4973_5812 279
1580 3300046558 Ga0495633_0024926 Ga0495633_0024926_1527_2366 279
1581 3300046559 Ga0495667_0010518 Ga0495667_0010518_1375_2214 279
1582 3300046559 Ga0495667_0096798 Ga0495667_0096798_259_1098 279
1583 3300046615 Ga0495656_0000091 Ga0495656_0000091_22081_22920 279
1584 3300046642 Ga0495634_0110477 Ga0495634_0110477_618_1457 279
1585 3300046648 Ga0495611_0007030 Ga0495611_0007030_3044_3883 279
1586 3300046663 Ga0495635_0011194 Ga0495635_0011194_2185_3024 279
1587 3300046664 Ga0495659_0000632 Ga0495659_0000632_5600_6439 279
1588 3300046665 Ga0495661_0010120 Ga0495661_0010120_1612_2451 279
1589 3300046675 Ga0495657_0019481 Ga0495657_0019481_1269_2108 279
1590 3300046675 Ga0495657_0034720 Ga0495657_0034720_1268_2107 279
1591 3300046675 Ga0495657_0194463 Ga0495657_0194463_243_1082 279
1592 3300046678 Ga0495599_0028704 Ga0495599_0028704_2283_3122 279
1593 3300046679 Ga0495623_0002783 Ga0495623_0002783_4482_5321 279
1594 3300046680 Ga0495646_0014188 Ga0495646_0014188_3706_4545 279
1595 3300046680 Ga0495646_0119405 Ga0495646_0119405_366_1205 279
1596 3300046681 Ga0495647_0002436 Ga0495647_0002436_2237_3076 279
1597 3300046681 Ga0495647_0019267 Ga0495647_0019267_945_1784 279
1598 3300046681 Ga0495647_0074495 Ga0495647_0074495_25_864 279
1599 3300046683 Ga0495658_0000065 Ga0495658_0000065_23259_24098 279
1600 3300046683 Ga0495658_0008416 Ga0495658_0008416_2460_3299 279
1601 3300046683 Ga0495658_0066140 Ga0495658_0066140_595_1434 279
1602 3300046683 Ga0495658_0365868 Ga0495658_0365868_48_887 279
1603 3300046689 Ga0495613_0010328 Ga0495613_0010328_1215_2054 279
1604 3300046689 Ga0495613_0078788 Ga0495613_0078788_1458_2297 279
1605 3300046690 Ga0495624_0050807 Ga0495624_0050807_1636_2475 279
1606 3300046691 Ga0495670_0000199 Ga0495670_0000199_25288_26127 279
1607 3300046794 Ga0495589_0021779 Ga0495589_0021779_2381_3220 279
1608 3300046809 Ga0495600_0030346 Ga0495600_0030346_2616_3455 279
1609 3300047315 Ga0495581_0024475 Ga0495581_0024475_1422_2261 279
1610 3300047317 Ga0495604_0056249 Ga0495604_0056249_1629_2468 279
1611 3300047318 Ga0495636_0046361 Ga0495636_0046361_504_1343 279
1612 3300047319 Ga0495674_0047281 Ga0495674_0047281_1074_1913 279
1613 3300047319 Ga0495674_0051263 Ga0495674_0051263_906_1745 279
1614 3300047322 Ga0495680_0012071 Ga0495680_0012071_906_1745 279
1615 3300047322 Ga0495680_0017326 Ga0495680_0017326_828_1667 279
1616 3300047322 Ga0495680_0043618 Ga0495680_0043618_2560_3399 279
1617 3300047444 Ga0495675_0152222 Ga0495675_0152222_196_1035 279
1618 3300047446 Ga0495679_028585 Ga0495679_028585_337_1176 279
1619 3300047471 Ga0495684_0001073 Ga0495684_0001073_11764_12603 279
1620 3300047471 Ga0495684_0052644 Ga0495684_0052644_2207_3046 279
1621 3300047471 Ga0495684_0116868 Ga0495684_0116868_364_1203 279
1622 3300047673 Ga0495593_0002018 Ga0495593_0002018_11060_11899 279
1623 3300047673 Ga0495593_0003557 Ga0495593_0003557_3059_3898 279
1624 3300048088 Ga0495602_0019419 Ga0495602_0019419_3919_4758 279
1625 3300048088 Ga0495602_0027637 Ga0495602_0027637_903_1742 279
1626 3300048904 Ga0496101_0046113 Ga0496101_0046113_693_1532 279
1627 3300048904 Ga0496101_0106497 Ga0496101_0106497_1221_2060 279
1628 3300048905 Ga0496102_0022366 Ga0496102_0022366_1578_2417 279
1629 3300048906 Ga0496103_0199908 Ga0496103_0199908_426_1265 279
1630 3300048907 Ga0496104_0065417 Ga0496104_0065417_812_1651 279
1631 3300048907 Ga0496104_0322350 Ga0496104_0322350_492_1331 279
1632 3300048908 Ga0496105_0011205 Ga0496105_0011205_2915_3754 279
1633 3300048908 Ga0496105_0019532 Ga0496105_0019532_2292_3131 279
1634 3300048908 Ga0496105_0291129 Ga0496105_0291129_401_1240 279
1635 3300048909 Ga0496106_0003446 Ga0496106_0003446_3809_4648 279
1636 3300048909 Ga0496106_0007383 Ga0496106_0007383_6884_7723 279
1637 3300048910 Ga0496107_0000509 Ga0496107_0000509_12474_13313 279
1638 3300048910 Ga0496107_0037811 Ga0496107_0037811_369_1208 279
1639 3300048911 Ga0496108_0141329 Ga0496108_0141329_182_1021 279
1640 3300048912 Ga0496109_0020639 Ga0496109_0020639_1879_2718 279
1641 3300048912 Ga0496109_0082674 Ga0496109_0082674_1872_2711 279
1642 3300048912 Ga0496109_0086401 Ga0496109_0086401_942_1781 279
1643 3300048914 Ga0496111_0039373 Ga0496111_0039373_956_1795 279
1644 3300048916 Ga0496113_0041662 Ga0496113_0041662_12_851 279
1645 3300048916 Ga0496113_0316048 Ga0496113_0316048_401_1240 279
1646 3300048917 Ga0496114_0001306 Ga0496114_0001306_12251_13090 279
1647 3300048917 Ga0496114_0084963 Ga0496114_0084963_1555_2394 279
1648 3300048917 Ga0496114_0198573 Ga0496114_0198573_373_1212 279
1649 3300048918 Ga0496115_0098174 Ga0496115_0098174_1046_1885 279
1650 3300048918 Ga0496115_0146012 Ga0496115_0146012_1030_1869 279
1651 3300048922 Ga0496119_0138407 Ga0496119_0138407_195_1034 279
1652 3300049571 Ga0501034_0199578 Ga0501034_0199578_535_1452 279
1653 3300049571 Ga0501034_0214716 Ga0501034_0214716_333_1256 279
1654 3300049581 Ga0501047_0181618 Ga0501047_0181618_825_1745 279
1655 3300049823 Ga0501044_0141974 Ga0501044_0141974_727_1668 279
1656 3300050494 nmdc:mga06z11_33296_c1 nmdc:mga06z11_33296_c1_687_1526 279
1657 3300050507 nmdc:mga05p37_151_c1 nmdc:mga05p37_151_c1_34747_35586 279
1658 3300050507 nmdc:mga05p37_7272_c1 nmdc:mga05p37_7272_c1_11149_11988 279
1659 3300050509 nmdc:mga0qj67_9689_c1 nmdc:mga0qj67_9689_c1_1988_2827 279
1660 3300050510 nmdc:mga06r32_755_c1 nmdc:mga06r32_755_c1_23812_24651 279
1661 3300050511 nmdc:mga08y16_108_c1 nmdc:mga08y16_108_c1_52530_53369 279
1662 3300050511 nmdc:mga08y16_2951_c1 nmdc:mga08y16_2951_c1_7345_8184 279
1663 3300050512 nmdc:mga0n895_25991_c1 nmdc:mga0n895_25991_c1_3346_4185 279
1664 3300050512 nmdc:mga0n895_265_c1 nmdc:mga0n895_265_c1_21461_22300 279
1665 3300050512 nmdc:mga0n895_37633_c1 nmdc:mga0n895_37633_c1_1859_2698 279
1666 3300050513 nmdc:mga0rr50_12610_c1 nmdc:mga0rr50_12610_c1_4384_5223 279
1667 3300050513 nmdc:mga0rr50_19659_c1 nmdc:mga0rr50_19659_c1_1394_2233 279
1668 3300050513 nmdc:mga0rr50_642_c1 nmdc:mga0rr50_642_c1_5536_6375 279
1669 3300050515 nmdc:mga0a205_1049_c1 nmdc:mga0a205_1049_c1_12366_13205 279
1670 3300050515 nmdc:mga0a205_146_c1 nmdc:mga0a205_146_c1_21233_22072 279
1671 3300050515 nmdc:mga0a205_21581_c1 nmdc:mga0a205_21581_c1_707_1546 279
1672 3300053077 Ga0495601_0000355 Ga0495601_0000355_10309_11148 279
1673 3300053077 Ga0495601_0017539 Ga0495601_0017539_295_1134 279
1674 3300053077 Ga0495601_0033848 Ga0495601_0033848_329_1168 279
1675 3300053077 Ga0495601_0083171 Ga0495601_0083171_1205_2044 279
1676 3300053077 Ga0495601_0163327 Ga0495601_0163327_26_865 279
1677 3300053078 Ga0495612_0001097 Ga0495612_0001097_4733_5572 279
1678 3300053078 Ga0495612_0007774 Ga0495612_0007774_3269_4108 279
1679 3300053078 Ga0495612_0040958 Ga0495612_0040958_593_1432 279
1680 3300053084 Ga0495595_0000554 Ga0495595_0000554_4996_5835 279
1681 3300053084 Ga0495595_0001043 Ga0495595_0001043_6761_7600 279
1682 3300053084 Ga0495595_0002582 Ga0495595_0002582_1090_1929 279
1683 3300053085 Ga0495619_0000048 Ga0495619_0000048_58018_58857 279
1684 3300053085 Ga0495619_0000256 Ga0495619_0000256_34398_35237 279
1685 3300053085 Ga0495619_0001353 Ga0495619_0001353_14368_15207 279
1686 3300053085 Ga0495619_0005007 Ga0495619_0005007_1028_1867 279
1687 3300053085 Ga0495619_0014512 Ga0495619_0014512_1544_2383 279
1688 3300053728 Ga0500657_054402 Ga0500657_054402_288_1127 279
1689 3300060353 Ga0501082_0050188 Ga0501082_0050188_399_1340 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08501

Shikimate_dh_N

Shikimate dehydrogenase substrate binding domain

56

137

0.98

PF18317

SDH_C

Shikimate 5'-dehydrogenase C-terminal domain

287

312

0.95

PF01488

Shikimate_DH

Shikimate / quinate 5-dehydrogenase

165

242

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2egg-assembly1.cif.gz_A crystal structure of shikimate 5-dehydrogenase (aroe) from geobacillus kaustophilus 0.9171 2 273
3sef-assembly2.cif.gz_C 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. n16961 in complex with shikimate and nadph 0.909 6 275
3jyo-assembly1.cif.gz_A quinate dehydrogenase from corynebacterium glutamicum in complex with nad 0.9062 6 273
3sef-assembly2.cif.gz_C 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. n16961 in complex with shikimate and nadph 0.8984 6 275
2cy0-assembly1.cif.gz_B crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with nadp 0.8962 6 276
ID Description Score Start End Superfamily
af_Q2FXY1_2_97_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9412 8 100 3.40.50.10860
af_P0A6D5_8_104_1.10.560.10 Mainly Alpha;Orthogonal Bundle;GROEL; domain 1;GroEL-like equatorial domain 0.9398 6 100 1.10.560.10
af_P15770_4_98_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9372 9 99 2.40.10.10
af_I6Y120_6_102_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9303 6 100 3.40.50.150
af_P0A6D5_3_112_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9275 1 108 3.40.50.10860
ID Description Score Start End GO Terms
AF-I5BWP7-F1-model_v4 Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) 0.9744 2 278 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009117
GO:0009423
GO:0019632
GO:0047429
GO:0050661
AF-A0A2D5TG25-F1-model_v4 Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) 0.9733 6 271 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0019632
GO:0050661
AF-A0A1M7E2Q4-F1-model_v4 Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) 0.9703 8 271 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0019632
GO:0050661
AF-A0A520NVJ4-F1-model_v4 Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) 0.9686 2 274 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0019632
GO:0050661
AF-A0A5C8SJ88-F1-model_v4 deleted 0.9685 1 278

Feature Viewer

pLDDT pTM Quality
95.45 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map